Last modified Dec. 3, 1999 (138 different sequences, 128 from D. melanogaster))
These have been unified into contigs. Internal asterisks are used to indicate
exon boundaries. I am starting to analyze the new Drosophila genomic sequence
from Celera see the N-terminal alignment for 82 distinct genes. 59 are full length.

CYP4C3 complete AL072439 AI457023 AI296945 AI106780 AL051651
AC007974 clone BACR48H21 U34323 AC008219 AC014779

MAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIE*
MNVDHDELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVE*
PILNSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRK*
ILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVC*
ETAMGRRIYAQSNSESEYVKAVY
GIGSIVQSRQAKIWLQSD
FIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNN
APDAYDDVGKKKRLAFLDLLIDASKEGTVLSN*
EDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLE
CCIKDSLRLFPSVPMMAKMVGEDVN*
IGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYI
PFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD*

AA952162 AI388993 AA538617 AA439290 AA940746 AA941522 AI106700 45% to 4c3
RLFPSSPCLAFAHADGVDLNFGGQLVACRLEAI 370

AC007928 Drosophila melanogaster chromosome 3 clone BACR04O02
47% with 4C14 probable 4 family member may be in new subfamily I-helix to heme
AC007809 Drosophila melanogaster chromosome 3 clone BACR45M03 (D718)
AC007809 AA698109 AL060049 AL076303
intron exon boundaries from C-helix to I helix not certain
MLTINLLLAVGALFWIYFLWSRRSKLYFLMLKIPGPIGLPIL
GSSLENIITYKR*YGSTILTWMGPVPFIVTRDPKVVEDIF
SSPDCHNKSQHIVNAITSCMGNGLLGKIDPHWLDRRKHFNPSFKQDLLLS
FFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAA*
ETTMGSEVKHDEHFKNGSLV
NRKRNFKQTETNFIYLKCDNPIHFYRLISHSTLNILMPLVQNRMIS
KICGYDKLRADNFSRIQKMLDNV
VNPLPKTDSDPESNIVINRAMELYRKGDITYM
DVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQ
KLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGP
DADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIG 
SKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQRRG*

AC007724 Drosophila melanogaster chromosome 3 clone BACR30N15 C-helix
from one small fragment of unordered sequences, this might be real 7042-7600
PMGFPFIGLNVFTQVRYACVPFYLKYME
KR*YGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLL
*VSIDNHWNERRKLLLPSFKNNAVLSFVPVLN
NEANFLVTLLAEFVDGGDINLLPELNKWSFKIAA*

AC007724 Drosophila melanogaster chromosome 3 clone BACR30N15 (D693) RPCI-98
119054 SHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLRLMP 119233
119234 SVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSKAAQFNPENFLPEKIHD 119413
119414 RHPYAFIPFSKGKRNCIG 119467
XKLALIKILRNYKLKTSFPYKNLEFVDHMVIKLAQSPQLAF*


 Score =  125 bits (310), Expect = 1e-28
 Identities = 55/89 (61%), Positives = 68/89 (75%)
 Frame = -3

Query: 71     RXLNETLRLMPSVPFSSRETLEDLRXSXGVVIPKGMTFSIDIFNTQRNTXXWGSEAAQFN 130
              R +NETLR +PSVPF+ RET  D R S GVVIPKG+   IDIF T RN   WG++ + FN
Sbjct: 100724 RVVNETLR*IPSVPFTPRETKRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFN 100545

Query: 131    PENFLPEKIHDRHPYAFIPFSKGKXNCIG 159
              P++FLP+ + DRHPYA+IPFSKG+ NCIG
Sbjct: 100544 PDHFLPDNVRDRHPYAYIPFSKGRRNCIG 100458

AL076582 AL074717 AL072640 N-term to C-helix also AC007724 71656-71049
MDTFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKR*
YGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEGN
KWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIAT*
ETTVGTDVKKDASFKNDSVL (this last line is the ETAM exon)

GQLTP***STPSYLLLLI*PQNHFHFRIKPLPNSLRQNSV*NHSKVFVYFVFGLESLPWIRFNCF*PWECVSGYTSYGVVAGSI*C
TLRYQDQWDYQFWA*PLSI**PINVNFEYTS*KGSGLIEHFVNTLGKMSIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLS
PECLNRSSIFSKPVNSCTGDGLLSLEGNEN*ALTYTLITYFIYVSI*MG*SSQELKSGIQAKCFDEFSSHLQL*GENFSCLPGLTC
RSG*KKGPRRHSEMVF*NSHS*VKSALKWDVMSTAILYHFSTETTVGTDVKKDASFKNDSVLKSYET*VLPIAQKCSNNIQSFLYF
*VYENNCYECFVAIHSQQDIFNTGRI*NAESFGQVQC*QNDRHGEFCLA*LH

RSAYTLVIKHTVIPIIINLTTESLPLSYKTFAEFAEAKQCLEPLQGVCLLRVRIRVLTMDTFQLLLAVGVCFWIYFLWSRRRLYMM
HFKIPGPMGLPILGIAFEYLITYKREF*IHFIERQWIN*TLCEHFR*NEHTNQVYGYLRLHMFGVGGTDAICNHSGSKDCRGNLFV
PRVPK*ELDIFQAG**LYRRWIIIIRG**KLGFNLHINNIFHLC*HLNGLIVART*IRHSSKMF**VFFPSSIMRRKL*LPSWTHL
SVRVKKRSATT**DGLLE*PLVSEVCAKMGCDVYCNIVSFFHRNHSGN*CKEGCVLQERFSFEKLRDVSVTNCAKV**QYPKLLVL
LGL*K*LL*MFCCHSLTTRYFQHWADLKRRKLWPSPMLTK**AR*VLLGLIA

KVSLHPSNKAHRHTYYY*FNHRITSTFV*NLCRIR*GKTVFRTTPRCLFTSCSD*SPYHGYVSTAFSRGSVFLDILPMESSPALYD
AL*DTRTNGITNSGHSL*VSDNL*T*ILNTLHRKAVD*LNTL*TL*VK*AYEPSIWIFTAPHVWCGWDRRHL*SLGIQRLPRKSFC
PQSA*IGARYFPSRLIAVQEMDYYH*RVMKTRL*LTH**HISFMLASKWVDRRKNLNPAFKQNVLMSFLPIFNYEAKTLVAFLDSL
VGQGEKKVRDDIVRWSFRIATRK*SLR*NGM*CLLQYCIIFPQKPQWELM*RRMRPSRTIQF*KVTRRKCYQLRKSVVTISKASCT
FRFMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKSNVNKMIGTVSFAWLNC

Cyp4d1 AF016992 see also AF016993 to AF017004,
CYP4D1 HAS ALTERNATIVE SPLICING
MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGN
AHIFLGLTPAEACLKIGELAERHGDTFGLFLGPSYSVMLFNPRDVERVLG
SSQLLTKSQEYSFLGRWLNEGLLVSNGRKWHRRRKIITPAFHFRILEPYV
EIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICETA*MGVSIN
AQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNV
LHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVD
ERPLSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIR
SVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEIN
GKLIPAGTNIGISPLYLGRREELFSEPNSFKPERFDVVTTAEKLNPYAYI
PFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELIL
RTKEPLMFKVRERVY

CLOSEST FIRST 4D1 EXON (NOT USED, SKIPPED IN 6/7 ESTS) AI062205
MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFI
GKPPHEMVKKIFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLR
FNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFHFKILDQFVEVF
EKGSRDLLRNMEQDRLKHGESGFSLYDWINLCTMDTIC

MORE DISTANT FIRST CYP4D1 EXON (THIS ONE IS USED) 6 ESTS MATCH THIS ONE
AI257879 AI406141 AI295319 AI064088 AI387842 AI135092
MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGN
AHIFLGLTPAEACLKIGELAERHGDTFGLFLGPSYSVMLFNPRDVERVLG
SSQLLTKSQEYSFLGRWLNEGLLVSNGRKWHRRRKIITPAFHFRILEPYV
EIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICETA*

AC015418 = AI261013 in ordered fragments 46% to 4D1
91-492 2330-378 missing 56 N-terminal amino acids
2330 ELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRK 2127
2126 LLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGI 1950
1949 KKHAQLQSDSEYVQAV 1902
1849 HSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQL 1676
1675 IQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGH 1508
1507 DTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLR 1355
1354 IYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNE 1181
1180 KQMHPFAFAAFSAGPRNCIG 1085
533 QKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRILPRDENGTTA*
378

Cyp4d2 Al009194 14092-15781 also X75955, AL023401 Cyp4d2 STS
missing N-terminal first exon in this genomic DNA
AI113485 GH09810, AA697893 HL03421
MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLD
PEQIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKN
NLYKLLNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSA
VMVEQLQSRADGMTPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYV
QAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMHDFTENI
IRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED
IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRK
SPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGT
NFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPYAYIPFSAGPRNCI
GQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSMNIVLRSANGVHLGLKPRA

AI402187 GH09810 94% identical to Cyp4d2 7 diffs probably is 4d2
PPVPMIGRWFAEDVEKRGKHIPAGTNLTMGIFVLPRDPEYFESPDEFRPE
RFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRQFELLPL
APEPRQLMNIVLRSANGVHLGLKPRA

Cyp4d8
AI403093 GH22459.5prime GH head pOT2 Drosophila 51% to 4d2
AC010113 chromosome 3L/66A5 clone RPCI98-10H23
AC010557 chromosome 3L/65F1 clone RPCI98-9E21
AC010112 chromosome 3L/71C3 clone RPCI98-9C21
AC010015 chromosome 3L/71C3 clone RPCI98-9C21
U34329 only three diffs with AC010113 above
MLLFLLVVLLFGAGWIIHLGQADRRRKVGNLPGPICPPLIGAMQLMLRLNPK
TFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGN
GLLLKDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDV
YRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNE*
CTALLSWRFMSVYLQVELLFTLTHPHLKW
RQTQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKR
RMALLDVLLMSTVDGRPLTNDEIREAVDTFM
FEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTTRSRP
VSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYS*
DGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHE
NGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQRVECIVNIVLR
SETGFQLGMRKRKHN*

AC004717 DS01529 also AC005834 comp(100737-101282) P1s DS01589 DS02501
44% to Cyp4d14, 46% to 4d2, 39% to 4d10, 38% to 4d1, probable new subfamily
AA698702 AA567823 AA698531 AI405296
MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALT
LRPENFIQRFGDYFN*KYGKTFRLWILGECLIYTKDLKYFESILSSSTLL
KKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKCLENFVEIMDR
NSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTT*ETAMGVQVNAQNEPN
FPYTKALK*SVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQKDIAIMQD
FTDKVIRERRAILERARADGTYKPLSTLT*DDIGGKAKMTLLDILLQATI
DNKPLSDVDIREEVDVFIFAGDDTTTSGMSHALHAISRHPKVQECISEHV
VSVLVPDPDASVTQTKLLEVKYLECVIKQTMRLHPPVPILGRYIPEDLII
GEIAIPGNTSI*LMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTPPLAY
IPFSSGPKNCIGQKFANLQMKALISKVIRHYELLPLGADLKATYTFILSS
STGNNVGLKPRTRVK*

AI106625 AI517120 N-term 65% to AC005834
AC010015 Drosophila melanogaster chromosome 3L/71C3 clone RPCI98-9C21
AC010014 Drosophila melanogaster chromosome 3L/62E5 clone RPCI98-19D21
AL078839.1|CNS00LWJ BAC:BACR48N09 C-term 63% to AC005834
MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWV
GEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVST
GRKWHARRKIFTHAFHFKVLEHYVEIMDRHSNVMVDNL
RKVADGKTAVDMLKYVSLAALDVIT*
EAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIR
VMHDFTDKVISERRETVRRAKADGTYRPLSGCT
AEIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSSG 
VSHALYAIARHPEVQQRIFEELQRVLGPDASASGTQAQLQDLKYLDCVIKETMRLY 
PPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGH
NTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLTFILRSASGIN
VGLRPRKALR

AC010113 Drosophila melanogaster chromosome 3L/66A5 clone RPCI98-10H23, Query: 18             
113685-114071 N-term
MILTATFICFCLASAFNY (from AC010557 65609-65663)
FRARRQRSLIKNLKGPFTWPLMGAMHKLLFLTAGRFLSAQT 113855
EYLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQS 114029
EQWQKRHSLISGLF 114071
114541-115249 C-term
KDHKSLLEILLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQK 114714
CLDELNLAQIKDQGWDLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFP
VGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQR 115041
YSLGPRCCPARKFSMQLLKTLLAPILGNFEVLPYGDEVRLDLRLVLGSSNGFQLALKPR 115249

Cyp4d10 U91634 Drosophila mettleri

MSLSLPPLIAVACLVVALARISWLPLRSWLRRRRRTHQLAAQLPGPRNLP
LLGNFHMFFGLEPWQVPHLINQLAKKYDGTFKLKMGSNFSLMMFQPRDIE
VVLGSSQLLDKAVEYSFLRGWLNDGLLLSGGRKWHRRRKIITPAFHFRIL
ESYDEIFDRQTRLLIHKWQQTLGHSFDLGHDVHLFTLDVICETAMGVSTN
AQTNADSDYVRAVKTISTVLHKRMFNIFYRFDLTYMLTPLAWAERRALNV
LHKFTEKIIVQRREELLRGGVTQTTDGADVGAKSKMVFLDILLQSNIDDK
PLTNLDIREEVDTFMFEGHDTTSSGITFFFYNIALYPECQRKCVEEIVSV
LGKDTETPVTYDLLNNLNYMDLCIKETLRMYPSVPLLGRKVLQECEINGK
IIPAGTNIGISPLFLGRSEDISSEPNTFKPERFDVVTSAEKLNPHAYIPF
SAGPRNCIGQKFAMLEIKAIAANVLRHYEIEFVGNAEESPVLIAELILRT
KDPLMFKLKKRVI

AC010003 Drosophila melanogaster chromosome 3L/75B13 clone RPCI98-6L11,
244-509 66531-67394 = AC0015424 AC007573 AC009369

MFWLGFGLLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGHLHILAKLVGPHPLRRATEMINEHLHDHRAKLWMGTKLYLVDCNPKDIQALCSAQQLLQKTNDYRVFENWLCEGLFTSGFEKWSHRRKIVMPAFNYTMIKQFVAVFEKQSRILLTNVAKFAESGDQIDFLQLISCFTLDTICETALGVSVGSQSSAKSEYLDAVKS*ILVIIDKRLKNIFYRNSFIFKRTSHYKR

EQELIKTLSGFTEGIIQKRIDEINQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDG

MFLTVKDIREEVDS

FLFGGFDLTATTLNSLMYNMTLHPEHQQRCREEVWSVCGKDKSEPISIEQVRQLEFLEAC

IKETLRMYPSGPLTARKATANCTISKYIIPKGSDVIISPI

YMGRCKDFFPDPMVFKPDRWAIGAEPKLRHHF

FIPFMAGARSCMGQRYAMVMLKMVLAHLLRNFLFEPLXERQVELKLNFVITLHTVDPIYVELK

Cyp4d14 AL009194 152A3.2 comp(10682..12421) 55% identical to Cyp4d2

MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLIN
ESPKTIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQ
KNNLYSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQ
SATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMGVKINAQLQPQFT
YVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLNDAVKNMHDFTN
SVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL
SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIG
DDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLI
PADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAG
PRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVLNVILRSTTGINC
GLKPRVY

Cyp4e1 K00045, AC005451 22741-24838 AI135768 AI293313
AI108382
MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGN
TP*TEILNRFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLI
SKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNE
NSTKFIDQLKKVADGGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSS
SVVQAFKD*ITYTFNMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTN
EIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRPLTSQELY
EEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGR
DATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVIDGDIVPKGTT
LNLGLLMLGYNDRVFKDPHKFQPERFDREKPGPFEYVPFSAGPRNCIGQK
FALLEIKTVVSKIIRNFEVLPALDELYDPILSASMTLKSENGLHLRMKQR
LVCDST*

Cyp4e2 U56957, X86076, U34332 AC005451
AA949109 AI404961 AI405011 AI546418 AI062772 AI403566
AI062848 AA141362 AA142039 AA940590 AI511759 AA940642
AA141985 AI388306
MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGN
AHQMGKNPSEILDTVFSWWHQYGKDNFVFWIGTYSNVLVTSSKYLEF
ILSSQTLITKSDIYQLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQ
DFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSI
NAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLK
TLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRP
LNSKELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVM
GNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVIDGD
LVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFEYVPFSAGP
RNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAE
RKKRDPYRHKYDPILSAVLTLKSENGLYIRLKERH

AC007291 Cyp4e3 BACR02I05 comp(115634-117642) also U34330

MWLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGK
NP*TEILSTFFDWWYDYGKDNFLFWIGYSSHIVMTNPKQLE*YILNSQQL
IQKSTIYDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMN
ENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRD
SSIVQAFREMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTY
DIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIY
EEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRS
VSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDLDGSIVPKGTTL
NLALILLGYNDRIFKDPHHFRPERFEEEKPAPFEYLPFSAGPRNCIGQKF
ALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGR
HKYDPILSAVLTLKSDNGLHLRLRERRS*

Cyp4e4 AL009194 152A3.6 16210-17867 also U34331
AI405607 AI404522 AL051240
MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAWQMR
SFQPDNLHDKFAEYVKRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQHQL
KKGTMYFALRGWLGDGLLLSRGKEWHTMRKIITPTFHFSILEQFVEVFDR
QSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAMGVNVDAQGADSE
VVHAVKDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQAGVICLHEFTN
GIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPLTDKQIRDEVNT
FIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSD
FATLPYLSCVVKESLRLYPPIPAVARCLEKDLVIDEGYIPVGTNVVVLLW
QLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIGQKFAL
LEMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRPRLY

AC005451 comp(14729-16905) AC005415 ESTs AA202364 (LD02646) AI297753
36% to 4e1, 37% to 4e2, 37% to 4e5, 35% to 4e3, 33% to 4e4 probable new family
MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQF
GLKPAEYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSL
LYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVH
RTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENATGQDSSSLNGET
SDLHGAIKDLCDIVCENAVVQERTFSIVKRFDALFKFSQYRARINKTPKL
ITSQIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIE
EVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEA
DLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDLDGTKVAKCTTVI
MCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIG
EKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVL
NIRVTLKSENGIQIRLRKR*

Cyp4e5 U78486 Drosophila mettleri

MWFIVYILLALPIMLFVFLSCEWPKRNDAEQIEWSSGVPFLGNAHQMGKT
PAEILNTFFEFWHKYNKDNFRIWIGYYANILVSNPKHLEVIMNSTTLIEK
LDIYDMLHPWLGEGLLTSKGSKWHKHRKMITPTFHFNILQDFHQVMNENS
AKFIKRLKEVSAGDNIIDFQDETHYLTLDAICDTAMGVTINAIEKRDTVD
VVKAFKDMCHIINMRAFRPLQRSDFLYRFSPEYATYAKTLKTLKDFTNDI
IAKRIKVHRTAAAKTNQEGSEFSRKKMLPDTLLSATIDGRPLNQQEIYEE
VSTFMFEGHDTTTSGVAFAGYILSRFPEEQRKLYEEQQAVMGNELNRDAT
FQEISAMKYLDLFIKEAQRVYPSVPFIGRYTDKDYNIHGTIMPKGTTLNL
GIIVLGYDDRVFEEPHRFYPERFEKQKPGPFEYVPFSAGPRNCIGQKFAL
LELKTVISKLVRTFEVLPAVDELVSKDGNLNTYVGLPKEEKERKERMGYK
YDPILSAVLTLKSENGLHLRLR

Cyp4g1 AL009188 also U34328,
AI134468 AI238257 AI107737 AI134464 AI516961 AI106721 AI402621
AI063157 AI389355 AI517399 AI108390 AI063322 AI109353 AI517684
AI107940 AI402779 AI402886 AI402810 AI238329 AI135715 AI133930
AI293299 AI108856 AI064278 AI292972 AI292892 AI135496 AI062067
AI064555 AI107765 AI109996 AI107207 AI135779 AI110101 AI387969
AI403655 AI404082 AI293025 AI107892 AI107173 AI292654 AI109079
AI063239 AI292944 AI293033 AI386573 AI514270 AI238755 AI109680
AI106986 AI135407 AI389454 AI113770 AI109410 AI108845 AI517484
AA694758 A1404254 AI063697

MAVEVVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSRE
YRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLG
NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRH
HRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTT
VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYK
FTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPA
SKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEV
NTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTF
ADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVI
VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGR
KYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLEKR
QYATVA

AL067059 (BACR015N20), AL057969 (BACR024M08) Drosophila melanogaster
genome survey of
301-454 comp(143-604) probably new family
MSLMFLGAECSSMVLAAFETSAHSVFFALVLLAMFPEHQXLVFXXFKEHFLLAKG
IEVTHTVLQX 425
LXFXVRXLNETLRLMPSVPFSSRETLEDLRXSXGVVIPKGMTFSIDIFNTQRNTXX
WG 251
SEAAQFNPENFLPEKIHDRHPYAFIPFSKGKXNCIG 143

Cyp4g15 AC013897 AI403684 AI388987 N-term AI134510 Cyp4g15 C-term

MEVLKKDAALGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFD
VIGPASSVFRTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFF
KPWLGDGLLISTGEKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDC
HDYMSEATVEILLGE*TAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFGFT
LTRYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQNGGVDQ
TPSTAGSDEKDREKDKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESA
QNGALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQR
PATFQDTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLL
HRNPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVG*RKYAMLKLKILLSTIL
RNYRVYSDLTESDFKLQADIILKREEGFRVRLQPRTS*

Cyp4p1 U34327, AC008186 comp(2-88, 148-465) EST AI293255

TSIGLIFGLMNMSLNPDKQELCYQEIQEHIDDDLSNLDVGQLNKLKYLEY
FMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHRNAKY
WDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLMV
VLLKQFKVLKAIDPQKIVFHTGITLRTQDKIRVKLVRRT*

Cyp4p2 AL055774 BACR021H19 80% identical to Cyp4p1
ETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMFTG
HKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDM*KETFAML
DTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQ
ELCYQEIQEHIXDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQT
LQETELENGLILPKRSQINIHVFDI

Cyp4p3 AC008186 48361-48564, 48626-49174 Drosophila
chromosome 2 clone BACR10M14 (D583) RPCI-98
No ESTs GSS AL063060
FAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGVVLGKRNMSLYAAEQNLC
SQEIQEHIXDDLSNLTLSQLSKLNYLGYFIKETRRRYLSIPIMGRQTLQEPELENGLFLPKRSQINI
HVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGK
KYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRRNCV*

N-terminal of Cyp4p sequences, cannot match up these N-terms with C-terms
Except that N-term B follows directly after Cyp4p3 so it is not the 4p3 N-term

N-term A AI389883 56% to 4p Nterm about 15 aa short to overlap with AL055774
MMICLLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKP
LDSLVPMIKGRTVFANCFDLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGF
SNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTATEKKWHTRR
SMLTRTFHLDILNQFQEIFIAESLKFVSQFQGQNEV

N-term B follows Cyp4p3 sequence on AC008186
MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFD
LYGKDHAGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLRTGLLTSTG

N-term C AI405947 GH26104, AI109737 GH09012
2 mismatches with AL055774 Cyp4p related
AL063060 BACR006L24 (N-term part) N-term of 4p sequence
Note: there may be alternative splicing in this gene since exon three
Starting with KKWHARR does not match genomic sequence AC008186
However, EST AI389883 does match this genomic sequence exon 3
but not exons 1 and 2
MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDG
TPVEIIAPIAKGKTIFGNTLDLYGRDHAGVFNYSRERAKEMGTSYIEYVF
GKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTSTGKKWHA
RRKMLTPTFHFNILNQFQEIFKTESQKFLLQFEGQDEVTITLHDVIPRFT
LNSICETAMGVKLDEMAEKGDRYR

AC007149 Drosophila melanogaster chromosome 2 clone BACR49A03 (D586) RPCI-98
              49.A.3 map 33A1-33A1 strain y; cn bw sp, WORKING DRAFT
              SEQUENCE, 83 unordered pieces
              Length = 123109
              
This may be part of the missing end of 4p2 since N-term B follows 4p3
There is only one difference with 4p3
Query: 446    KYAMQEMKTLMVVLLKQFKVLKAIDPQKIVFHTGITLRTQDKIRVKLVRR 511
              KYAMQE+KTLMVV+LK FK+L  IDP+ IVF  GITLR ++KI+VKLVRR
Sbjct: 104464 KYAMQELKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRR 104661

This is the same as N-term C
Query: 1      MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGK
              MIILWLILALSALLYWLHRANKDYHILSFFTKRIRL DGT VEIIAPIAKGK
Sbjct: 105098 MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLNDGTSVEIIAPIAKGK

Query: 49     TIFGNTLDLYGRDH 66
              TI+GNTLDLYGRDH
Sbjct: 105241 TIYGNTLDLYGRDH 105294

hybrid full length Cyp4p sequence made of 4p1, 4p2, 4p3 parts
MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDG
TPVEIIAPIAKGKTIFGNTLDLYGRDHAGVFNYSRERAKEMGTSYIEYVF
GKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTSTGKKWHA
RRKMLTPTFHFNILNQFQEIFKTESQKFLLQFEGQDEVTITLHDVIPRFT
LNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYN
MFTGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDM*KET
FAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLY
AAEQELCYQEIQEHIXDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIM
GRQTLQETELENGLILPKRSQINIHVFDIHRNAKYWDSPEEFRPERFLPE
NVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLMVVLLKQFKVLKAIDPQ
KIVFHTGITLRTQDKIRVKLVRRT*

AL063060 this fragment spans the C-term of one gene and the N-term of another
Query: 165 PFSAGQRNCIGK------------------------KYAMQEMKTLMVVILKHFKILPVI 200
           P SA QRNCIGK                        KYAMQEMKTLMVVILKHFKILPVI
Sbjct: 28  PXSAXQRNCIGKSTSLQNIRFSYICVLSISFNHKGQKYAMQEMKTLMVVILKHFKILPVI 207

Query: 201 DPKSIVFQVGITLRFKNKIKVKLVVR 226
           DPKSIVFQVGITLRFKNKIKVKLV R
Sbjct: 208 DPKSIVFQVGITLRFKNKIKVKLVRR 285

Score =  139 bits (346), Expect(2) = 3e-78
 Identities = 66/66 (100%), Positives = 66/66 (100%)
 Frame = +3

Query: 1     MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLD 60
             MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLD
Sbjct: 49611 MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLD 49790

Query: 61    LYGRDH 66
             LYGRDH
Sbjct: 49791 LYGRDH 49808

Score =  174 bits (437), Expect(2) = 3e-78
 Identities = 89/94 (94%), Positives = 90/94 (95%), Gaps = 21/94 (22%)
 Frame = +2

Query: 67    AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLR 126
             AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLR
Sbjct: 49868 AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLR 50047

Query: 127   TGLLTS---------------------TGKKWHARRKMLTPTFHFNILNQFQEIF 160
             TGLLTS                     TGKKWH RR MLT TFH +ILNQFQEIF
Sbjct: 50048 TGLLTSTGELDCGFITRRYSSYYRTPFTGKKWHTRRSMLTRTFHLDILNQFQEIF 50212

1 N-terminal =

MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLDLYGRDH*
AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTST*
GKKWHTRRSMLTRTFHLDILNQFQEIF

 Score =  199 bits (500), Expect = 2e-50
 Identities = 93/132 (70%), Positives = 109/132 (82%), Gaps = 2/132 (1%)
 Frame = -3

Query: 350 IQEHIXDDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRS 409
           +     DD+SNL++ QL+KL YL YF+KET RL+PS+PIMGR+ +QETEL NGLILPK +
Sbjct: 483 LMRSFSDDMSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGA 304

Query: 410 QINIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEM 469
           QI IHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGK+ +   +
Sbjct: 303 QITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKRRSRFSL 124

Query: 470 KT--LMVVLLKQFK 481
               LM+  + Q K
Sbjct: 123 SNDFLMIAFILQVK 82

DDMSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGA
QITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIG
KKYAMQEMKTLMVVLLKQFKVLKAIDPQ

 Score = 59.7 bits (142), Expect = 2e-08
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = -2

Query: 461 GKKYAMQEMKTLMVVLLKQFKVLKAIDPQ 489
           GKKYAMQEMKTLMVVLLKQFKVLKAIDPQ
Sbjct: 88  GKKYAMQEMKTLMVVLLKQFKVLKAIDPQ 2

Score = 90.9 bits (222), Expect = 8e-18
 Identities = 43/84 (51%), Positives = 55/84 (65%)
 Frame = +3

Query: 1      MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLD 60
              M+ILWL+ A   L+ W++R N+DY IL FF KRIR K+G   E IAP+ KG TIF N+ D
Sbjct: 124743 MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFD 124922

Query: 61     LYGRDHAGVFNYSRERAKEMGTSY 84
              LYG+DH  +F  S      + TSY
Sbjct: 124923 LYGKDHCKLFGGSFAGLSMLMTSY 124994

MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFD
LYGKDHAGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLRTGLLTSTG

 Score =  107 bits (265), Expect = 7e-23
 Identities = 50/68 (73%), Positives = 57/68 (83%)
 Frame = +1

Query: 67     AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLR 126
              AGVF +SR+ AK++G SY EY  G AIYN+IDADSAE VLN PNLI KG +Y+FLHPFLR
Sbjct: 125023 AGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLR 125202

Query: 127    TGLLTSTG 134
              TGLLTSTG
Sbjct: 125203 TGLLTSTG 125226

Score = 63.2 bits (151), Expect = 2e-09
 Identities = 21/51 (41%), Positives = 41/51 (80%)
 Frame = -1

Query: 3     ILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKT 53
             +LW+ +A+  +++W+++ NKDY+IL+FF +R++ KDG P++ + P+ KG+T
Sbjct: 98294 LLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRT 98142

AL063060 frame 1 contains C-term of one gene and
frame 2 has N-term of another
frame 1 possible C-term of Cyp4p2
XXGSITPTFPXSXXQRNCIGKSTSLQNIRFSYICVLSISFNHKGQKYAMQ
EMKTLMVVILKHFKILPXIDPKSIVFQVGITLRFKNKIKVKLVRRNCV*
frame 2 possible N-term of Cyp4p1
MIXLWLILALSALLYWLHRANKDYHILSFFTKXIXLXDGTPVEIIAPIAK
GKTIXXNTLDLYGR

AC008324 Drosophila melanogaster chromosome 2 clone BACR25K01 (D854)
Length = 122061 this sequence is identical to AC008003 from the EECNK exon on
But the C-helix exon before this does not match

Gene 1 76245-78135 38% to 4d14 N-term is also on AC008325
MFLEVLFAAPLVIFIFRKLWAHLNRTYFILSLCKRIRTEDGSLLESKIYVAPSKTRFGNNFDLVNFT
TESIFNFMRDASAKAKGRNYLWYFFHAP
MYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFK
EECNKLVKVLHQSVNMELELNQVIPQFTLNNVC
ETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFGDYRKQV
NNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQI
DHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQ
FNELVYMECVIKESLRLFPSVPFIGRQCVEETVVNGMVMPKDTQISIHLYEIMRDARHFS
NPDLFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVT
LLDDLTFENGIVLRTKQNIKVKLVHRENK*

Gene 2 78359-79584 gene runs off end of fragment EST AA567719 matches until
FLFAP then diverges this may indicate alternate splicing with a third gene
Downstream of this one.
MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLT
PANIFSYIRESTAKANGQNYIWNFLFAP
MYNVVRPEEAEEVFQSTKLITKNMSYELIRPFLGDGLLISTDHKWHSRRKALTPAFHFNVLQSFLGIFK
EESKKFIKILDKNVGFELELNQIIPQFTLNNIC
ETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRK
RQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTT
STSLIFTLLL

AA567719 AA697618 AI517752, AL108342 ETAL exon matches may extend (many Frame shifts)

MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGS
PLESKVFVVPGKTRFGNNLDLLNLT
PANIFSYIRESTAKANGQNYIWNFLFAP
EYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIF
KEESQKFIKILDKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQR

AC008003 Drosophila melanogaster chromosome 2 clone BACR48D02 (D851)
Length = 161114 same sequence as AC008324 gene 2 except for C-helix exon
AI517752 GH28810 AA567719 HL01677 ETAL exon matches AI404516 GH24257 but not before
QKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNIC
ETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIH
GFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMF
GGYDTTSTSLI

AC008325 Drosophila melanogaster chromosome 2 clone BACR05M06 (D855) RPCI-98
Length = 129759
AI404516 AA698190 76% to AI517752 same as AC008325

MWIALLGIPILLAVLTLLLKHINKTYFILSLTKRVRTEDGSPLESKVAIMPGKTRFGNNL
DILNFTPASVFNFVRESTAKAKGQNYLWYFLYAPMYNVVRPEEAEEVFQSTKLITKNVVY
ELIRPFLGDGLLISTDHKWHSRRKALTPAFHFNVLQSFLGIFK
EECKKFLNVLEKNLDAELELNQVIPPFTLNNIC
ETALGVKLDDMSEGNEYRKAIH

Cyp6a2 M88009, S51248, U78088, AC007549
AI238008 GH13965, AI114198 GH10927, AA696656 GM08076
MFVLIYLLIAISSLLAYLYHRNFNYWNRRGLPHDAPHPLYGNMVGFRKNR
VMHDFFYDYYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNF
ADRGQFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVI
KVSEEFVKVITEQVPAAQNGAVLEIKELMARFTTDVIGTCRFGIECNTLR
TPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMRMMPEDVHQFF
MRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGE
LAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEG
QLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEK
GTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPR
NCIGMRFGQMQARIGLAQIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGI
YLRVERI

AL062684.1|CNS002GP Drosophila melanogaster genome survey sequence TET3 end of
43% to 6a2
LAGXXXSTTMGFTLYELACNQDVQDKLRAEIXSVLERYNGKLEYDSMQDLFYME
KVINESLRKHPVXAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEXY
PEPEKFIPERFDEEQVKRASHLRFPTFGAGPRNCIGLRFGRMQVIIGLALLIHNXRF
EXHPKTPVPMKYTINNLLLGSEGGIHLNITKVVRD*

AC010578 21500-20681 AA696094, AA803578, AA202305, AI546241
63% identical to AI063421

MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGELWRTMP
LAGILKRTYLKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDKF
HDRGVYHNDKDDPLTNNLATIEGQKWKNLRQKLTHTFTSAKMKSMFSTVL
NVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCNSLRDP
KAEFVQMGYSALRERRHGWLVDLLIFGMPKLAGELGFQFLLPSVQKFYMK
IVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAFV
FFLAG 20681

AI063421 GH03219 AI532649 SD04231, 63% identical to AA696094
LIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFA
DIFKRTYNKLRNKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHD
RGVFHNERDDPLSANLVNIDGQKWKTLRQKLTPTFTSGKMKTMFPTILTV
GDELIRVFGETASADSDSMEITNVVARFTADVIGSCAFGLDCHSLSDPKAKF

AA951440 LD31895, AA816508 LD01943, AA201305 LD04267
AI134994 AL076863, AL076873 (BACR039A20) AC010578
MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFI
DIVTPIYEKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDR
GMYHNERDDPLTGHLFRIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVG
EELTQVCGELADNAMCGILEIGDLMARYTSDVIGRCAFGVECNGLRNPEA
EFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVGIV
RETVKQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGFDTS
ASTLGFAXYELAKQP

AC010578 Drosophila melanogaster chromosome 2 clone BACR03K23 (D1086) RPCI-98
C-terminal region that could match with either AC010578 N-terminal
AI402220 exact match to AC010578 33500-34100 region AI258456 = Cyp6a17
EFLAQAIIFLGAGFETSSTTMGFGIYELGRNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTD
TDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRG
YKFSVSPETQIPMKIVVKNILISAENGIHLKVEKLAK*

L46858, AL061295 (BACR004K24) 52% identical to cyp6a5

EFTYDSMQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEP
GQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPR
NCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPAHGI
YLKVQQLSQMSS*

AL061650.1|CNS00613 Drosophila melanogaster genome survey sequence TET3 end of
370-507 comp(305-718) 60% to L46858
TLRGXPLLPRLTRFSGLLYAARGVRLFXFGPGLLLLXPVYGIXXVPALXPXPHRFI
PERX 539
LAGRLAPRPAAAWLPFGVGPRXCVGMGFGRVPAAVGLVGLLRIFRFGVCPRPGP
GVAFLR 359
SPFLLCPAXGFCLGVPRL 305

AA801503 HL02667 I-helix and before, 53% identical to Cyp12a2

TVQEYRSPNGFLLRLGRETSLYRYIPTPTYKKFSRAMDEIFDT
CSMYVNQAIERIDRKSSQGDSNDHKSVLEQLLQIDRKLAVVMAMDMLMGG
VDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHSEFTVEDMK

Dm0590 STS from DS07966-Sp6 in vector ad10sacBII, AL058810 (BACR003F22)
350-383 comp(931-1032) exact to Dm0590
DFLXAQAXSFEVAGIETCSASMSFALYELAKQPLMQSRLRREXREAFA
SNPNGRLTYEAVARMEFLDMVVEETLRKYPIVPLLERECT
419-505 comp(214-474)
PNPXRFNPXXFRCGEQALQXPXXYXPFGAGPXNCIGMQIGLLQIKLGLVYFLHQ
HRVEIC
DRTVERIQFDAKFALLASEQRIYLKVDCL*

AC007137 Drosophila melanogaster chromosome 2 clone BACR25C02
(D544) AI512580
306-457 K-helix to heme comp(85862-86538) exact match to W91838
attempting to assemble P450 sequence most like 6d1 missing some internal seq.

MWLLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGITWSFLQKAYRREFR
HVEAICEAYQSGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELK
WDYISGYRRFNLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQG
CPQEVDIQQKLRV*YSVNIIANLIYGLDINNFEHEDHILTSYLSHSQASIQS*
FTLGRLPQKSSYTYRLRDLIKQSVELREDHGLIRKDILQLLVRFRN*NRLM
VSFEVCIVKSCTNSLFLDADKLLSIKRLAKVAEDLLKVSLDAVASTVTFT
LLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLK*ETLRK
YPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKY
KPLRFLQTANDVGQCEDKTKSNVFIGFGIGGSQCVGTYRIQIILAMFRQY
FSHRNYRTELCKVGN*

Cyp6a8 L46859, AL054065, AI258590 LP01819, AI107730 GH05558

MALAYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQ
KTKNIHEIFQDHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDF
SNFSNKGIFYNEKDDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYP
TVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFAIQCNSLR
DEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFY
SRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEV
LAQAFVFFIAGFETSSSTMGFALYELAKNPDIEQHDQNFTYECTKDLKYL
NQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHH
DPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQAR
IGPALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVETV

AC008285 Drosophila melanogaster chromosome 3 clone BACR31P16 (D1002)
85740-87319 77% identical to 6a8 (this is a new 6a subfamily member)
AI403838 GH23364 80% to Cyp6a8 N terminal
MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQ
EYYNKYRNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH
LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVA
RFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLC
RNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEI
VAQAFVFFIAGFDTSSSTMGFALYELAKNPSIEQHDQKFTYECIKDLKYLDQVLSETLRH
YTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFSPEE
SAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATPDPLTFDPHSAI
LLGIKGGIQLKVEAI*

AC004721 Cyp6a16 DS03308 complete 2-455 comp(2956-5070) 47% to 6a8
MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETYDAF
RGSAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTANLFNLQGEEWRNL
RTKLSPTFTSGKMKYMFGTVSTVAQQLGGTFDELVAVLELHDLMARYTTDVI
GSCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLGLPVRI
LHPDITKFFNRIVRETVELRERENIRRNDFMDLLLDLRR
KGLTMEQMAAQAFVFFVAGFETSSSNMSYALFELAKNQDVQQKLRMEINDSIGKHG
KLTYEAMMEMPYLDQTI
PETLRKYPALSSLTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEP
HEFRPERFAPDACRERHPTAFLGFGDGPRNCIGLRFGRMQVKVGLITLLR
RFRFSLPPGSPTQLKVTKRNLILLPSDGVRLQVDPVESRLM*

Cyp6a9 L46860, AL054861, AL053264, AL072094, AL055555
AL070586, AL054261, AI257903 AL078165 AL069773

MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCE
EPHILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLD
ISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLLDGQKWKSMRSKLSS
TFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIG
TCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLH
MKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSES
GESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKE
CQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPDLNRECLEDYEV
PGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPIFFARTSEGSDSVE
WLPFGDGPRLCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKT
FLISSETGIFLKVERV

AL072844.1|CNS00H2C Drosophila melanogaster genome survey sequence TET3 end
404-507 19-330 42% with 6a5
LLIPTAAIHMDPGIYENPQRFYPERFXEQAXRSRPAAAFLPXGDGLRGCIAARFAEQ
QLLVGLVALLRQHRYAPSAETSIPVEYDNRRLLLMPKSDIKLSVERVDXL*

AC008288 = AL072844 AC009342
WGNIKGVVSGKRHAQDALQDIY
TAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQLNGHKWRSLHAKSAEVFTPANMQKLLV
RLSQISSRIQRDLGEKSLQTINISELVGAYNTDVMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAE
PATAYFQKVALSQLQLHRRRDRQPLQTFLQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCLYELARQPEVQDRTRLEINK
ALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAI
HMDPGIYENPQRFYPERFEEQARRSRPAAAFLPFGDGLRGCIAARFAEQQLLVGLVALLRQHRYAPSAETSIPVEYDNRRLLLMPK
SDIKLSVERVDKL*

AL069964.1|CNS00DFU Drosophila melanogaster genome survey sequence T7 end of
72% to 6a9 N-terminal
MSVGTVLLTALLALVGYLLMKWRSXMRHWQDLGIPCEEPHILMG
SMKGVRTARSFNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLEK
SLXKQILIKEFNKFTDRGXFHNPEDDPLSGQLFLLDGQKWRTMR
NSTSSTFTSGKMKY

Cyp6a9 HOMOLOG Drosophila grimshawi U87164

DPEAEFRIMGRKSLTDQRHGNLGNALLNGFPNFSRRIHMKLTPEHIEKFF
MRIVKETVDYREKNNVRRNDFMDQLIDLKNKPLMKSETGESMNLTIEEIS
AQALVFFAAGFETSSTTMGFALYELARAEDVQNRLRKECNEVLARHNGDL
TYESIKDMKYLDQVISETLRLYTVLPILNRQCLEDYVVP

Cyp6a13 Drosophila melanogaster AC005457, DS08616, AA941155 LD25139
4-474 comp(7564-8986) 52% identical to CYP6A5 probable 6A protein
AC007085 (BACR21H10) comp(108394-108855)
MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGV
AGERPVYFRGNMSGLGRDLHWTDINLRIYRKFRGVERYCGYFTFMTKSLFIMDLELIRDI
MIRDFSSFADRGLFHNVRDDPLT
GNLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKD
LCARFTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKL
RFRLFRPEVSEFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALV
FFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQ
VVAETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFE
PEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFS
SRNFLISTQEGVHLRME

AC009844 45% to 6a2 no exact match in nr same as AL097801, AL057750
65863-64775 3 IN FRAME STOPS COULD BE A PSEUDOGENE OR THERE ARE FRAMESHIFTS
missing about 30 AA at C-terminal
MAVMIVLLIGVITFLAWYVHQHFNYWKRRGI
FPR*APKLPTVIPAYLMKTRPFCGYFSRDPPTKLRTKPAGPFVGFLYVFQEDW*L*PNIDSAKPE
LIREFDKFPVGGVFHNERED
PLSATLVNIDGQKWKPLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSME
ITNVVARFTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELA
AKLRMKATVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFN
EIAAQAFIFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMRE
MTYLEKVITETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPE
PEKFIPERFDEDQVQQRPXCTFLPFGDGPRNCIGLRFGRMQVIVGXALLIHNFKF

AC009844 Drosophila melanogaster chromosome 2 clone BACR01L16 (D1052) 

Query: 1     MALAYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ 60
             MAL YILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ
Sbjct: 77597 MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ 77418

Query: 61    DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH 120
             DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH
Sbjct: 77417 DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH 77238

Query: 121   LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA 180
             LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA
Sbjct: 77237 LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA 77058

Query: 181   RFTVDVIGTCAFAIQCNSLRDEKA 204
             RFTVDVIGTCAF IQCNSLRD KA
Sbjct: 77057 RFTVDVIGTCAFGIQCNSLRDVKA 76986

 Score =  284 bits (718), Expect(2) = 2e-87
 Identities = 155/350 (44%), Positives = 230/350 (65%), Gaps = 17/350 (4%)
 Frame = -1

Query: 6     ILFQVAVALLAILTYYIHRKLTYFKRRGI-PFVAPHLIRGNMEELQKTKNIHEIF-QDHY 63
             ++  + + ++  L +Y+H+   Y+KRRGI P  AP L       L KT+     F +D  
Sbjct: 65863 VMIVLLIGVITFLAWYVHQHFNYWKRRGIFPR*APKLPTVIPAYLMKTRPFCGYFSRDPP 65684

Query: 64    NKFRESKA-PFVGFFF-FQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHL 121
              K R   A PFVGF + FQ       +++ AK  LI++F  F   G+F+NE++DP+SA L
Sbjct: 65683 TKLRTKPAGPFVGFLYVFQEDW*L*PNIDSAKPELIREFDKFPVGGVFHNEREDPLSATL 65504

Query: 122   FNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNS-VLEIRDLVA 180
              N+DG +W+ LR KL+ TFTSGKMK M+PT+++V +E + V  E    +S  +EI ++VA
Sbjct: 65503 VNIDGQKWKPLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVA 65324

Query: 181   RFTVDVIGTCAFAIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMV 240
             RFT DVIG+CAF + C+SL D KA+F+  G  ++ ++RHG  ++  +   P+LA KL M 
Sbjct: 65323 RFTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELAAKLRMK 65144

Query: 241   RTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEV 300
              T   +++FY  I+ +TV  R K ++KR+DF+DMLIE+K    +  +NGD   GLT  E+
Sbjct: 65143 ATVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMK----LKFDNGDKENGLTFNEI 64976

Query: 301   LAQAFVFFIAGFETSSSTMGFALYELAKNPDIE------------QHDQNFTYECTKDLK 348
              AQAF+FF+AGFETSS+TMGFALYELA + DI+            QH+    Y+  +++ 
Sbjct: 64975 AAQAFIFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMT 64796

Query: 349   YLNQVLD 355
             YL +V+D
Sbjct: 64795 YLEKVID 64775

 Score =  280 bits (708), Expect = 1e-74
 Identities = 162/219 (73%), Positives = 172/219 (77%), Gaps = 33/219 (15%)
 Frame = +3

Query: 238   GMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKE---------MTLEN 288
             G VRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKE           + +
Sbjct: 27510 GKVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKESDSREWRCGQRINH 27689

Query: 289   GD-------VVRGLTMEEVLAQAFVFFIAGFETSSSTMGFA------------LYELAKN 329
             G        V+     + +L         G E+  S  G              LY L  +
Sbjct: 27690 GGGFGTSLCVLHCWL*DILLHHGICPIRTGKESGHSR*GSG*GGGGHRAT*PKLY-LRVH 27866

Query: 330   PDIEQHDQNFTYECTKDLKYLN-----QVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFV 384
                E     F +   + LK LN      +L ETLRLYTIVPNLDRMAAKRYVVPGHPNFV
Sbjct: 27867 QGSEVPQSGFRWYVNEYLK*LNPTDFNNILAETLRLYTIVPNLDRMAAKRYVVPGHPNFV 28046

Query: 385   IEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRF 444
             IEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRF
Sbjct: 28047 IEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRF 28226

Query: 445   GQMQARIGPALL 456
             GQMQARIG ALL
Sbjct: 28227 GQMQARIGLALL 28262

 Score =  196 bits (494), Expect(2) = 2e-94
 Identities = 102/186 (54%), Positives = 140/186 (74%), Gaps = 12/186 (6%)
 Frame = +2

Query: 169   KNSVLEIRDLVARFTVDVIGTCAFAIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMR 228
             K+ ++E+RD++ARFT DVIGTCAF I+C+SL+D +AEF   G+R++ ++RHG +   F+ 
Sbjct: 69299 KSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFIN 69478

Query: 229   SYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLEN 288
             S+  LAR+L M  T    + F+ RIV ETVA REK +I+RNDFMD LI+LKN      E+
Sbjct: 69479 SFQNLARRLHMKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSES 69658

Query: 289   GDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIE------------QHD 336
             G+ V  LT+EE+ AQAFVFF AGFETSS+TMGFALYELA++ DI+            +++
Sbjct: 69659 GESV-NLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYN 69835

Query: 337   QNFTYECTKDLKYLNQVL 354
                TYE  KD+ YL+QV+
Sbjct: 69836 GEITYESMKDMVYLDQVI 69889

 Score =  181 bits (455), Expect = 5e-45
 Identities = 93/188 (49%), Positives = 136/188 (71%), Gaps = 12/188 (6%)
 Frame = -2

Query: 172   VLEIRDLVARFTVDVIGTCAFAIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYP 231
             VLEI DLVAR+T DVIG CAF + CNSL++  AEF+  GKR+++++R+G LL+  +  +P
Sbjct: 28950 VLEIVDLVARYTPDVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFP 28771

Query: 232   KLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDV 291
             KL+R+L +      +++FY+ IV  T+  R + + KR+DFMD LIE+  +++     G+ 
Sbjct: 28770 KLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQA----GNT 28603

Query: 292   VRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIEQHDQNF 339
               GL+  E+LAQAF+FF+AGFETSS+TMGFALYELA + DI++H+  F
Sbjct: 28602 EDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQKHNNEF 28423

Query: 340   TYECTKDLKYLNQVLDETLR 359
             TYE  K++KYL QV+  T +
Sbjct: 28422 TYEGIKEMKYLEQVVMGTFQ 28363

VLEIVDLVARYTPDVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFP 28771
KLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNT 28603
EDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQKHNNEF 28423
TYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIPKGTTGVIPALGIHYDPEIYPEP
GEVKPERLTDEAIAARPSCTWL

Sbjct: 42575 AEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLR 42754

Query: 264   EHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFAL 323
              + KR+DFMD LIE+  +++     G+   GL+  E+LAQAF+FF+AGFETSS+TMGFAL
Sbjct: 42755 TNEKRHDFMDSLIEMYEKEQA----GNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFAL 42922

Query: 324   YELAKNPDIE------------QHDQNFTYECTKDLKYLNQVLD---ETLRLYTIVPNLD 368
             YELA + DI+            +H+  FTYE  K++KYL QV+       RL+       
Sbjct: 42923 YELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMGK*NPKRLHNFT*R-- 43096

Query: 369   RMAAKRYVVPGHP-----------------------NFVIEAGQSVIIPSSAIHHDPSIY 405
                A  +  P  P                       N ++  G + +IP+  IH+DP IY
Sbjct: 43097 ---AFSHFTPQKPFASIQFWRI*RE*PRQIFRLKILNTLLPKGTTGVIPALGIHYDPEIY 43267

Query: 406   PEP 408
             PEP
Sbjct: 43268 PEP 43276

Query: 356   ETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPER 415
             ETLR Y ++ +L RM    +  P  P + I  G     PSS             E +PER
Sbjct: 43120 ETLRKYPVLAHLTRMTQTDFS-PEDPKYFIAQGNHWCDPSSWYSL*SGNLSRTGEVKPER 43296

Query: 416   FSPEESAGRPSVAWL 430
              + E  A RPS  WL
Sbjct: 43297 LTDEAIAARPSCTWL 43341


 Score =  174 bits (436), Expect = 8e-43
 Identities = 83/152 (54%), Positives = 104/152 (67%), Gaps = 1/152 (0%)
 Frame = -2

Query: 343   CTKDLKYLN-QVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHD 401
             C+  L +L    + ETLRLYT++P L+R   + Y VPGHP +VI+ G  V+IP  A+H D
Sbjct: 35619 CSFSLSFLTFGFILETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRD 35440

Query: 402   PSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGPALLIRNFK 461
               +Y  P  F P+ FSPE    R SV WLPFGDGPRNCIG+RFGQMQARIG ALLI++FK
Sbjct: 35439 EKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFK 35260

Query: 462   FSTCSKTPNPLVYDPKSFVLGVKDGIYLKVETV 494
             FS C KT  P+ Y+ + F++    GIYLK E V
Sbjct: 35259 FSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 35161

IERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAF 35817
VFFAAGFETSSTTMGFALYELAQNQDIEKCNGELNYESMKDLVYLDQ 35637
ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRD 35440
EKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFK 35260
FSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 35161

 Score =  171 bits (429), Expect(2) = 2e-94
 Identities = 80/139 (57%), Positives = 97/139 (69%)
 Frame = +1

Query: 356   ETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPER 415
             ETLRLYT++P L+R   + Y VPGHP +VI+ G  V+IP  A+H D  +Y  P  F P+ 
Sbjct: 69946 ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDN 70125

Query: 416   FSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGPALLIRNFKFSTCSKTPNPLVYD 475
             FSPE    R SV WLPFGDGPRNCIG+RFGQMQAR G ALLI  FKFS C +T  P+VY 
Sbjct: 70126 FSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYS 70305

Query: 476   PKSFVLGVKDGIYLKVETV 494
              K F++  + GI+LKVE V
Sbjct: 70306 KKRFLISSETGIFLKVERV 70362

ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDN 70125
FSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYS 70305
KKRFLISSETGIFLKVERV 70362


 Score =  149 bits (373), Expect = 2e-35
 Identities = 89/205 (43%), Positives = 135/205 (65%), Gaps = 38/205 (18%)
 Frame = +2

Query: 204   AEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREK 263
             AEF+  GKR+++++R+G LL+  +  +PKL+R+L +      +++FY+ IV  T+  R +
Sbjct: 42575 AEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLR 42754

Query: 264   EHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFAL 323
              + KR+DFMD LIE+  +++     G+   GL+  E+LAQAF+FF+AGFETSS+TMGFAL
Sbjct: 42755 TNEKRHDFMDSLIEMYEKEQA----GNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFAL 42922

Query: 324   YELAKNPDIE------------QHDQNFTYECTKDLKYLNQVLD---ETLRLYTIVPNLD 368
             YELA + DI+            +H+  FTYE  K++KYL QV+       RL+       
Sbjct: 42923 YELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMGK*NPKRLHNFT*R-- 43096

Query: 369   RMAAKRYVVPGHP-----------------------NFVIEAGQSVIIPSSAIHHDPSIY 405
                A  +  P  P                       N ++  G + +IP+  IH+DP IY
Sbjct: 43097 ---AFSHFTPQKPFASIQFWRI*RE*PRQIFRLKILNTLLPKGTTGVIPALGIHYDPEIY 43267

Query: 406   PEP 408
             PEP
Sbjct: 43268 PEP 43276

 Score =  141 bits (352), Expect = 6e-33
 Identities = 75/154 (48%), Positives = 103/154 (66%), Gaps = 18/154 (11%)
 Frame = -2

Query: 341   YECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPN 382
             Y+  +DL Y+ +V++E+LR + +V +L R+A K Y    +P 
Sbjct: 71283 YDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQ-HSNPK 71107

Query: 383   FVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGL 442
             + IEAG  V++ +  IHHDP  YPEP +F PERF  E+   RP+ A+LPFG GPRNCIGL
Sbjct: 71106 YFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGL 70927

Query: 443   RFGQMQARIGPALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVETV 494
             RFG+MQ  IG ALLI NF+F    KTP P+ Y   + +LG + GI+L +  V
Sbjct: 70926 RFGRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGGIHLNITKV 70771

YDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPK 71107
YFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGL 70927
RFGRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGGIHLNITKV 70771


 Score =  122 bits (302), Expect = 4e-27
 Identities = 67/109 (61%), Positives = 85/109 (77%), Gaps = 12/109 (11%)
 Frame = -3

Query: 246   IQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAF 305
             I+ F+ RIV ETVA RE+ +I+RNDFMD LI+LKN+  M  ++G+ V  LT+EE+ AQAF
Sbjct: 35993 IERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVN-LTIEEIAAQAF 35817

Query: 306   VFFIAGFETSSSTMGFALYELAKNPD------------IEQHDQNFTYECTKDLKYLNQV 353
             VFF AGFETSS+TMGFALYELA+N D            IE+ +    YE  KDL YL+QV
Sbjct: 35816 VFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQV 35637

Query: 354   L 354
             +
Sbjct: 35636 V 35634

IERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAF 35817
VFFAAGFETSSTTMGFALYELAQNQDIEKCNGELNYESMKDLVYLDQV 35637


 Score = 83.1 bits (202), Expect = 2e-15
 Identities = 44/170 (25%), Positives = 84/170 (48%), Gaps = 3/170 (1%)
 Frame = +3

Query: 106   KGIFYNEKDDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHE 165
             KG++ N+K DP+S  L+ L G  W+ +R KL  +    +M L+Y  +   A + +  ++ 
Sbjct: 82008 KGLYCNQKSDPLSGDLYALRGESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNS 82187

Query: 166   KV--PKNSVLEIRDLVARFTVDVIGTCAFAIQCNSLRDEKAE-FLYFGKRSLVDKRHGTL 222
              +    +S + I+ ++ R+ +  +  C F +     +    E F    + +L   +HG L
Sbjct: 82188 TLMSQPHSTVHIQKIMRRYVLSSLAKCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYL 82367

Query: 223   LNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDML 275
             +N  M   P   R L M RT    +E++ +++T  V  RE     + D++ +L
Sbjct: 82368 MNLMMIRVPNFCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLL 82526

KGLYCNQKSDPLSGDLYALRGESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNS 82187
TLMSQPHSTVHIQKIMRRYVLSSLAKCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYL 82367
MNLMMIRVPNFCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLL 82526


 Score = 73.7 bits (178), Expect(2) = 2e-21
 Identities = 31/55 (56%), Positives = 44/55 (79%)
 Frame = +2

Query: 64    NKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPIS 118
             +K++ S  PF GF+FF + +A + DLEL K++LIKDF++F N+GIFYNE DDP+S
Sbjct: 44717 SKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS 44881

 Score = 60.9 bits (145), Expect(2) = 2e-87
 Identities = 31/70 (44%), Positives = 44/70 (62%)
 Frame = -3

Query: 347   LKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYP 406
             L+  + +  ET+R   +V +L R+A + Y    +P + IE G  VI+P+ AIHHDP  YP
Sbjct: 64673 LQITSILFTETMRKRPVVGHLIRVATQHYQHT-NPKYNIEKGTGVIVPTLAIHHDPEFYP 64497

Query: 407   EPFEFRPERF 416
             EP +F PERF
Sbjct: 64496 EPEKFIPERF 64467

 Score = 56.2 bits (133), Expect = 3e-07
 Identities = 26/82 (31%), Positives = 49/82 (59%)
 Frame = -2

Query: 1     MALAYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ 60
             M++  +L    +AL+  L       + +++  GIP   PH++ G+M+ ++  ++ +EI+ 
Sbjct: 90483 MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWT 90304

Query: 61    DHYNKFRESKAPFVGFFFFQSP 82
              +YNKFR S  PF GF++F+ P
Sbjct: 90303 SYYNKFRGS-GPFAGFYWFRRP 90241

MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGSGPFAGFYWFRRP
AVFVLEKSLGKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRNSTSSTFTSGK


6a9
MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCE
EPHILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLD
ISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLLDGQKWKSMRSKLSS
TFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIG
TCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLH
MKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSES
GESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKE
CQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPDLNRECLEDYEV
PGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPIFFARTSEGSDSVE
WLPFGDGPRLCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKT
FLISSETGIFLKVERV


 Score = 50.4 bits (118), Expect(2) = 2e-21
 Identities = 23/60 (38%), Positives = 39/60 (64%)
 Frame = +1

