Jan. 25, 2000 
N-terminal sequences of all 90 Drosophila melanogaster P450 proteins/genes.
90 N-terminal sequences from Drosphila melanogaster have been listed here.  This includes 
two different N-terminals for the 4d1 gene, that has alternative splicing.  Cyp6a15p has 
no N-terminal and is not included here.  There are three other pseudogenes Cyp307a2p, Cyp6t2p 
and Cyp9f3p.  All 86 other P450s are full length. 
Cyp12e1 AC018294 has an N-terminal in the genomic sequence, but it is not obvious.  I chose 
The first 38 amino acids based on a best guess for exon 1 with acceptable GT-AG boubdaries.   
An effort has been made to align the P(hyd)(hyd)GN motif at the right end.  This was not possible 
for all sequences, since this motif is not seen in every P450. 317a1 and 318a1 may not be 
aligned correctly.  See FASTA file for complete sequence info and accession numbers.  F after 
the number indicates full length sequence is known (or alternate splice). 

 1F 4c3         MAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNA-IEMNV
 2F 4aa1     MHLRLLSPPQLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNC-MLVTD
 3F 4g1                          MLTTLVGTLVAMALYEYWRR-NSREYRMVANIPSPPELPILGQA-HVAAG
 4F 4g15           MEVLKKDAALGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHL-FDVIG
 5F 4s3 AC015418                  MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGEL-IANVK
 6F 4p1 AI405947   MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNT-LDLYG
 7F 4p2 AI389883  MICLLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANC-FDLLG
 8F 4p3 AC008186   MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANS-FDLYG
 9F 4ac1 AC008325aMWIALLGIPILLAVLTLLLKHINKTYFILSLTKRVRTEDGSPLESKVAIMPGKTRFGNN-LDILN
10F 4ac3 AC017771 MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNN-LDLLN
11F 4ac2AC008324aMFLEVLFAAPLVIFIFRKLWAHLNRTYFILSLCKRIRTEDGSLLESKIYVAPSKTRFGNN-FDLVN
12F 4d1                              MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGNA-HIFLG
13F 4d1 alt splice             MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHG-HHFIG
14F 4d2                           MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNL-LMYRG
15F 4d14                        MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNA-PLLIN
16F 4d8                           MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGAM-QLMLR
17F 4d20 AI106625               MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCG-LQALH
18F 4d21 AC004717               MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNG-LQALT
19F 4e1                         MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNA-HQMGN
20F 4e2                         MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNA-HQMGK
21F 4e3                         MWLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNA-NRIGK
22F 4ae1 (old 4e4)             MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAA-WQMRS
23F 4ad1 AC005451             MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNL-FQFGL
24F 303a1 L49408 AC017306            MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSA-LQVSQ
25F 18a1   MLADSYLIKFVLRQLQVQEDGDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYL-LFMGS
26F 304a1 AC014292 AI257867        MITETLLTICAAVFLCLSYRYAVGRPSGFPPGPPKIPLFGSY-LFMLI
27F 305a1 AC009382 AI064680AC018013MSALIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNT-LQFRK
28F 306a1       MSADIVDIGHTGWMPSVQSLSILLVPGALVLVILYLCERQCNDLMGAPPPGPWGLPFLGYL-PFLDA
29F 307a1 AC014810 MLAALIYTILA(15aa)GVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRPWPIIGNL-HLLDR
30p 307a2p    MLTSVFYVLFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNI-NLLGR
31F 6a2                           MFVLIYLLIAISSLLAYLYHRNFNYWNRRGLPHDAPHPLYGNM-VGFRK
32F 6a9                        MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSL-TGVQT
33F 6a21 AL069964 on AC009844  MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSM-KGVRT
34F 6a8                        MALAYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNM-EELQK
35F 6a18 AC008285 AI403838     MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNM-EGYKK
36F 6a22 AC010578 80744 AA951440  MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNM-EGFRK
37F 6a19 AC010578 21500 AA696094  MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNT-GELWR
38F 6a20 AI063421 AC009844        MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNT-SELMK
39F 6a23 AC009844 44542-44721     MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNM-KDWPK
40F 6a17                           MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNI-KDWPN
41F 6a13                          MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNM-SGLGR
42F 6a14                          MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNM-XRSTT
43F 6a16 AC004721                 MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHF-FRLQS
44F 6u1 AC008288 AC017706      MDLMHRTLLTALGELSVVYALVKFSLGYWKRRGILHEKPKFLWGNI-KGVVS
45F 6d2                            MWTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVM-DTVMK
46F 6d4 AC008197 AI404831         MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGC-LDSVW
47F 6d5 AC007441 AI108995 AI402085 MIGIYLLIAAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGAL-ESVTK
48F 6t1       MIAVFSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFVGNV-WNLLR
49p 6t2p     MVIAFFIFLCAALAVGSVVLLP-------LIALLAVWLWQRRHFRIWRRLGVPYLPAAPVLGNV-LNVET
50F 6t3 AC007440                 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNL-GQLLF
51F 6g1                         MVLTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNT-KVVFK
52F 6g2 AC015208 19014-20624     MELVLLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNL-MGLLN
53F 6v1 AC015002               MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNL-SRVLR
54F 6w1 AC008257 AI403674          