Query: 6     ILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK 65
             +L  + V +L++L +   R+  Y++RRGIP   PH I GN+++  K ++I  IF+D+Y K
Sbjct: 44542 LLLALIVVILSLLVFAARRRHGYWQRRGIPHDVPHPIYGNIKDWPKKRHIAMIFRDYYFK 44721

MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDVPHPIYGNIKDWPKKRHIAMIFRDYYFK
YKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS

 Score = 45.7 bits (106), Expect = 4e-04
 Identities = 22/61 (36%), Positives = 36/61 (58%)
 Frame = +1

Query: 429 WLPFGDGPRNCIGLRFGQMQARIGPALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIY 488
           W  FG G R+CIG++F Q+Q R+  ALL+  ++FS  ++ P          ++ ++DGI 
Sbjct: 694 WFGFGVGARSCIGIQFAQLQLRLALALLLSEYEFSLNTRKP----------LINLEDGIA 843

Query: 489 L 489
           L
Sbjct: 844 L 846
WFGFGVGARSCIGIQFAQLQLRLALALLLSEYEFSLNTRKPLINLEDGIAL
 Score = 39.5 bits (90), Expect = 0.030
 Identities = 26/75 (34%), Positives = 33/75 (43%)
 Frame = +1

Query: 356   ETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPER 415
             ETLR Y ++ +L RM    +  P  P + I  G     PSS             E +PER
Sbjct: 43120 ETLRKYPVLAHLTRMTQTDFS-PEDPKYFIAQGNHWCDPSSWYSL*SGNLSRTGEVKPER 43296

Query: 416   FSPEESAGRPSVAWL 430
              + E  A RPS  WL
Sbjct: 43297 LTDEAIAARPSCTWL 43341

AL057750.1|CNS00162 Drosophila melanogaster genome survey sequence TET3 end of
47% to 6a2 65% TO AL062684
YVIGKFSXGLDCHSXSDPKAKFVQMGTTAITERRHGKSMXLLLFGAPELAAXX
RMKATVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDN
GDKENGLTFNEIAAQAFIFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHN
GKLDYDSMREMTYLEKVITETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLA
IHHDPEFYPEPEKFIPERFDEDQVQQRPXCTFLPFGDGPRNCIGLRFGRMQVIVGXALLI
HNFKF

Cyp6a14 AC005457 P1 clone DS08616 AC007085 (BACR21H10) 16539-17204
13565-15095 57% identical to CYP6A5
MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMX 13699
RSTTSAISTKEFIRSLRGRVPSPECTFFKRTALITDLDFIKQVMIKDFSYFQ 13868
DRGAFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRL
GDAM 14045
DKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFT
RR 14219
RHSTLVQSFIFTNARLARKLRIKVLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQ
MIE 14399
LRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQP
DIQQ 14579
RLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHP 14759
LLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVK
N 14939
RHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFS 15095
KKSFLLTTNDGIYLKVE

Cyp6a15p Drosophila melanogaster GenEMBL AC005457 P1 clone DS08616
comp(10139-9361) POSSIBLE PSEUDOGENE (MISSING N-TERMINAL)
AFTVTNSKLAKKLKMKILRDDLTDFFLSVVKPALSGMTLWTSPPSGGRSSRQGGS
KFDLS 9960
HNWTLE
QMAAQAIVFFLAGFETSSSTMSSCKYELALQPEI*NQIRDEIERVLEGNAITYDALAK
9768
INYPEQVLSETLRKHPIQLIKFLLETQES 9681
FRVRNTELIVEKGTSLLIPVHSVHYDPHLYPHPKLFDSSRLKAYKSNSRHPFAYLP
FGTF 9467
GPRSCIGLRFGKMQAKIGIVSLCQRFKFGDSDLTDIPL 9361

Cyp6a17 AL052842 (BACR001L16), AL074108 (BACR035C16) 49% with 6a2 AA699131
HL07765 = AI135898, GH13814, AI260230 LP03950, AI258456 LP01662
AI534145 SD06663, AI114010 GH10635, AI533952 SD06306 AI402220
AC010578 33000 region
MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFR
DYYFKYKNSDYPFAGFYFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATL
FSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVV
DLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLF
GFPKLSRRLRLKLNIQEAEDFYTKIVRETIDYRLRTKEKRND 338
FMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQD 509
VQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKVPVLAHLTR
MTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPE 263
RFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMK 86
IVVKNILISAENGIHLKVEKLA

AA567377 N-terminal to C helix same gene as AA698035
AI513739 AI134544 AI389195 AI295735 AI134091
MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRA
MFDIVCDLYTKGGSKKFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRN
VFATSSDDDPHDMSNLFGSSLFSMRDARWKDMRSTLSPAFTGSKMRQMF
QLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIASTAFGLQV
NSFKDRENTFYQ

This sequence is 71% identical to Drosophila mettleri CYP9 AF083947
So this is a blast with that seq.
AC007594 Drosophila melanogaster chromosome 3 clone BACR28I14 (D680) RPCI-98
             28.I.14 map 87B-87C strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 83 unordered pieces
             Length = 100315

AC007594 assembled sequences two different genes
Sequence A exact match to AI259899
37628 DRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEA 37807
37808 IMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDP 37987
37988 KYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSR 38167
38168 FALLEAKAVIYYLLKDYRFAPANKSCIPLKLITSGFQLSPKGGFWIKLVQR 38320
the following sequence is in the same contig as the above seq. And so it is a
different gene sequence B.
39127 MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCD 39306
39307 LYTKGGSK 39330
the following sequence is different from Sequence A
The EST AI513739 is identical to these two sequences from the N-term up to NTFYQ
So these are probably from the same gene
32607 KFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSNLFGSSLFS 32428
32427 MRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTR 32248
32247 FTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKI
32021 LKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWS 31842
31841 DRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKEL 31674
31673 KYLDQVVSEVLRKWPPAIAFDRECNKE 31593
this sequence is missing an internal exon, probable pseudogene
31595 EAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLSPKGGFWIKLVQR 31455

reconstruction of sequence A
If we assume only two genes then the EST AI257340 must be the N-terminal of sequence 
A, since it is different from sequence B
AI257340
MLWEFFALFAIADALLYRWASANNDFFKDRGIAYEKPELYFGNMAGMFLRKRAMFDIVCD 205
LYTKGGSKKFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNEFATSSDDDPHDMSN 385
LFGSSLVSMRDARWKDMRSTLSPAFTGSKMRHMVQLMNHEA 508
***** warning this sequence is from sequence B to make a complete seq.
There may be some minor variation in the real Seq. A
KEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFY
*****
AI259899 extends sequence A back toward the N-terminal
QMGKKLTTFTFLQSMKFMLFFALKGLNKILKVELFDRKSTQYFVRLVLDAMKYRQEHNIV 180
RPDMINMLMEARGIIQTEKTKASAVREWS
37628 DRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEA 37807
37808 IMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDP 37987
37988 KYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSR 38167
38168 FALLEAKAVIYYLLKDYRFAPANKSCIPLKLITSGFQLSPKGGFWIKLVQR 38320

reconstruction of sequence B (pseudogene)
39127 MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCD 39306
39307 LYTKGGSK 39330
the following sequence is different from Sequence A
The EST AI513739 is identical to these two sequences from the N-term up to NTFYQ
So these are probably from the same gene
32607 KFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSNLFGSSLFS 32428
32427 MRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTR 32248
32247 FTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKI
32021 LKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWS 31842
31841 DRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKEL 31674
This sequence has a small (8aa) deletion here
31673 KYLDQVVSEVLRKWPPAIAFDRECNKE 31593
this sequence is missing an internal exon, probable pseudogene
31595 EAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLSPKGGFWIKLVQR 31455

gb|AC009741.4|AC009741 Drosophila melanogaster chromosome 3 clone BACR44K17 (D976) 
RPCI-98
              44.K.17 map 87B-87B strain y; cn bw sp, WORKING DRAFT
              SEQUENCE, 174 unordered pieces
              Length = 194613

146199 QRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSNLFSSSLFSMRDARWK 146378
146379 DMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIA 146558
146559 STAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFILLFALKSLNK 146699
146768 ILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIGRPDMINML 146887

 Score =  250 bits (633), Expect(2) = 2e-80
 Identities = 124/166 (74%), Positives = 138/166 (82%), Gaps = 1/166 (0%)
 Frame = +3

Query: 75     QRKPLLMIRDPELVKQITIKDFDHFINHRNIFGVDNND-PHDMDNLFGSSLFSMRDARWK 133
              QR+PLLM+RDP+L+KQITIKDFDHFINHRN F   ++D PHDM NLF SSLFSMRDARWK
Sbjct: 146199 QRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSNLFSSSLFSMRDARWK 146378

Query: 134    DMRRPLSPAFTGSKMRQMFQLMDIVANEAVECLKRDDIPENGIELDMKDYCTRFTNDVIA 193
              DMR  LSPAFTGSKMRQMFQLM+ VA EAV+CLK+DD      ELDMKDYCTRFTNDVIA
Sbjct: 146379 DMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIA 146558

Query: 194    STAFGLQVNSFKDRENQFYMMGKKLTPLQPLTNLKFLLFTSAQKIFK 240
              STAFGLQVNSFKDREN FY MGKKLT    L N+KF+L  + + + K
Sbjct: 146559 STAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFILLFALKSLNK 146699

 Score = 70.6 bits (170), Expect(2) = 2e-80
 Identities = 33/41 (80%), Positives = 37/41 (89%)
 Frame = +2

Query: 240    KALKISLFDRQSTNYFVRLVLDAMKYRQENNIIRPDMINML 280
              K LK+ +FDR+ST YFVRLVLDAMKYRQE+NI RPDMINML
Sbjct: 146765 KILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIGRPDMINML 146887

Cyp6d2 AC004377 DS00837

MWTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQER
SLGMALADIYARHEGKIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDR
GVYVDEDKDPLSANLFNLRGASWGSVIFGLEIDSFRNPKNEFREISSSTS
RDESLLLKIHNMSMFICPPIAKLMNRLGYESRILTSLRDMMKRTIEFREE
HNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMSIEKIAAQA
FLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDR
FTYEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGT
PILISLFGMQRDPVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCI
GKALRMGKVNSKVAVAKILANFDLVQSPRKEVEFRFDAAPVLVTKEPLKL
RLTKRK*

AC007440 comp(89081-89665) region also on same fragment Cyp6g1 and one other
59% to 6D1 intron location at DFI*VMII not certain
AC007440 comp(104661-104918) region C-term
AC015208 18689-17472 + 17407-17141
MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFL
RISFGDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFN
NFLNRFESADAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYS
QMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGG
LRRGRSELITKTK
ELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGI
ILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEG
FSLQPHVDFI*VMIIPTYLCQSKF
QFWPEPGVFDPKRFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYW
VETCERTVSEIRFNPKSFMLESENEIYLRFCRSSL*

AC015208 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in ordered
2-491 19014-20624 45% to 6g1
MELVLLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQLY
NHPDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQNIF
FLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEAK
ELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVPF
VRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQF
VFEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTL
KMIESLEFMQMILLEVLRMYPPLPFLDRECTSGRDYSLAPFHKKFVVPKGMPVYIPC
YALHMDPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHG
CIGERFGYLQAKVGLVNLLRNHMITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDALGV*

AC007441 Drosophila melanogaster chromosome 3 clone BACR10E03 (D690) RPCI-98
AI108995 AI517349 AI114209 AI403829 AI134370 AI238761
AI517348 AI107803 AI405169 AI109667 AA141600 AL065891
50% to Cyp6d2
MIGIYLLIAAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGALESVTKGK
RSFGMAIYDMYKSTKEPVIGLYLTLRPALLVRDAQLAHDVLVKDFASFHD
RGVYVDEKNDPMSASLFQMEGASWRALRNKLTPSFTSGKLKAMFETSDSV
GDKLVDSIRKQLPANGAKELELKKLMATYAIDIIATTIFGLDVDSFADPN
NEFQIISKKVNRNNIEDIIRGTSSFL
probable end of gene on AI402085 AI107062 AA141601 AA141667
LYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACILETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIG
MHRDEEYFPDPLAYKPERYLENGKDYTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPLMPKS
GVPVRLSLKK*

AF083946 Cyp6g1 = AC007440, AL065705, AA698945, AI402390 GH21606, AI403823 GH23342,
AI063794 GH03774 AI517356 GH28075 AI113449 GH09719 AI517823 GH28887
AI386932 GH17321 AI133818 GH10520 AI062549 GH01777 AL070300 (BACR31O06)
AI402215 AC015208 3-150 22920-22477 154-491 22405-21326

note: lower case matches ESTs not AF083946

MVLTEVLFVVVAALVALYTWFQRNHSYWQRkgipYIPPtpiigNTKVVFK
MENSFGMHlSEIYNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDF
NRFHNRYarcdphgdplgynNLFFVRDAhwkgiRTKLTPVFTSGKVKQMY
TLmQEIGKDLELALQRRGEKNSGSFITEIKEICAQFSTDSIATIAFGIRA
NSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSLMRIQFFTADF
SHFMRSTIGHVMEERERSGLLRNSLIDVLVSLRKEAAAEPSKPHYAKNQD
FLVVSAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGG
GSLSYEKIQSLEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPFY
DYTLENGTPVFIPIYALHHDPKYWTNPSQFDPERFSPANRKNIVAMAYQP
FGSGPHNCIGSRIGLLQSKLGLVSLLKNHSVRNCEATMKDMKFDPKGFVH
QADGGIHLEIVNDRLYDQSAPSLQ

AC008257 43% identical to 6g1 possible frameshifts after EKDRRKA and GEDV
identical to AI403674, AI237973, AI517561, AI107861, AI404012, AI109083, AI389275, 
AI113367, AI064268, AI064259, 1 diff with AI108091, 2 diffs with AI402430
MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFH
EAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLF
FARSPGWRELRTKISPVFTSGKIKQMYPLMVK*IGKNLQDSAERLGSGTEVQVKDLCSRF
TTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLF
SRETTKFIRSSVNYVLKEREKDRRKA*RNDLIDILLALKREAAANPGEDV*KEVDLDYLV
AQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYL
SQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYW
PDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTC
DKTIKKIEWAPTSPETFSTRRIISRFEAITGPAN*

AC015002 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in
43% identical to 6g1 = AC011761
4-510 11535-8695
MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQLRRFY 11344
FDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGALSLF 11164
LAKQPEWREIRTRLAPAFAGAKLKQMFSLMEE
IGCDLEWYLKRLTRDLRRGDAERGAIVSIKDVCDLYNTDMIASIAFGLRSYSLRNTQSE 9947
IGSHCQDLFRPNVRRIIDLFVIFYLPKLVPLLRPKLFTEPHAEFLRRVIQLVIEERERGG 9767
DLRNDLIEMLLTLKKEADLQQDKSHFTHHRDFLAAQAASFEVAGIETCSASMSFALYELA 9587
KQPLMQSRLRREIREAFASNPNGRLTYEAVARMEFLDMVVEETLRKYPIVPLLERECTPI 9407
NKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPK 9305
YWPDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIK 8830
LGLVYFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLKVDCL* 8695

AC006469 Cyp9b1 chromosome 2R DS02730 and DS07472 also U34324
1-505 comp(54916-56640) 74% identical to 9b2
MSFVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASAL
QKASFQKQISEFYNRTRHH*KLVGLFNLRTPMIQINDPQLIKKICVKDFD
HFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTL
MNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKV
NSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTN
VEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCF
IFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYD
AAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGD
NINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSC
IGNRYAVMQAKGMLYNLMLNYKIEASPRTTRDMWESARGFNIIPTTGFWM
QLVSRK*

AC006469 Cyp9b2 DS02730 and DS07472 also U34325, AI402118
COMP(57251-58955) AI063849 GH03949 AI108995 AI107803 AI114209 AI517349
AI403829 AI238761 AI134370 AI517348 AI403297 AI108823 AI386498
MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAAL
QKSSFQRQLTEFYERTRQH*KLVGFFNMRTPMITLNDPELIKKVCVKDFD
HFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTL
MNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKV
NSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAK
VDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCF
IFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYD
AVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGD
RINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNC
IGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGFNFTPRSGFWM
HLVPRK*

Cyp9b3 Drosophila mettleri AF083945
MDLILLLSIVGLIYFVYKWATARHNEFELRGLPFEKPLPIFGNN
AAVVTGRASFQKSSPSSIARTRQHKMVGFFNFRTPMIQLNDPEIIKKITVKDFEYFP
NHQLFFTTEERLINDMLSVMKDQRWKHMRNTLTPVFTSAKMRSMFSLMNESFAEC
MDHLDQMSKTAVKPGGSFELELKEVCNRLSNDLIATTAFGLKVSSYKKPDNDFYEIGKSI
VFFRGKALYKLFACPTTLPAVFKLLGFKIFDAQKTDFFIRLVVDAMKYREENNIVRPD
MIQLLMEAKKESTEHWSDDELVAQCFIFFFAAFENNASLICTTAYELLNNPDVQQRLY
EEVQETYDALKGEMLTYDAVTKMKYMDLVASESLRKWTLAASTDRECAKDYTLYDD
DASKLFEFKAGDRINIPIVGLHLDDKFFPEPHKFIPERFSDGNKDQIVPYTYLPFGAGPRN
CIGNRYALMQAKAMLYNLVLKYKIERSPKTVKDLLSDSRGFQLTPQSGYWVHLVPRK

Cyp9c1 U34326, AL063862 (BACR007C22), AL058497 (BACR024A05)
AL076220 (BACR038N13) AL055637 (BACR021M20)
N-term AC007581 (BACR03I24) 1-43 8937-9143 may be two genes
This sequence is from 19 unordered fragments
AI296124 AI297882 AI543300 AI294370
AC007574 chromosome 2 clone BACR11C07 (D638) RPCI-98
MVFVELSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNIPWSV
LMGKESYIKHSIDLHLRLKQHKVYGVFN*LRDPLYYLSDPELIRQVGIK
NFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLK
IRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFTRYTNDV
IATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMK
VKTSPLHSFF
NVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQ
QDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAE
ILAVKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQ
LKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEEHKHE
IRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDRTPA
DMMSSISGFRLLPRELFWCKLESRGPA*


Cyp9f1 Drosophila mettleri AF083947
MLVEFLALSVVVLLLAYRWATANYNFFKERGIPYHKPYPFVGNMGKMLLR
QKSMFDLIVELYNRGDSKVFGIFEQRKPLLMIRDPELVKQITIKDFDHFI
NHRNIFGVDNNDPHDMDNLFGSSLFSMRDARWKDMRRPLSPAFTGSKMRQ
MFQLMDIVANEAVECLKRDDIPENGIELDMKDYCTRFTNDVIASTAFGLQ
VNSFKDRENQFYMMGKKLTPLQPLTNLKFLLFTSAQKIFKALKISLFDRQ
STNYFVRLVLDAMKYRQENNIIRPDMINMLLEARGLINSDKLKSSVVRDW
SDRDIVAQCFVFFFAGFETSAVLMCFTAQELLENEDVQEKLYEEVAQVDS
DLQGGQLTYEAIMGMKYLDQVVSEVLRKWPAAIAVDRECNKDITYEVDGK
SVQIKKGEAVWLPTCGFHRDPKYFENPNKFDPDRFSEENKDKIQPFTYYP
FGVGPRNCIGSRFALLEAKAVIYYLLREFRLVPAKKTCIPLVLSSSGFQL
APKTGFWVKLIPRK

Cyp9f2 AA735946 78% IDENTICAL TO Cyp9f1 AI113499 AI259899

DRENTFYQMGKKLTTFTFLQNMKFILLFALKSLN
KILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQT
EKTKASAVREWSDRSIVAQCFAFFFAGFETSAVLMCFTAHELMENQDVQQ
RLYEEVQQVDQDLEGKELTYEAIMGMKYLDQVVSEVLRKWPPAIAFDREC
NKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPK

AC007594 Drosophila melanogaster chromosome 3 clone BACR28I14 (D680) RPCI-98
             28.I.14 map 87B-87C strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 83 unordered pieces
             Length = 100315

 Score =  280 bits (708), Expect(2) = 3e-89
 Identities = 140/152 (92%), Positives = 142/152 (93%)
 Frame = -3

Query: 36    ILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREW 95
             ILKVE+FDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREW
Sbjct: 32024 ILKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREW 31845

Query: 96    SDRSIVAQCFAFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYE 155
             SDR IVAQCF FFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKEL
Sbjct: 31844 SDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKEL--- 31674

Query: 156   AIMGMKYLDQVVSEVLRKWPPAIAFDRECNKD 187
                  KYLDQVVSEVLRKWPPAIAFDRECNK+
Sbjct: 31673 -----KYLDQVVSEVLRKWPPAIAFDRECNKE 31593

 Score =  245 bits (619), Expect = 8e-65
 Identities = 116/121 (95%), Positives = 117/121 (95%)
 Frame = +2

Query: 97    DRSIVAQCFAFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEA 156
             DR IVAQCF FFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEA
Sbjct: 37628 DRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEA 37807

Query: 157   IMGMKYLDQVVSEVLRKWPPAIAFDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDP 216
             IMGMKYLDQVV+EVLRKWP AIA DRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDP
Sbjct: 37808 IMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDP 37987

Query: 217   K 217
             K
Sbjct: 37988 K 37990

 Score = 68.7 bits (165), Expect(2) = 3e-89
 Identities = 31/36 (86%), Positives = 34/36 (94%)
 Frame = -2

Query: 1     DRENTFYQMGKKLTTFTFLQNMKFILLFALKSLNKI 36
             DRENTFYQMGKKLTTFTFLQ+MKF+L FALK LNK+
Sbjct: 32190 DRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKV 32083

AC005450 Cyp9h1 comp(17940-19601) = AC007453 comp(140861-142543) = AC005472 comp(8473-
9426)
42% identical to 9b3 66% identical to AA567377 47% identical to 9c1
MDQSMIALALFIILLVLLYKWSVAKYDVFSERGVSHEKPWPLIGNIPLKAMIGGMP
VLKKMIELHTK
HTGSPVYGIYALRDAVFFVRDPELIKLIGIKEFDHFVNHNSMHNNIQESILSKS
LISLRDGRWKEMRNILTPAFTGSKMRIMYDLIQSCSEEGVIHIQEQLELSQDASIELE
MK
DYFTRFANDVIATVAFGISINSFRRKDNEFFRIGQAMSRISAWSVVKAMLYALFPRL
MK
VLRIQVLDTKNIDYFSSL
VTAAMRYRQEHKVVRPDMIHLLMEAKQQRLADLSDKSKDELYYSEFTADDLLAQC
LLFFF
AGFEIISSSLCFLTHELCLNPTVQDRLYEEIISVHEELKGQPLTYDKLTKMKYLDMV
VLE
ALRKWPPSISTDRECRQDIDLFDENGQKLFSARKGDVLQIPIFSLHHDPENFEDPEF
FNP
ERFADGHALESRVYMPFGVGPRNCIGNRMALMELKSIVYQLLLNFKLLPAKRTSR
DLL
NDIRGHGLKPKNGFWLKFEARQ*

cyp12a4 AC006091 AC015190 334-470 612-178
Drosophila melanogaster chromosome 3 clone BACR48G05 (D475)
1-533 comp(90442-92074)
MLKVRSALSLIQSQKATLSLATQK*
RWQTNVATAEAREDSEWLQAKPFEQIPRLNMWALSMKMSMPGGKYKNMELME
MFEAMRQDY
GDIFFMPGIMGNPPFLSTHNPQDFEVVFRNEGVWPN
RPGNYTLLYHREEYRKDFYQGVMGVIPTQ
GKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEF
ILELRDPDTLEAPDDFIDTINRWTLESVSVVALDKQLGLLKNSNKESEALKLFHYL
DEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDKEAKEG
VVR
PENEQSVLEKLLKVDRKVATVMAMDMLMAGVDT
TSSTFTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEASMKNVPYLRACIKESQ
RLHP
LIVGNARVLARDAVLSGYRVPAGTYVNIVPLNALTRDEYFPQASEFLPERWLRSPK
DSE
SKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNYPTE
NAFR
SALINLPNIPLKFKFIDLPN*

cyp12a5 AC006091 AC015190 315-470 3273-2746 Drosophila melanogaster chromosome 3 clone 
BACR48G05 (D475)
1-535 comp(93052-94626) 76% identical to other AC006091 SEQ. 58% TO
12A1, 12A2
MLKGRIALNILQSQKPIVFSASQQ*RWQTNVPTAEIRNDPEWLQAKPFEE
IPKANILSLFAKSALPGGKYKNLEMMEMIDALRQDYGNIIFLPGMMGRDG
LVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPS
QGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQVNQEFIKEIRDASTQEVPG
NFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKLFKYLDEFFLHSA
DLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKEGV
VRPEHEQSVLEKLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKN
PEKQARLREEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLVIGN
ARGLTRDSVISGYRVPAGTIVSMIPINSLYSEEYFPKPTEFLPERWLRNA
SDSAGKCPANDLKTKNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRN
FNVEFNHSTKNAFRSALINLPNIPLKFKFTDVPN*

AC012807 Drosophila melanogaster, WORKING DRAFT SEQUENCE, in ordered pieces
53569-51819 = AI403604 AI389173 AA801503 48% identical to 12a2
MLRLTVKHGLRANSQLAATRNPDASSYVQQL
ESEWEGAKPFTELPGPTRWQLFRGFQKGGEYHQLGMDDVMRLYKKQFGDICLIPGLFGM 53300
PSTVFTFNVETFEKVYRTEGQWPV 53228
RGGAEPVIHYRNKRKDEFFKNCMGLFGN
GAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNRIREIRDKESQEVPGDFMNTINH 52788
LTFESVATVALDRELGLLREANPPPEASKLFKNIEVLMDSFFDLGVRPSLYRYIPTPTYK 52608
KFSRAMDEIFDTCSMYVNQAIERIDRKSSQGDSNDHKSVLEQLLQIDRKLAVVMAMDM 52434
LMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSLHSEFTVEDMKSLPYLRAVIK 52254
ESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFLLKDDRLYPRAKEFIPERWLR 52074
RKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEMELTVANLVRNFHIEYNYS 51900
TEKPYKCRFLYKPNIPLKFKFTDLKY* 51819

A cyp12 family member 45% to 12a5 AC008187
AA802777 AA567770 AA567809 AA698375  AA698380 AA698511
AA942250 AA990733 AL074984, AI402682 AI402683 AI389804

LQLITKRNRMNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSS*ITEEHKTYDEI
PRPNKFKFMRAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWV
TTFNTKDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVASQN
EAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKEIRDPKTLEVP
EDFTDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALT

>AL074984 note this sequence has the end of an early exon at its beginning

AC008187

PWLXXXDRPMXLISRNRDDPDALT

LNIQPSMWRXISTPNFRMMMRLLDDILMFSQKMIKDTEDSVEKRRQ*

LQLIPKRNRMNTLSSARSVAIYVGPVRSXXXASVLAHEQAKSS

AC008187 N-term region
SAVNSIFMQPKGLKTYYEFNN*FIER*ELIHTCIFRCPPEFYFFSNIKEIRDARTLEMPPGFRIPWLGGFRSPNGFDQSKSRRSRC
IDCVPKHEARCSDMPFN*IYSHQCGDLSPLQTFG**CVFSMTS*CSHRK**RTPRTLWKSGAS**IK*KINKISVCKENKDQL*EL
FLFFFNLVIYLEIVYR*TRIPYKFFKKYLNILEFFSSDPTK*VPGNVIVVIVVSNFSEGVFMLSSNALNLFF*PVTFICLFFQLSE
VGNSRRLYRSADKKMKLMLCLLAFVFV*DFCILKHFKLFALLSFLRFRDKPLV*ERSRKWNCF*LQLITKRNRMNTL

ISRQFNFYATQRIENLL*VQQLVH*ALRINSYLYISMST*VLLFLQH*RNSRC*NSGDAAWFSNPLAWWLSIAQWV*SVEIETIQM
H*LCSKTRSTMFRYAFQLNIQPSMWRFISTPNFRMMMRLLDDILMFSQKMIKDTEDSVEKRRQLINKIKNK*NISLQREQGSTLRI
VFIFL*FGYLS*NCLPLN*NPL*IF*KIFKYFRIFF*RSH*MSTG*CNSRNSSIKFL*GCIYVKFQRSQFVFLASHVHLFIFSVE*
GRQFTAIIPFS**ENETHALFAGFCFCLRFLHFEAFQVIRSPLFSTF*R*AFGIRTFSKVELFLVAVDHQKE*NEYIE

DQPSIQFLCNPKD*KLIMSSTTSSLSAKN*FILVYFDVHLSFTFSPTLKKFEMLELWRCRLVFESLGLVAFDRPMGLISRNRDDPD
ALTVFQNTKHDVQICLSIEYTAINVEIYLHSKLSDDDASSR*HLNVLTENDKGHRGLCGKAAPVNK*NKK*IKYQFAKRTRINSKN
CFYFSLIWLFILKLSTVELESLINFLKNI*IF*NFFLAIPLNEYRVM**S***YQISLRVYLC*VPTLSICFSSQSRSFVYFFS*V
R*AIHGDYTVQLIRK*NSCFVCWLLFLFEIFAF*SISSYSLSSLFYVLEISLWYKNVLESGTVFSCS*SPKGIE*IH*

AC008187 Drosophila melanogaster chromosome 2 clone BACR13D20 (D604) RPCI-98
= AC013857
86142 LQLITKRNRMNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSS*ITEEH
85937 KTYDEIPRPNKFKFMRAFMPGGEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTF 85761
85760 NTKDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGLVAS
      QNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEF 85452
85390 IKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRDIF 85211
85210 RLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQAGEKINS 85037
85036 NSMLERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMP 84857
84856 TKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGTTVLLGS 84680
84679 NVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKR 84524
84523 VVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFTDIEQ* 84371

duplicate C-terminal fragment
Query: 405   CQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTF 464
             CQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTF
Sbjct: 14817 CQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTF 14638

Query: 465   LPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFT 524
             LPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMF+MEPAITFPFKFT
Sbjct: 14637 LPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFLMEPAITFPFKFT 14458

Query: 525   DIEQ 528
             DIEQ
Sbjct: 14457 DIEQ 14446

Query: 45    ITEEHKTYDEIPRPNKFKFMRAFMPGGEFQNASITEYTSA 84
             +  E ++Y  IP P K +F RAFMPGGEF +ASI +Y +A
Sbjct: 13807 VVTEARSYKNIPLPRKQEFARAFMPGGEFHDASILDYAAA 13688

Query: 163   SAINPIFMQPRGLRMYYEPLSNINNEF-----------------------IKEIRDPKTL 199
             SA+N IFMQP+GL+ YYE     NN F                       IKEIRD +TL
Sbjct: 87107 SAVNSIFMQPKGLKTYYE----FNN*FIER*ELIHTCIFRCPPEFYFFSNIKEIRDARTL 86940

Query: 200   EVPEDF 205
             E+P  F
Sbjct: 86939 EMPPGF 86922

Query: 211   RLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQ 243
             RLVFESLGLVAFDR MGLI +NRD+ DALT+FQ
Sbjct: 86932 RLVFESLGLVAFDRPMGLISRNRDDPDALTVFQ

Query: 244   TSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQAG 302
             T   +FR  F+L+IQPSMW+ ISTP +R M R L+D L  +QKM+K+ +D++EKRRQ
Sbjct: 86835 TRSTMFRYAFQLNIQPSMWRFISTPNFRMMMRLLDDILMFSQKMIKDTEDSVEKRRQLI 86656

Query: 303   EKINS--NSMLER 313
              KI +  N  L+R
Sbjct: 86655 NKIKNK*NISLQR 86617

AL063519.1|CNS002VH T7 end of BAC BACR07K20 STS G01307 is exact match
29% to 12A1
MXILXLNRQYGDIVLEVMPSNVPIVHLYNRDDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDR
YASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNFLPALNAVCDDFIELLRARRDPDTLV
VPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLG
LWKYFPTKTYRDFARAEDLIYE*VHR

AL074984 note this sequence has the end of an early exon at its beginning
DRPMXLISRNRDDPDALT
and the start of a related gene at its end.
KRNRMNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSS(intron)ITEEXK
There is no P450 like sequence in the region between these, so
this might represent an alternative splicing option, with two
similar exons adjacent to each other in the genome.  Alternatively,
the upstream fragment could be a pseudogene.
XVXXPWLXXXDRPMXLISRNRDDPDALTVSQNTKHDVQICXSIEYTAINV
EXYLHSKLSDDDASSR*HLNVLTENDKGHRGLCGKAAPVNK*NKK*IKYQ
YAKRTRINSKNCFYFSLIWXFILKLSTVELESL*IFKKXXXXLDXXLAXP
LNE*RVCNSRNSSIKFSEVYLL*VPTLSICFSSQSRSFVYFFS*VR*AIH
GDYTVQLIRK*NSCFVCWLLFLFEIFAF*SISSYSLSSLFYVLEISLWYK
NVLESGTVFSCS*SPKGIE*IH*AVRDLWRFTWVPFDLXXQPPFWHMNKL
NLVLVCTKSSRNRFIMLLVSNYR*RRSXXPX*XPRPQSXX

XFXXLGLXXXIAQXV*SVEIETIQMH*LCHKTRSTMFRYAXQLNIQPSMW
RXISTPNFRMMMRLLDDILMFSQKMIKDTEDSVEKRRQ*INKIKNK*NIS
MQREQGSTLRIVFIFL*FGXLS*NCLPLN*NPYKFLKKXQXX*XXX*RXH
*MSNGYVIVVIVVSNSLRCIYCKFQRSQFVFLASHVHLFIFSVE*GRQFT
AIIPFS**ENETHALFAGFCFCLRFLHFEAFQVIRSPLFSTF*R*AFGIR
TFSKVELFLVAVDPQKE*NEYIEQCAICGDLRGSRSIFXXSLRFGT*TS*
I*C*YAQNPVEIDLSCY*FPIIDNGGAXXLXEXRAHNXXX

XXXPLAWXFXSPNXFDQSKSRRSRCIDCVTKHEARCSDMPXN*IYSHQCG
DXSPLQTFG**CVFSMTS*CSHRK**RTPRTLWKSGASK*IK*KINKISV
CKENKDQL*ELFLFFFNLXIYLEIVYR*TRILINF*KKXKXXRXFXSXPT
K*VTGM**S***YQIL*GVFIVSSNALNLFF*PVTFICLFFQLSEVGNSR
RLYRSADKKMKLMLCLLAFVFV*DFCILKHFKLFALLSFLRFRDKPLV*E
RSRKWNCF*LQLIPKRNRMNTLSSARSVAIYVGPVRSXXXASVLAHEQAK
SSVSMHKIQSK*IYHVISFQL*ITEEXKXSXXSAPTIXX

AC007398 AC007418 mito clan best matches = 37-38% to 12a sequences
note this P1 clone is incomplete and this sequence is made up from 2
unconnected fragments and an EST AA941795 The EST spans the gap between
the fragments but it is not without stop codons at the end.  It may have
a retained intron. Sequence has long C-terminal extension
44% to AC007356 ESTs AA941795 AI258819 AA697999

MQRLRTGESSNPKKLNV*
SQQPVTSVATTRTTASSLPA
ETTSSPAAAVRPYSEVPGPYPLPLIGNSWRFAPLIG*
TYKISDLDKVMNELHVNYGKMAKVGGLIGHPDLLFVFDG
DEIRNI*
THFLFAMELRPSMPSLRHYKGDLRRDFFGDVAGLIGV*
HGPKWEAFRQEVQHILLQPQTAKKYIPPLNDIASEFMGR*
IELMRDEKDELPANFLHELYKWALE*
SVGRVSLDTRLGCLSPEGSEEAQQIIEAINTFFWAVPELELRMPLWRIY
PTKAYRSFVKALDQFT*EITLHPRICMKNIGKTM
DKADADEARGLSKSEADISIVERIVRKTGNRKLAAILALDLFLVGVDT
TSVAASSTIYQLAKNPDKQKKLFDELQKVFPHREADINQNVLEQM
PYLRACVKETLRMRPVVIANGRSLQSDAVINGYHVPKGVSFREMVTIW*
DPAYFPEPKRFLPERWLKQSTDXXX
SAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKV
GFNHVLHLALPELPPFNLPYLIPGTDLPQIQGLVQFRRVC
VPCELHVHSAVASEFQTNAEGRVSCLHQREPEAHHGAQSCSYTRRMCDIY
SQSSAAVAMLHFN*

AC007356 Drosophila melanogaster chromosome 2 clone BACR24H09 (D595) RPCI-98
Comp(74301-74834) most like mitochondrial sequences CYP12A and CYP12B
AI297564 is an exact match
MNNLSLKAWRSTVSCGPNLRQCVPRISGA
GSRRAQCRESSTGVATCPHLADSEEASAPRIHSTSEWQNALPYNQIPGPK
PIPILGNTWR
LMPIIGQYTISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIEK
CYRSEGPTPFRPSMPSLVKYKSVVRKDFFGDLGGVVG
RHGEPWREFRSRVQKPVLQLSTIRRYLQPLE
VITEDFLVRCENLLDENQELPEDFDNEIHKWSLE
GIGRV
ALDTRLGCLESNLKPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTRYVK
NMNFFV
SVCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQK
DEKIATIMALDLILVGIDTVSMAVCSM
LYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLDQMHHLKGFIKEVFRMYSTVIG
NG
RTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERWLKPQHGGTPG
KLHPF
ASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEYNHKPLDYAVTFMYAPDG
PLRFKMTRV*

Cyp12b1 U78485 Drosophila acanthoptera

MWKFAIHSQQPFCWQQLCNRRHLYVGNVQQQTHLELLDAAPTRSDDEWLQAKPY
EKVPGPGTWQVLSYFLPG
GKQYNTNLIQMNRRMREWYGDIYRFPGLMGKQDVIFTYNPNDFELTYRNEGVWP
IRIGLESFTYYRKVHRPE
VFGSIGGLVSEQGKDWAHIRNKVNPVQMRVQNVRQNLPQIDQISREFVDKLDTLR
DPVTHILNDNFHEQLKM
WAFESISFVALNTRMGLLSDRPDPNAARLAEHMTDFFNYSFKYDVQPSIWPYYKT
PGFKKFLQTYDKITEIT
TAYIDEAIKRFEIEKDSGNECVLQQLLSLNKKVAVVMAMYMLMAGIDTTSSAFVTIL
YHLARNPHKQRQLHR
ERRRILPDSDEPLTPENTKNMPYLRACIKECMRITSITPGNFRIATKDLVLSGYRVPR
GEGVLMGVLELSNS
EKYFGQSGQFMPERWLKADTDPDVKACPAARSRNPFVYLAFGFGPRTCIGKRIAE
LEMETLLTRLLRRYQVS
WLAEMPLQYESNIILSPHGIYVQVRAAC

cyp12b2 AC004657 DS07069_3_b12 P1 DS07069 Also AC004345 P1 DS07069
MWKYSNKIIYRNVSGNQLWFNRNSSVGGTLSQQVRSWQKEQELLKSRNLFTNN
GYICSQTQ
LELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPG*GALRNTNLIQMNRLMREMY
GDIYC
IPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGG
LASE*Q
GQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDK*LETQRNPETHTLTTDFH
NQLKM
WAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKT
AGFKKF
LKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLM
AGIDT*T
SSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRI
TSIT
PGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAP
DIQAC
PAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTII
LS
PCGDIRFKLEPVGDLM

>AL063519 T7 end of BAC BACR07K20 STS G01307 is exact match

AC006496 AC012699

MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGI

WDIPGPKRIPFLGTKWIFLLFFRRYKMTKLHE

YGDIVLEVMPSNVPIVHLYNRDDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDR

YASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNFLPALNAVCDDFIELLRARRDPDTLV

VPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLG

LWKYFPTKTYRDFARAEDLIYE

Orf with I helix

SQSSVISEIIDHELEELKKSAACEDDEAAGLRSIFLNI

LELKDLDIRDKKSAIIDFIAAGIET

Orf with EXXR motif

LANTLLFVLSSVTGDPGAMPRILSEFCEYRDTNILQDALTNA

TYTKACIQESYRLRPTAFCLARILEEDMELSGYSLNAG

Orf with PERW and heme motifs

TVVLCQNMIACHKDSNFQGAKQFTPERWIDPATENFTVNVDNASIVV

PFGVGRRSCPGKRFVEMEVVLLLAK

Cyp18 U44753 AL062343

MLADSYLIKFVLRQLQVQEDGDAQHLLMVFLGLLALVTLLQWLVRNYREL
RKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVM
SDYKMIRECFRREEFTGRPDTPFMQTLNGYGIINSTGKLWKDQRRFLHDK
LRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVS
NVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPS
ISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAK
AEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKE
MRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHS
PTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKV
RKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSL
KGNVGATITPESFKVCLKRSPLGPTAADPHHMRNVGAN

AI294030 3 DIFFS WITH CYP18
MLADSYLIKFVLRQLQVQQDGDAQHLLMGFLGLLALDT

AL067521 similar to CYP18 I-helix to K-helix region
LLWXSVFHCXIRGCCARVXXALARVVGRLRLPXFXXXXXLPLPASPFLASXRRSXXVPLAPTPSPXR 515

AL077732 similar to CYP18 C-terminal
Note: these three similar fragments may indicate a second CYP18 gene
IDTEGKXATXSTSYPSXXAXXXSXAXFWRGVELFLFFASFIHCFXIXLPXGQPLPSLKGN 183
VGXTITPESFNVCLXXRPLWPTSADPHHMRNVGAN 288

AC012164 Drosophila melanogaster chromosome X clone BACR14D22 (D1120) RPCI-98
308-468 107436-107984 = AC012373 37% to CYP18 36% to CYP2L1
This is a CYP2 like sequence
AC012373 308-468 153999-154499 = AC012164 107442-107942
see AC015216 below

AC012164 293-399 27006-27380
this fragment identical to AC015216 73548-73922
RGLGKEELAGHATTLLLEGYETSAMLLAFALYELALNEDAQRHAGNLI 27185
DPGALGELRYSEAALLEALRLHPAMQALQKRCTKTFTLPDQKSGASSELKVHLGTELVLP 27365
VHAIH 27380
this seq frameshifts to the next seq

AC012164 401-416 27445-27492
this fragment = AC015216 73987-74034
DSALYPAPNQFRPERF 27492

AC012164 477-537 109248-109066 not on AC015216 or AC012373
FLFFAPLKAWFGIGPPEGLPLARFKGKVGAPLPPGLVKVCPKGPPLGAPSPHSPPMGKVGA 109066

AC012164 Drosophila melanogaster chromosome X clone BACR14D22 (D1120) RPCI-98
CYP18 region 
  1-131 114600-114992
131-171 115830-115952 
170-314 116024-116458
315-402 116562-116825
403-537 117262-117666


Note AC015216 is ordered pieces so there are two main genes here
the first is an unknown gene from 48688-50877
the next gene is CYP18 from 51875-54944 on the minus strand
a third gene is found in part at 73548-74034

AC015216 Drosophila melanogaster, in ordered fragments
CYP18 54944-51875 minus strand
new gene 48688-50877 
this gene is identical to AC012373 152577-152804, 152894-153046, 153468-154541
this gene is identical to AC012164 84571-84344, 84254-84102, 107115-107984

31% to CYP18 an internal intron is present but cannot be precisely identified
48688 MSADIVDIGHTGWMPSVQSLSILLVPGALVLVILYLCERQCNDLMGAP
48832 PPGPWGLPFLGYLPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFFRR 49011
49012 DVMTGRAPLYLTH
49155 GIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECV 49301
49723 VNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGVVNFLPWLRHL 49902
49903 PANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQLRQS 50082
50083 KEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRDTDSQLYCDDQLRHLLAD 50250
50251 LFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRACIS 50421
50422 ETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFL 50601
50602 TADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTEVDMAGES 50778
50779 GITLTPTPHMLRFTKLPAVEMRHAPDGAVVQD 50877

AC014292 AC009393 AC008359 AC014072 AI257867
MITETLLTICAAVFLCLSYRYAVGRPSGFPPGPPKIPLFGSYLFMLIINF
KYLHKAALTLSRWYKSDIIGLHVGPFPVAVVHSADGVREILNNQVFDGRP
QLFVAAMRDPGQDVRGIFFQDGPLWKEQRRFILRYLRDFGFGRRFDQLEL
VIQEQLNDMLDLIRNGPKYPHEHEMVKSGGYRVLLPLLFNPFSANAHFYI
VYNECLSREEMGKLVKLCQMGIQFQRNADD
YGKMLSIIPWIRHIWPEWSGYNKLNESNLFVRQFFADFVDKYLDSYEEGVE
RNFMDVYIAEMRRGPGYGFNRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTE
ATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSLPFGAGKRL
CAGETFARNMLFLVTATMCQHFDFVLGPNDRLPDLSQNLNGLIISPPDFWLQLQDRH*

Cyp28a1 U89746 Drosophila mettleri

MLEITLILVLLLLGLFYVFMTWNFGYWRKRKVPGPKPHCFTGNY
PHMYNMKRHSVYDLNDIYSEYEHKFDAVGIYGARSPQLLVISPQVARRVFVSDFR
HFH
DNEISLMVDEKSDFIMANNPFSQIGDEWKQRRADITPGLTMGRIKTVYPVTQEVCQ
KM
TDWLRKQIRLPPSGGIDAKDMSLRFTSEMVTDCVLGLKAESFSDKPTPIMGYIKDL
FA
QSWTFIIYFVLVSTLPALRHVFKLRFVPLRIENFFVNLMQTAIDARRQQLAAGKQFE
R
VDFLDYILHLGKKKNLDTRHLTAHTMTFLLDGFETTALYDSCALVLSRDQEAQQKL
RE
ELEAHLDDKGIIDFEKLNELPFLDACVQESLRIFPPAFMSNKLCTEPIELPNKTGENF
TVERGTTVVVPHYCFMMDEEFFPDPQAFKPERFMQPDAAKMYREQGVFMAFGDG
PRVC
IGMRFALTQIKGALVELLTKFIIRVNPKTRSDNEYDPTTFIGTCKGGIWLDFELRQ

Cyp28a2 U89747 Drosophila mettleri

MLVTLILLGLVVFLGYKFLIWNYDYWRKRKVPGPKPALFTGNYP
HLFTGKQHPVYAVNEIYRKYKNDYDAVGIYISRMPQLLIVNPDLAHRVFVSNFKN
FHD
NEISALVVEKSDYIFANNIFSMTGDAWKERRSDITPGLTISRIKSVYPVTNQVCKKM
T
EYIKKQIRIAPKDGLNGKDLSLCFTTEMVTDCVLGLGAQSFTDNPTPVMAKMRNL
FRQ
DLPFLINTIAMALFPPLRRIIRLRFLSKTIVEFFVRFMETPLEERQKHISAGANINRV
DMLGYIIQLSPKRNMDSLKITACTMSFLLDGDDTPPSLLSNTLLLLGRNPQGHQRL
RE
ELSEHLCDQGFIDFDKLVDLPYLNACVHESIRIFLTAVSSKLCTESIELSNRNGPNFT
VEKGTVVLVPITCFMYDDDHFPNANEYNPERFLKPDSIKKYRDQGLFLGFGDGPRI
CIGMRFGLAQAKAALVEILVNFDVSVNARTRKDNLYDPKNLLSTLEGGIWLDFAARS


AC008324 Drosophila melanogaster chromosome 2 clone BACR25K01 (D854) RPCI-98
             25.K.1 map 25C-25D strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 81 unordered pieces
             Length = 122061

 Score =  172 bits (432), Expect = 9e-43
 Identities = 93/93 (100%), Positives = 93/93 (100%), Gaps = 43/93 (46%)
 Frame = +2

Query: 122   NNPFVLTGEAWKERRAEVTPGLSANR---------------------------------- 147
             NNPFVLTGEAWKERRAEVTPGLSANR
Sbjct: 28130 NNPFVLTGEAWKERRAEVTPGLSANRVSLGCPRIVYSKLISC*CLFSLGALIPLSIEVLQ 28309

Query: 148   ---------VKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLG 198
                      VKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLG
Sbjct: 28310 SINALPPQKVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLG 28489

Query: 199   ISAQSFTDNPTPMVGM 214
             ISAQSFTDNPTPMVGM
Sbjct: 28490 ISAQSFTDNPTPMVGM 28537

TKRVFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFYDL 28669
MQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAELTSHTMTFLTDGFETTAQVL 28840
THTLLFLARNPKEQMKLREEIGTAELTFEQISELPFTEACIH 28966 aa362

 Score =  144 bits (360), Expect(2) = 1e-35
 Identities = 73/102 (71%), Positives = 84/102 (81%), Gaps = 19/102 (18%)
 Frame = +2

Query: 98    SDFRSFHDNEMAKFTDSK 115
             +DFRSFH+NE   F  ++
Sbjct: 29560 TDFRSFHNNEWRNFVSTR 29613

Query: 113   DSKTDPILANNPFVLTGEAWKERRAEVTPGLSANRV-------------------KAAYP 153
             + KTD IL NNPFVLTG+ WKERR+E+ P LS NRV                   KA YP
Sbjct: 29666 NKKTDMILGNNPFVLTGDEWKERRSEIMPALSPNRVRNHINHLSNQNSIFEFRKVKAVYP 29845

Query: 154   VSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGISAQSFTDNPTPMVG 213
             VS  VCKKFVEYIRRQ  MA ++GL+A DL LCYTTEV+SDC LG+SAQSFTD PTP++
Sbjct: 29846 VSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTPLLK 30025

Query: 214   M 214
             M
Sbjct: 30026 M 30028

 Score =  139 bits (348), Expect(2) = 1e-51
 Identities = 65/65 (100%), Positives = 65/65 (100%)
 Frame = -3

Query: 1      MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDI 60
              MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDI
Sbjct: 119395 MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDI 119216

Query: 61     DEIYE 65
              DEIYE
Sbjct: 119215 DEIYE 119201

 Score =  112 bits (277), Expect = 1e-24
 Identities = 45/69 (65%), Positives = 58/69 (83%)
 Frame = -3

Query: 1      MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDI 60
              MCP++T L ++  +L L+YVFLTWNF+YW+KRGI TA +WPFVGSFPS+FT+KRN+ YDI
Sbjct: 114532 MCPVTTFLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDI 114353

Query: 61     DEIYEQYKN 69
              D+IYE   N
Sbjct: 114352 DDIYEYVYN 114326

 Score = 83.5 bits (203), Expect(2) = 1e-51
 Identities = 39/46 (84%), Positives = 41/46 (88%)
 Frame = -1

Query: 58     YDIDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSF 103
              Y +  +  QYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSF
Sbjct: 119169 Y*LHHLIRQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSF 119032

 Score = 25.8 bits (55), Expect(2) = 1e-35
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +1

gb|AC008324.1|AC008324 Drosophila melanogaster chromosome 2 clone BACR25K01 (D854) 
RPCI-98
             25.K.1 map 25C-25D strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 81 unordered pieces
             Length = 122061

 Score =  201 bits (505), Expect(3) = 3e-79
 Identities = 102/244 (41%), Positives = 163/244 (66%), Gaps = 43/244 (17%)
 Frame = +2

Query: 119   NNIFSMTGDAWKERRSDITPGLTISRI--------------------------------- 145
             NN F +TG+AWKERR+++TPGL+ +R+
Sbjct: 28130 NNPFVLTGEAWKERRAEVTPGLSANRVSLGCPRIVYSKLISC*CLFSLGALIPLSIEVLQ 28309

Query: 146   ----------KSVYPVTNQVCKKMTEYIKKQIRIAPKDGLNGKDLSLCFTTEMVTDCVLG 195
                       K+ YPV+ +VCKK  EYI++Q  +AP  GLN KDL LC+TTE+++DCVLG
Sbjct: 28310 SINALPPQKVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLG 28489

Query: 196   LGAQSFTDNPTPVMAKMRNLFRQDLPFLINTIAMALFPPLRRIIRLRFLSKTIVEFFVRF 255
             + AQSFTDNPTP++   + +F Q   F+  T+   L+PP+ +   +   +K +  FF
Sbjct: 28490 ISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFYDL 28669

Query: 256   METPLEERQKHISAGANINRVDMLGYIIQLSPKRNMDSLKITACTMSFLLDGDDTPPSLL 315
             M+  ++ R++  +A     R D L Y++QL  K+ +++ ++T+ TM+FL DG +T   +L
Sbjct: 28670 MQKCIQVRRESPAAQ---QRDDFLNYMLQLQEKKGLNAAELTSHTMTFLTDGFETTAQVL 28840

Query: 316   SNTLLLLGRNPQGHQRLREELSEHLCDQGFIDFDKLVDLPYLNACVH 362
             ++TLL L RNP+   +LREE+         + F+++ +LP+  AC+H
Sbjct: 28841 THTLLFLARNPKEQMKLREEIG-----TAELTFEQISELPFTEACIH 28966

 Score =  187 bits (470), Expect(3) = 2e-76
 Identities = 98/254 (38%), Positives = 160/254 (62%), Gaps = 19/254 (7%)
 Frame = +2

Query: 109   VVEKSDYIFANNIFSMTGDAWKERRSDITPGLTISRI-------------------KSVY 149
             V +K+D I  NN F +TGD WKERRS+I P L+ +R+                   K+VY
Sbjct: 29663 VNKKTDMILGNNPFVLTGDEWKERRSEIMPALSPNRVRNHINHLSNQNSIFEFRKVKAVY 29842

Query: 150   PVTNQVCKKMTEYIKKQIRIAPKDGLNGKDLSLCFTTEMVTDCVLGLGAQSFTDNPTPVM 209
             PV+  VCKK  EYI++Q ++A  +GL+  DLSLC+TTE+V+DC LG+ AQSFTD PTP++
Sbjct: 29843 PVSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTPLL 30022

Query: 210   AKMRNLFRQDLPFLINTIAMALFPPLRRIIRLRFLSKTIVEFFVRFMETPLEERQKHISA 269
               ++ +F     F+  ++   L+  +R+   + F +K    FF+  +   +  R +
Sbjct: 30023 KMIKRVFNTSFEFIFYSVVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITLRLEK--- 30193

Query: 270   GANINRVDMLGYIIQLSPKRNMDSLKITACTMSFLLDGDDTPPSLLSNTLLLLGRNPQGH 329
                  R D L Y++QL  K+ + +  I   TM+F+LDG +T   +L++ +L+LGRNP+
Sbjct: 30194 -PEQQRDDFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQ 30370

Query: 330   QRLREELSEHLCDQGFIDFDKLVDLPYLNACVH 362
              ++R+E+         + FD++ +LP+L+AC++
Sbjct: 30371 DKVRKEIG-----SADLTFDQMSELPHLDACIY 30454

 Score = 85.8 bits (209), Expect(3) = 3e-79
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 2/89 (2%)
 Frame = +1

Query: 363   ESIRIFLTAVSS-KLCTESIELSNRNGPNFTVEKGTVVLVPITCFMYDDDHFPNANEYNP 421
             E++RIF   +++ K+ TE  EL+N+NG +  +  G VV++P+    +D  ++     + P
Sbjct: 29026 ETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKP 29205

Query: 422   ERFLKPDS-IKKYRDQGLFLGFGDGPRICIG 451
             ERFL  +   KKYRDQGLF GFGDGPRIC G
Sbjct: 29206 ERFLNINGGAKKYRDQGLFFGFGDGPRICPG 29298

 Score = 76.1 bits (184), Expect(3) = 2e-76
 Identities = 37/94 (39%), Positives = 60/94 (63%), Gaps = 3/94 (3%)
 Frame = +3

Query: 358   NACVHESIRIFLTAVSS-KLCTESIELSNRNGPNFTVEKGTVVLVPITCFMYDDDHFPNA 416
             N  + E++R+F   V++ KL TE  E +N+NG    ++ G VV +P+    +D  ++ +
Sbjct: 30510 NFIILETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDP 30689

Query: 417   NEYNPERFLKPD--SIKKYRDQGLFLGFGDGPRICIG 451
               + PERFL+ +   +K YRD+G++L FGDGPR C G
Sbjct: 30690 LTFKPERFLESNGGGMKSYRDRGVYLAFGDGPRHCPG 30800

 Score = 68.3 bits (164), Expect = 6e-11
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 1/198 (0%)
 Frame = +1

Query: 275   RVDMLGYIIQLSPKRNMDSLKITACTMSFLLDGDDTPPSLLSNTLLLLGRNPQGHQRLRE 334
             R  ML  ++       +D   I     +F+ +G DT  + L  TLL+L  +    ++  E
Sbjct: 77458 RYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYE 77637

Query: 335   ELSEHLCDQGFIDFDKLVDLPYLNACVHESIRIFLTA-VSSKLCTESIELSNRNGPNFTV 393
             E+     D   I   +  +L Y+   + ES+R+F +     + C E   ++    P
Sbjct: 77638 EIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRQCVEETVVNGMVMP---- 77805

Query: 394   EKGTVVLVPITCFMYDDDHFPNANEYNPERFLKPDSIKKYRDQGLFLGFGDGPRICIGMR 453
              K T + + +   M D  HF N + + P+RF   +++   R    F+ F  G R CIG +
Sbjct: 77806 -KDTQISIHLYEIMRDARHFSNPDLFQPDRFFPENTVN--RHPFAFVPFSAGQRNCIGQK 77976

Query: 454   FGLAQAKAALVEILVNFDV 472
             F + + K  L  ++ NF +
Sbjct: 77977 FAILEIKVLLAAVIRNFKI 78033

 Score = 66.0 bits (158), Expect(3) = 2e-76
 Identities = 31/52 (59%), Positives = 39/52 (74%)
 Frame = +2

Query: 450   IGMRFGLAQAKAALVEILVNFDVSVNARTRKDNLYDPKNLLSTLEGGIWLDF 501
             +GMRF L Q KAALVEIL NF++ VN +TR DN  D    ++TL+GGI+LDF
Sbjct: 30857 LGMRFALTQLKAALVEILRNFEIKVNPKTRSDNQIDDTFFMATLKGGIYLDFKDL* 31012

 Score = 59.3 bits (141), Expect(2) = 3e-17
 Identities = 24/57 (42%), Positives = 38/57 (66%)
 Frame = -3

Query: 5      LILLGLVVFLGYKFLIWNYDYWRKRKVPGPKPALFTGNYPHLFTGKQHPVYAVNEIY 61
              L ++  ++ L Y FL WN+ YW+KR +P  K   F G++P +FT K++ VY ++EIY
Sbjct: 119374 LFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDEIY 119204

 Score = 53.5 bits (126), Expect = 2e-06
 Identities = 23/62 (37%), Positives = 38/62 (61%)
 Frame = -3

Query: 5      LILLGLVVFLGYKFLIWNYDYWRKRKVPGPKPALFTGNYPHLFTGKQHPVYAVNEIYRKY 64
              L+L+  ++ L Y FL WN++YWRKR +       F G++P +FT K++  Y +++IY
Sbjct: 114511 LVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDIDDIYEYV 114332

Query: 65     KN 66
               N
Sbjct: 114331 YN 114326

 Score = 51.9 bits (122), Expect(3) = 3e-79
 Identities = 24/36 (66%), Positives = 28/36 (77%)
 Frame = +3

Query: 450   IGMRFGLAQAKAALVEILVNFDVSVNARTRKDNLYD 485
             +GMRF L Q KAALVEI+ NFD+ VN +TRKDN  D
Sbjct: 29355 VGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFM 29462

29401 aaatcgtgcg aaacttcgac atcaaggtta atcccaaaac tcgcaaggat aatgaaattg
                                  29461 atgataccta ctttatgnnn nnnnnnnnnn nnnnnnnnnn 
nnnnnnnnnn nnnnnnnnnn

 Score = 50.4 bits (118), Expect(2) = 3e-17
 Identities = 18/46 (39%), Positives = 35/46 (75%)
 Frame = -1

Query: 55     YAVNEIYRKYKNDYDAVGIYISRMPQLLIVNPDLAHRVFVSNFKNF 100
              Y ++ + R+YKN    VG++ +R+PQL++  P+ AH+++VS+F++F
Sbjct: 119169 Y*LHHLIRQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSF 119032

AI062825 75% to Cyp28a2
QGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEID
DTYFMPALKGGVWLDFVERN*

Cyp28a3 U91565 Drosophila nigrospiracula

MRFALIQIKAAVVEVITKFNVRVNPKTRKDNEYEPTAFITSLKGGIWLDFESRP

Cyp28a4 U91565 Drosophila hydei

MRFAMTQIKGALVEVLTKFNVRVNPKTRTDNEYEPTRFITTLKGGIWLDFEPRQ

Cyp28a5 DS00180_1 : contig 1 (85065 bases) of 1 for P1 d29 (AC001660)
AI387905 AI387915 AI514076
MVLITLTLVSLVVGLLYAVLVWNYDYWRKRGVPGPKPKLLCGNYPNMFTMKRH
AIYDLDDI
YRQYKNKYDAVGIFGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDEKTDFI
FANNP
FSLTGEKWKTRRADVTPGLTMGRQIKTVYPVTNKVCQKLTEWVEKQLRLGSKDG
IDAKQMS
LCFTTEMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFPSLSHLI
KLR
FVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFLDYILQLGEKRNLDNRQLLA
YSMTF
LLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTIAFEKLSDLPYLDACV
QETI
RLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSFQ
PERFL
EPDAAKTFRERGVFMGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKINDKTRKD
NDYEP
GQIITGLRGGIWLDLEKL*

AC014191 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in ordered
1-519 10002-8254 36% to 28a5 50% to part of AC009355 38% to whole AC008327
34% to 28a5 36% to 28A1 and 28A2
10002 MFGSLLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHFTMDMRDIY 9811
      RHYRNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENN 9631
9630 DASKMVDIAKDRLVALNPFVLEGEEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFI 9451
9450 AIKSAGGKDLDCID
9350 LGLRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWL 9171
9170 RPKVFPRSHDRFYGQMISEALRLRRSKHQERNDFINHLLEMQRELDLSEEDMASHAMT 8997
8996 FMFDGLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGY 8817
8816 LPDLDALIDLPYLSACFN 8763
     *ESLRIYPAGGWASKTCTKEYELRGS 8629
8628 HHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCKQQG 8476
8475 IFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFVGVHKGGI 8296
8295 WLQFVPRKNVTTK* 8254

AI403094 AI403665 AA698711 AA697564 AC008324 AI062825 AC008327 50% to 28A2 
MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVF
TQKRNVVYDIDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDF
RSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKERRAEVTPGLSANRVKA
AYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGIS
AQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFYDL
MQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAELTSHTMTFLTDGFETTAQVL
THTLLFLARNPKEQMKLREEIGTAELTFEQISELPFTEACIH
ETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKP
ERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRK
DNEIDDTYFMPALKGGVWLDFVERN*
1-69
114532 MCPVTTFLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDI 114353
114352 DDIYEYVYN 114326
missing 28 amino acids 70-97
98-114
29560 TDFRSFHNNEWRNFVST 29613
115-355
29666 KTDMILGNNPFVLTGDEWKERRSEIMPALSPNRVKAVYP 29845
29846 VSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTPLLK 30025
30026 MIKRVFNTSFEFIFYSVVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITLRLEKP-EQ 30202
30203 QRDDFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVR 30382
30383 KEIGSADLTFDQMSELPHLDAC 30454
356-448
30519 ILETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDPLTF 30698
30699 KPERFLESNGGGMKSYRDRGVYLAFGDGPRHCPG 30800
30860 MRFALTQLKAALVEILRNFEIKVNPKTRSDNQIDDTFFMATLKGGIYLDFKDL* 31021

CYP4AA1 AC004516 68725-68267 AC004426 AC005556 comp(849-1502)
P1s DS08658 (D196) and DS00960

MHLRLLSPPQLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPF
L
GNCMLVTDKDCK*YGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVFFYRLM
HNFLGD
GLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDAEAVGTEINIAK
YVNN
CVLDILN*EAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIYHW
TKMAND
ELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRDFTEEDIVN
EACTF
MLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMTDLHEMRYM
EMCIKE
ALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIYPDPEKFQPERF
SPEN
SENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITL
RA
SGGLWVRLKERDHPLIAH*

L49408 DS02740, AI405120

MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKV
IDVFA
RQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLG
VLLTD
GEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRI
EMHDLTS
VYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF
SGYN
GFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQS
LLAICL
DMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPY
CEAIT
LEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFN
PDRYL
FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEV
PLEGAT
AAVKPYDIMLVAREQ*

AC003055|AC003055 Drosophila melanogaster (P1 DS06332)
This is the end of a partial gene found on AC009909
ESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAF
KPE
RFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRDRL
IPKGD
SGFGVVLQGDVNLEYRRFFR*

second gene complete 5801-7437
MFTLVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSYPGILINKSR
SLILDVQDVYSKYKDKYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVGHNP
DDKYVAGSPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQG
DIIETRDLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTL
VAIFVRKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQLQQRGNSIHDSV
GHALTVHLDGFETSGAVLYNAVSYQLSEHHEEQEKLRSEILEALASEGQISYDQINNLPYLD
QCFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDNDIYPEASE
FRPDRFENGAASVLTKRGCFLPFGDGPRICLGMRVGQLSVKTAIVHILSNYQVEQMKKV
PLGADSGMGIFLNGDVELKYTKLQK

AC002444 (P1 DS02782 gene runs off end of cosmid) AC009909

MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSN
LVFDVQKIY 77703
SKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWD
KYARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVA
EKNNILETRDV 78113
CFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVA
PCSR 78351
LLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLV
GHA 78531
LTVMLDGYDTSGTALLHALYYVLAENPAVQQKLRVEILSCMA 78711
SEKSLDFEKLSSLQYLEQ 78765

AC009909 Drosophila melanogaster chromosome 2 clone BACR30P05 (D1011) RPCI-98
             30.P.5 map 22F-23A strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 68 unordered pieces
             Length = 106422
1-65
45210 MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFD 45031
45030 VQKIY 45016
66-184
44962 SKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLN 44783
44782 PFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDV 44606
185-363
44544 CFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSR 44368
44367 LLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLVGHA 44188
44187 LTVMLDGYDTSGTALLHALYYVLAENPAVQQKLRVEILSCMA 44008
44007 SEKSLDFEKLSSLQYLEQCFN 43945
last part is from AC003055 Drosophila melanogaster (P1 DS06332)
ESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAF
KPE
RFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRDRL
IPKGD
SGFGVVLQGDVNLEYRRFFR*

This gene from AC009909, AC002444, AC003055
MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFD
VQKIYSKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDK
YARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILE
TRDVCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAP
CSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLV
GHALTVMLDGYDTSGTALLHALYYVLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQY
LEQCFNESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPE
PEAFKPERFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGR
DRLIPKGDSGFGVVLQGDVNLEYRRFFR*


2nd = AC003055 42101-
This fragment is before the main segment of another P450 below it so it is a different 
gene.
41631 ERLAMLTLKSALVHILSNFQVVRGRDRLIPKGDSGFGVVLQGDVNLEYRRFFR* 41792

Query: 1     MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKS-NLVF 59
             M+ L  L L ++H+    +Y YLTW+HKYW KRG+VTA PLT+LG+YPG+L  KS +L+ 
Sbjct: 42101 MFTLVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSYPGILINKSRSLIL 42280

Query: 60    DVQKIYS---KYKGKHRAVGVFVTRQPQILVLD----------------PELAHEVLVSN 100
             DVQ +Y       G      ++ T+  Q  V D                P LAHE+LV+ 
Sbjct: 42281 DVQDVYK*ALPLIGDCLLQKIWSTQ*IQGQVQDSRNLHYATARSSWFWVPALAHEILVNK 42460

Query: 101   FRCYKDSLQSSYLRHAKWDKYARLNPFWASGQSWRRL---------RTDAQAGISG 147
             F  ++D++ SS++ H    KY   +P     Q WR++         RTDAQ+  +G
Sbjct: 42461 FSPFRDTITSSFVGHNPDAKYVAGSPLL---QRWRQMEATALRKCWRTDAQSTENG 42619

Query: 66    SKYKGKHRAVGVFVTRQPQILVLD-PELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARL 124
             SKYK K+R VG F+TRQP       P L      ++   +     ++     +     R 
Sbjct: 42354 SKYKDKYRTVGTFITRQPAAPGFGFPPLPMRFW*TSSVPFGTPSPAALWATIRMQSTWRG 42533

Query: 125   NPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDV 184
             +PF+++G  W+RLR++   G++ SRL+ AY+IWEQ G+ L EY+ +   E+ +I+ETRDV
Sbjct: 42534 HPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQGDIIETRDV 42713

Query: 185   -----------------CFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAF 227
                               +R+TA+ MADFIWGIDAG+L+  + +    Q+ ++ W+++AF
Sbjct: 42714 RT*TETHFHQANITLQLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAF 42893

Query: 228   YMLTLFMATIVAPCSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQ 287
               +  F  T+VA   R L   RF+ K TDEFF  LT++++ LR       RTDYLSHL+Q
Sbjct: 42894 SSMIRFNKTLVAIFVRKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQ 43073

Query: 288   LRDQKQATHDDLVGHALTVMLDGYDTSGTALLHALY-----------------------Y 324
             L+ +  + HD  VGHALTV LDG++TSG  L H LY                       Y
Sbjct: 43074 LQQRGNSIHDS-VGHALTVHLDGFETSGAVLYHMLYSVSKFHNFHILLHI*SIENNAVSY 43250

Query: 325   VLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLEQ 363
              L+E+   Q+KLR EIL  +ASE  + ++++++L YL+Q
Sbjct: 43251 QLSEHHEEQEKLRSEILEALASEGQISYDQINNLPYLDQCFN

43484 ESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDNDIYPEASEFRPDRFENGAASV
LTKRGCFLPFGDGPRICLG 43750

AC007571 Drosophila melanogaster chromosome 3 clone BACR48A14 (D551)
comp(64150-64449) missing some internal sequence, exons not exact

MLASIILSGWLLLAWLYFLWS
RRRYYKVAWQLRGPIGWPLIGMGLQMMNPESKSWTGF*
YMDGLSRQFKAPFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYR
FMSSAIGDGLFTSSSPRWHKHRRLINPAFGRQILSNFLPIFNAEAEVLLQ
KLELEGVQHGKRLEIYQILKKIVLEAAC*
QTTMGKKMNFQHDGSLCIFKAYNGLVQMLRHLIMVNNIC
missing about 95 amino acids in the middle. Sequence similarity is too low to
identify exons from genomic sequence
WLITFAFSLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQVSYWSDQSCTH
The sequence above probably contains an exon since it shares SPWL with
AC007752 in the same region of a related gene.  Exon boundaries are not clear.
One other exon is probably not identified here.
*LISQTFETTSTALYFTILCLAMHPCYQ
EKLHKELVTELPPSGDINLEQLQRLEYTEMVINEAMRLFAPVPMVLRSAD
QDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDAHFGLD
SPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEE
LLVKGNISLKLKDYPLCRVERR*

Three reading frames of the undefined region
note there are 58-60 amino acids from the W of the C-heliX to the ETAM exon
ETTMGKKMNFQHDGSLCIFKAYNGLVQMLRHLIMVNNICL*LDRSVCKTNAIAVALS*LNISSFRTFPPAAKGRRHTVWVYRTGKL
LVRSKLHPLKMVSSIFRQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTIAAVGFKHPVK
ILYHDSFHRLSRPHRRHCTLPSSAWQCIPATRRSCTRNWS

RDNDGQENELPARWIFMHI*SL*WVSSNAQAFNNG**HLPLA*PKCV*NECYRRGSILT*YIVVPDFSACSKRSSAYCLGL*NR*A
TGPIKVAPTKNGELHLPTASRTHSLGSGRQFQSGSAAIRNGDEGQVQSHFH*AGEGACGARSAELAGCEG*GECDHCSGRFQTSSE
DIVP*LISQTFETTSTALYFTILCLAMHPCYQEKLHKELVT

RQRWARK*TSSTMDLYAYLKLIMG*FKCSGI**WLITFAFSLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFIEQVSY
WSDQSCTH*KW*APSSDSFSNP*SR*WPPIPIRISSDPKWR*GASPKPFSLSR*GSMWSAVS*VGRM*GMRRM*PLQR*VSNIQ*R
YCTMTHFTDFRDHIDGIVLYHPLPGNASLLPGEAAQGTGH

AC007752 best match to AC007571 can be used against one another to find exons
121000 region 3 frames
ETTMGSDVKDEESFRSNSLLGRYQW*XXVLTWNRNASIH**HPGNHDRYVLLSVAQ*PILPAAGWKGIALLPGQN*DSSVYSEGEH
LQLLPPLIHLRIS*PL*IIERKLAEDEMGALPSIQSNDKNLFLNLVTDLMRRGVFTLKNVEDESNIIVFGAFETTANAVYYTLMLL
AMFPEYQERAFEEIK

KPPWAAM*RMKRASGAIPCWGDTNGEF*XXLGIGMHLSINSILETMTDMCFSPWLNSRFCRQLAGKESHYYQAKTEIRQFIRKVST
SNYSLRLFTYESLNPFR*LRESWPRTKWEHYLPSSPMIKTYF*IWSRI**DEECLP*RMLRMSRISSFLELLRPRLMQCTTP*CCW
RCFRNTRRGPLRK*R

RNHHGQRCKG*RELQEQFLAGAIPMVSFDLESECIYPLIASWKP*XXQICASLRGSIADFAGSWLERNRTTTRPKLRFVSLFGR*A
PPTTPSAYSLTNLLTPLDN*EKVGRGRNGSTTFHPVQ**KPISKSGHGFDETRSVYPEEC*G*VEYHRFWSF*DHG*CSVLHPDVA
GDVSGIPGEGL*GNK

AL068269 AA141181 might be same as AC005130
302-502 comp(5-630) 38% with 6a2 very similar to AL062712
AAQAXFLXLAGFDTSSSTYHFLRCTSWPRTPXFRTPXNGXSGCLAV
*PRSATELRHFTGLXYLRQVVDEVLRXYPPTXFLDRCCNSRTGYDL
SPWNGGSPFKLRAGTXVYISVLGIHRDAQYWPNPESFDPERFSAEQ
RQQHHPMTYLPFGAGPRXCIGXXLGQLEIKVGLLHILNXFRVEXCE
RTLPEMRFDPKAFVLTAHNGTYLRFVKNXL*

AC005130 DS01560, complete sequence AL062712 (BACR006M08), AL075733 (BACR037C16),
AL059237 (BACR025F06) AC005811 DS05527 heme region 51% with 6a2 MAY BE SAME GENE AS
AL068269
439-506 21-224 Probably new family 3 pieces
2520 FGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRRILVEDFPEF 2374
1859 CFLLLAGFDTSSSFALYELAKNPTIEHRLQAELRVDLQSSHNHQLSYDTLTGLVYLRQVLED 1674
1450 LPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVELCERTLPEMRFDP* 1322

*CIHKVTLENRCICGQTIFTITWLS
LFSFFCAALAVGSVVLLPLIALLAVWLWQRRHFRIWRRLGVPYLPAAPVL
GNVLNVETAASVISFESYTSVRKLLGAPL*
*FGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRR
ILVEDFPEFSSSFKSTDAIRDTMGSGNLLFTKYKTWWETHKIFAVRTSGK*
*YVFADAPYRNCGRHNPSARLLRSPGCFLLLAGFDTSSSFALYELA
KNPTIEHRLQAELRVDLQSSHNHQLSYDTLTGLVYLRQVLEDDPQFHDEI
SYPPRELQRIASV*
*SDTCLAVYFIIFKIRNPKPRIL
HQIDLTRATLTASLHALPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVE
LCERTLPEMRFDP*

AC012831 comp(42975-44564) similar to AC014742
MIAVFSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFVGNVWNLLRGACCFGDQFRELYESKEA
AGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLE
NIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRV
GTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKN
TTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLG
IHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTA
HNGTYLRFVKNSL*

AC014742 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in ordered
1040-2504
suspect frame shift at about amino acid 9 since N-terminal not found in other frame
This gene is missing K-helix to PERF region and has two in frame stop codons
This is probably a pseudogene.
MVIAFFIFL*CAALAVGSVVLLPLIALLAVWLWQRRHFRIWRRLGVPYLPAAPVLG 1204
NVLNVETAACCFGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRRILVEDFPEFSSSFKST 1398
DAIRDTMGSGNLLFTKYKTWWETHKIFAIRLGGRRIRSLLYGLLERI*QNLEAHMAQK 1557
LNGAESVELEVKQLCALFTTDIFAKFALQSLQNPEAEFRPMCIEVNDPKPKRLSHHLFTGF 1710
TPPI-YRVRTHLYSEEYERFMRKSMNYVLAQRAEN*EKRYDLIDMFLQMHRT 1841
ETAEGIIHRPDFYVAQAAFLLLAGFDTSSSFALYELAKNPTIEHRLQAELRVDLQSSHNHQLSYDTLTGLVYLRQVLED 2077
LPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVELCERTLPEMRFDP*ASVLTAHNGTFLRFVRNSL* 2504

AL070820.1|CNS00FNQ Drosophila melanogaster genome survey sequence TET3 end
181-429 70-848 40% with 28A1
LSLCYTTEVVSDCGLGXSAXSFTDTPTPLLKXIKRVFNTSFEFIFYSVVTNLWQKV
RKFY
SVPFFNKETEVFFLDIIRRCITLRLEKPKQQRDDFLNYILQLQEKKGLHTDNILIN
TMTFILDGFETTALVLAHIMLMLGRNPESK
LTFDQMSELPHLDACI*LETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVV
TIPVKAL 794
HHDPQYYEDPLTFKPERF 848

AL062352 AL054245 AI108091 AI113367 AI064259 AI064268 36% with 6a2
FRPPGXITXXPXMTXTXYXLAKNEXLQDRLRQEIVDFFGDEDHISY
ERIQEMPYLSQXVNETLRKYPIVGYIEREAIHPRTIPQHGVPHGMS
IYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGP
RNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPETF
CTRRIISRFEAITGPAN*

AC014186 AA803931 AA821188 AA803220 AI404794
MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPL
RCGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLLCINLHPNS
ILEKVSQYRVHFQRPLRVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHAR
GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLE*
DTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQ
VIHSQMESVIEKRAKELLDMGEPAGRAHNLLDTLLLAKFEGQSLSRREI
RDEINTFVFXGVDTTTAAMSFVLYALAKFPETQTRLRKELQDVALDETTDLDALNGLPYLEALIKE
VLRLYTIVPTTGRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPE
DGAVAPPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQM
VLKAQQGINVSFLKQ*

AC014186 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in ordered
           pieces
           Length = 13825

 Score =  269 bits (681), Expect = 5e-72
 Identities = 155/195 (79%), Positives = 162/195 (82%), Gaps = 53/195 (27%)
 Frame = -3

Query: 1   MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPL------------RCGALLAVLLAW 48
           MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPL                +LA  LA
Sbjct: 968 MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPLGMRRPSGGAPRLAAAKVLATHLAA 789

Query: 49  Q-----------------QRKCWRLIWQLNGWRGVIQQPVLWLLLCINLHPNSILEKVSQ 91
           +                 Q    +L  +    RG+   P  ++          ILEKVSQ
Sbjct: 788 ERMARSDPAAGAMVTTLHQSASEQLSVESKAIRGISSYPDAFIA--------GILEKVSQ 633

Query: 92  YRVHFQRPLRVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHAR---- 147
           YRVHFQRPL VLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHAR
Sbjct: 632 YRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRRGLLHARGKYL 453

Query: 148 ------------------GQKWKLRR--LNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT 187
                             GQKWKLRR  LNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT
Sbjct: 452 NS*LSKLCN*LYLPANF*GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQT 273

Query: 188 NLHGQAVK 195
           NLHGQAVK
Sbjct: 272 NLHGQAVK 249

PSNHQTEPLKTTLIASVCAAYKAPH*IEKKTRRGIARPLLVATLVMHLNIALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQ
PVLWLLLCINLHPNS*V*SRRPLEE*VLIRMHSLQAYWRRYPNIGCTSSDRWPFSLAPESCSISMIPPAWSAFSMRPNAWTRPFCR
MASLFDAVCSMPEVNT*IADYPNYAISFIYLQIFEGKNGNCAASN*IPPSVTISWPVSSMSSIRWAIRWWNSSKRRRIFMDRRLSL
RLPRICLVELYSRYPVVSSTTQLVNNKHLKSKTS*LTCLNLLKCQQSIN*LQSTFKWNFINKLLIAFTYLRGTDTFPPFPC

AIKSSN*ATKNHVDCKCMCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPLGMRRPSGGAPRLAAAKVLATHLAAERMARSDPA
AGAMVTTLHQSASEQLSVESKAIRGISSYPDAFIAGILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQ
DGFFVRRGLLHARGKYLNS*LSKLCN*LYLPANF*GQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKF
TAAEDLLSRAVLEVSCCK*HNSTS***TFKI*N*LINLLKFIEMPAID*LIAINIQMEFYKQITNCIYLPARDGHVPSVSM

SHQIIKLSH*KPR*LQVYVLPTKHHIRSKKKRVVESLGHCW*RH**CT*TLPFGHAAPFWRCSSPGSSESAGDSSGS*TDGAE*SS
SRCYGYYSASICIRTVECRVEGH*RNKFLSGCIHCRHTGEGIPISGALPATAGRSRWHPSPALYR*SRRHGVRSQCARMPGQDLSA
GWLLCSTRSAPCQR*IPK*LIIQIMQLALFTCKFLRAKMEIAPQATESRLQSQYRGQFLRCLQFGGQSDGGTVPNADESSWTGG*V
YGCRGFA*SSCTRGILL*VAQLN*LIINI*NLKLVN*LA*IY*NASNRLINCNQHSNGIL*TNY*LHLLTCEGRTRSLRFHA

blast with 4d2 etam onward
gb|AC014186.1|AC014186 Drosophila melanogaster, *** SEQUENCING IN PROGRESS ***, in 
ordered
            pieces
            Length = 13825

 Score =  123 bits (306), Expect = 8e-28
 Identities = 70/185 (37%), Positives = 114/185 (60%), Gaps = 5/185 (2%)
 Frame = +2

Query: 130  EGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKE 189
            +G DTTT+A+SF LY +++ PE Q RL++E++DV  ++      L  L  L ++E +IKE
Sbjct: 3335 QGVDTTTAAMSFVLYALAKFPETQTRLRKELQDVALDETTD---LDALNGLPYLEALIKE 3505

Query: 190  SLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDAD 249
             LRL+  VP  GR   +  EI G+   AG    + ++ L  D EY+  P  F+PER+  +
Sbjct: 3506 VLRLYTIVPTTGRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPE 3685

Query: 250  VPQIHP--YAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEP---RHSMNI 304
               + P  ++YIPFS GP  CIG+++++L MK   ++L+R F+ + L PE    R    +
Sbjct: 3686 DGAVAPPAFSYIPFSGGPHVCIGRRYSLLLMKLLTARLVREFQ-MELSPEQAPLRLEAQM 3862

Query: 305  VLRSANGVHL 314
            VL++  G+++
Sbjct: 3863 VLKAQQGINV 3892

 Score = 65.2 bits (156), Expect = 3e-10
 Identities = 42/141 (29%), Positives = 74/141 (51%)
 Frame = +3

Query: 1    ETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIK 60
            +T+MG +++ Q   + P +QA +  + +L KR I+     DWIF+ TQ    +  D+ ++
Sbjct: 2934 DTSMGAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLW--RDLDEQLQ 3107

Query: 61   VMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDEDI 120
            V+H   E++I +R + L++  +              R   LLD LL +  +G  LS  +I
Sbjct: 3108 VIHSQMESVIEKRAKELLDMGEPAG-----------RAHNLLDTLLLAKFEGQSLSRREI 3254

Query: 121  REEVDTFMFEGHDTTTSAISF 141
            R+E++TF+F      T+  SF
Sbjct: 3255 RDEINTFVFAVGFPVTTNYSF 3317

4d2 for comparison
VVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYR
                                                   
GLDPEQIMDFVKKNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKL
                                                   
LNCWLGDGLLMSTGRKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGM
                                                   
TPINIFPVICLTALDIIAETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRV
                                                   
DWIFRLTQPTEAKRQDKAIKVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRR
                                                   
MALLDVLLQSTIDGAPLSDEDIREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRL
                                                   
QQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKH
                                                   
IPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPYAYIPFSAGPRNCIGQK
                                                   
FAMLEMKSTVSKLLRHFELLPLGPEPRHSMNIVLRSANGVHLGLKPRA

AI404831 GH24669 52% to 6d2 N-term AC008197, AC009846, AA141002 C-term
MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYDVYV
KSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIF
SLRGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQ
NYAIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFG
VSNGCSCRIAQFLFRIGFKNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDD
IKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQETIRKYPGLP
ILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAI
IKILQNFNVEVMSRSEIEFENSGIALIPKHGVRVRLSKRVPKLS*

6d1 for comparison

MLLLLLLIVVTTLYIFAKLHYTKWERLGFESDKATIPLGSMAKV
FHKERPFGLVLSDIYDKCHEKVVGIYLFFKPALLVRDAELARQILTTDFNSFHDRGLY
VDEKNDPMSANLFVMEGQSWRTLRMKLAPSFSSGKLKGMFETVDDVAAKLLNHLNERL
KDGQSHVLEIKSILTTYAVDINGSVIFGLEIDSFTHPDNEFRVLSDRLFNPKKSTMLE
RFRNLSTFMCPPLAKLLSRLGAKDPITYRLRDIVKRTIEFREETGVVRKDLLQLFIQL
RNTGKISDDNDKLWHDVESTAENLKAMSIDMIASNSFLFYIAGSETTAATTSFTIYEL
AMYPEILKKAQSEVDECLQRHGLKPQGRLTYEAIQDMKYLDLCVMETTRKYPGLPFLN
RKCTQDFQVPDTKLTIPKETGIIISLLGIHRDPQYFPQPEDYRPERFADESKDYNPAA
YMPFGEGPRHCIAQRMGVINSKVALAKILANFNIQPMPRQEVEFKFHSAPVLVPVNGL
NVGLSKRW

gb|AC009846.2|AC009846 Drosophila melanogaster chromosome 3 clone BACR23F10 (D1097) 
RPCI-98
             23.F.10 map 94C-94D strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 79 unordered pieces
             Length = 110926

 Score =  425 bits (1080), Expect = e-119
 Identities = 207/207 (100%), Positives = 207/207 (100%)
 Frame = +2

Query: 1     MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD 60
             MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD
Sbjct: 28877 MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD 29056

Query: 61    VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL 120
             VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL
Sbjct: 29057 VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL 29236

Query: 121   RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY 180
             RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY
Sbjct: 29237 RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY 29416

Query: 181   AIDIIASTIFGLDVNSFENPDNKFRKL 207
             AIDIIASTIFGLDVNSFENPDNKFRKL
Sbjct: 29417 AIDIIASTIFGLDVNSFENPDNKFRKL 29497

INVAVII*NSSL*RIKRTLLPKRTNNRRISAHIIGGSPV**SAIY*LSQIKGGFKKKKRCTTSTMFSLILLAVTLLTLAWFYLKRH
YEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYDVYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDE
ERDPLSANIFSLRGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIFGLDV
NSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPS*VISESEFCYGVSNGCSCRIAQFLFRIGFKNPVGLAMLQIVKETVEYREK
HGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGKS*YKLNSNQDRLSGLTFSGHIKTISLEAITAQAFIFYIAGQETTGSTA
AFTIYELAQYPELLKRLQDEVDETLAKND

YQCSCDHLEFFAVKN*ENVTAKENK*STNFSAYNWRLSSLIVSYILTFTDKGRI*KKEKVHYFDYVFADFIGRNAIDFGVVLSEAP
L*VLGATRISI*KTLRDSIRLLGQCVAAGEEHGLGHLRCVCEE*RARLGHLFALPSGCFDQRRRSGSPCSGPGFRQFPRSRRLR**
GTGSPVGQYLLASRSELAIDEAHVVAMFHIRKVEEHVQHIRGYW*QDGGPSAKGAAGGGLQGGGHKESDAKLCH*HYSLDYLWLGC
K*LRKS**QVP*TGVVGQSQ**IQCHVRHDDLPGALVSNK*E*VLLWCV*WMFL*DSTVPIQNRF*KSSWPGHVADCQGNR*VSRE
TWNSAQGSVAVAHSAEEYRQDRRE*REVL*HSEDTRW*VIIQVKF*SR*IEWFNVFRSY*NHILGGHHRSGFYILHRWSGDHRIDC
SLYHLRAGSVSRATEAPAG*SGRDTGQKR

LSM*L*SFRILRCKELRERYCQREQIIDEFQRI*LEALQFDSQLYIDFHR*RADLKKRKGALLRLCFR*FYWP*RY*LWRGSI*SA
TMSTGSDADFHLKNTPGFHSVAWTVCGGRRRAWAWPSTMCM*RVKSASWAFICSSVRLF*SETPIWLAVFWPRISPVSTIAAFTLM
RNGIPCRPISSRFAVRAGDR*GTCCRHVSHPES*RACSAHPRILVTRWWPICKRSCRRRASRRWT*RK*CKTMPLTL*PRLSLAWM
*IASKILITSSVNWCRWPEPIIDSMPCSA**SSWCPRK**VRVSFAMVCLMDVLVG*HSSYSE*VLKIQLAWPCCRLSRKPLSIAR
NME*CARICCSCSFS*GIPAR*TRMTRSPLAFRRHPMVSHNTS*ILIKID*VV*RFQVILKPYPWRPSPLRLLYSTSLVRRPPDRL
QPLPSTSWLSIQSY*SACRMKWTRHWPKT

AC008197 Drosophila melanogaster chromosome 3 clone BACR02L12 (D753) RPCI-98
             02.L.12 map 94B-94C strain y; cn bw sp, WORKING DRAFT
             SEQUENCE, 113 unordered pieces
             Length = 125235

 Score =  425 bits (1080), Expect = e-119
 Identities = 207/207 (100%), Positives = 207/207 (100%)
 Frame = +2
67979
Sbjct: 67979 MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD 68158
Sbjct: 68159 VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL 68338
Sbjct: 68339 RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY 68518
Sbjct: 68519 AIDIIASTIFGLDVNSFENPDNKFRKL 68599
VISESEFCYGVSNGCSCRIAQFLFRIGFKNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDD
IKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQETIRKYPGLP
ILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRI

SIRQIYE*VKFSIIVLP*R*TLLVFRSPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKGESP
WKSYFLIKNRVYPDS*AQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEKQQPQDLHSAGI
SRGSTSVRVMSKANHQAHNVTLHIDKGI*LETRFNFD*EGFNIKYYKKHILLNRFLLF*NRVAMLKLVN*TAAHHKSTISQRILRL
*INF*VFCI**LLAYNIRALFCISPLI*SCHQDYQCSFLGGFFFPQIFFF*KGKKFFLFGCKELRERYCQREQIIDEFQRI*VEAL
QFDSQLYIDFRRERVDLKKRKGALLRLCFR*FYWP*RY*LWRGSI*SATMSTGSDADFHLKNTPGFHSVAWTVCGGRRRAWAWPST
MCM*RVKSASWAFICSSVRLF*SETPIWLAVFWPRISPVSTIAAFTLMRNGIPCRPISSRFAVRAGDR*GTCCRHVSHPES*RACS
AHPRILVTRWWPICKRSCRRRASRRWT*RK*CKTMPLTL*PRLSLAWM*IASKILITSSVNWCRWPEPIIDSMPCSA**SSWCPRK
**VRVSFAMVCLMDVLVG*HSSYSE*VLKIQLAWPCCRLSRKPLSIARNME*CARICCSCSFS*GIPAR*TRMTRSPLAFRRHPMV
SHNTS*ILIKID*VV*RFQVILKPYPWRPSPLRLLYSTSLVRRPPDRLQPLPSTSWLSIQSY*SACRMKWTRHWPKTTERSPTIP*
TRWNFWTCVCRKPFANIRVFPF*IVNAPRTTQYPTPTTSFRRERQL*SPCTAFTMMQSTSRIPRPMIPNASRRRVAIIIPLHSCRL
ARVPGF

LHPADL*VSKVLDYSIALKVNTFGF*ISAGCGRLYGCT**AATGWSYFWSVAQLHGFRPVPTPQTR*LPLVRTENGPTEVHQR*ES
LEVLFSH*ESCLS*FISSIGGDLQDQSGRHHLSQLRWNHPSEGACYAETARWR*SPCGLPGPGGIPFQFRTLVREATAPGSS*CRH
KQGIHFGASNVQGKSSSPQRNPTY**RNLVRNKIQF*LGRI*Y*IL*KTYTSKPVPSILK*SCYAKVS*LNSSPS*INNKSTNSKI
INQLLSILYIIIVSL*HKSFVLHFTINIKLSSRLSM*LFGGVFFPPNFFFLKREKIFSFRL*RIKRTLLPKRTNNRRISAHISGGS
PV**SVIY*LSQRKGGFKKKKRCTTSTMFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIY
DVYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSLRGQSWRSMRHMLSPCFTSGKLKSMF
STSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPS*
VISESEFCYGVSNGCSCRIAQFLFRIGFKNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDG
KS*YKLNSNQDRLSGLTFSGHIKTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSL
NKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESRNYNPTAFMPF
GEGPRI

TPSGRFMSK*SSRL*YCLKGKHFWFLDLRRMWTSIRVHLVSRHWMELFLVRCSAAWFPTSSYASN*VTPIGTNGKWAHRSSPKVRV
LGSPIFSLRIVFILIHKLNWRRSTRPVWPPSFVATQMESPE*GSMLCRDCAMEVIPMWIARTWRDSISISNPGPRSNSPRIFIVPA
*AGDPLRCE*CPRQIIKPTT*PYILIKESS*KQDSILIRKDLILNIIKNIYF*TGSFYFKIELLC*S*LTKQQPIINQQ*VNEF*D
YKSTFKYFVYNNC*LIT*ELCFAFHH*YKAVIKTINVAFWGGFFSPKFFFFKKGKNFFFSAVKN*ENVTAKENK*STNFSAYKWRL
SSLIVSYILTFAEKGWI*KKEKVHYFDYVFADFIGRNAIDFGVVLSEAPL*VLGATRISI*KTLRDSIRLLGQCVAAGEEHGLGHL
RCVCEE*RARLGHLFALPSGCFDQRRRSGSPCSGPGFRQFPRSRRLR**GTGSPVGQYLLASRSELAIDEAHVVAMFHIRKVEEHV
QHIRGYW*QDGGPSAKGAAGGGLQGGGHKESDAKLCH*HYSLDYLWLGCK*LRKS**QVP*TGVVGQSQ**IQCHVRHDDLPGALV
SNK*E*VLLWCV*WMFL*DSTVPIQNRF*KSSWPGHVADCQGNR*VSRETWNSAQGSVAVAHSAEEYRQDRRE*REVL*HSEDTRW
*VIIQVKF*SR*IEWFNVFRSY*NHILGGHHRSGFYILHRWSGDHRIDCSLYHLRAGSVSRATEAPAG*SGRDTGQKRRKDHLRFP
EQDGIFGPVCAGNHSQISGSSHSES*MHPGLHSTRHQPRHSEGNASCDLPVRHSP*CRVLPGSRDL*SRTLLGGESQL*SHCIHAV
WRGSQDL

gb|AA141002|AA141002 CK01076.5prime CK Drosophila melanogaster embryo BlueScript
           Drosophila melanogaster cDNA clone CK01076 5prime
           Length = 704

 Score =  119 bits (295), Expect = 2e-27
 Identities = 63/103 (61%), Positives = 67/103 (64%), Gaps = 1/103 (0%)
 Frame = -1

Query: 73  KNDGKITYDSLNKMEFLDLCV-QETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVI 131
           K  GK T     +      CV ++   K PG PI                VIPKGTPVVI
Sbjct: 704 KXTGKXT*XFPEQDGIFGTCVCRKPFAKXPGXPIXEWGMHPG*HSTGHQPVIPKGTPVVI 525

Query: 132 SLYGIHHDAEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRI 175
           SLYGIHHDAEYFPDPETYDPER SEE+RNYNPTAFMPFGEGPRI
Sbjct: 524 SLYGIHHDAEYFPDPETYDPERXSEENRNYNPTAFMPFGEGPRI 393

AI064680 N-TERM TO C-HELIX AL061315 AI404867 AI406053 AI1516839
MSALIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWA
KDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITCTDG
QLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQ
SVLNVLWCLIAGKR

AC009382 Drosophila melanogaster chromosome 3L/76B4 clone RPCI98-1B21, WORKING

Query: 1     MSALIFLCAILIGFVIYSLISSARRPKNFPPGPRF 35
             MSALIFLCAILIGFVIYSLISSARRPKNFPPG  F
Sbjct: 27001 MSALIFLCAILIGFVIYSLISSARRPKNFPPGEFF 26897

 Score = 37.9 bits (86), Expect = 0.029
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 2/25 (8%)
 Frame = +2

Query: 28    NFPP--GPRFVPWLGNTLQFRKEASAV 52
             NF P  GPRFVPWLGNTLQ R   S++
Sbjct: 26396 NFIPKTGPRFVPWLGNTLQVRLHKSSL 26476

AL078186
MLTSVFYVLFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKY
QCFDQAPGPHPWPIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHT
RCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNCKFIXXLRF

AC014810 in ordered pieces 27% to Cyp18 new family = AL065712

MLAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRP
WPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV
MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYM
KMSQIVARKWSTGIRELGNQLVP
GEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIFWEINQGHPLDFLPWL
YPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTD
ALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII
EEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVF
INNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKHF
LPFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTPREKIGPL*

AC008307 AC015141 AC007725 chromosome 3 clone BACR03D22 (D709) RPCI-98
324-511 45427-44854
45427 TAFSSQWALFALSKEPRLQQRLAKERATNDSRLMHGLIKESLRLY 45293
45292 PVAPFIGRYLPQDAQLGGHFIXXX 45230
45165 TMVLLSLNTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALK 44986
44985 QLHSLLGRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPR 44854

AC015396 Drosophila melanogaster, Cyp302a1 dib1 gene
1-183 32005-32502 184-493 32643-33702 36% to 12A3 mito? = AL099182 GSS
MLTKLLKISCTSRQCTF
AKPYQAIPGPRGPFGMGNLYNYLPGIGSYSWLRLHQAGQDKYEKYGAIVRETIVPGQDI 32181
VWLYDPKDIALLLNERDCPQRRSHLALAQYRKSRPDVYKTTGLLPTNGPEWWRIRAQ 32352
VQKELSAPKSVRNFVRQVDGVTKEFIRFLQESRNGGAIDMLPKLTRLNLE 32502
32643 VTCLLTFGARLQSFTA
QEQDPRSRSTRLMDAAETTNSCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVALELVE 32870
ENVRNGSVGSSLISAYVKNPELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIA 33032
RNPEVQQKLHEEARRVLPSAKDELSMDALRTDITYTRAVLKESLRLNPIAVGVGR 33197
GRGQDLNQDAIFSGYFVPKG
TTVVTQNMVACRLEQHFQDPLRFQPDRWLQHRSALNPYLVLPFGHG 33441
MRACIARRLAEQNMHI 33489
LLLRLLREYELIWSGSDDEMGVKTLLINKPDAPVLIDLRLRRE* 33705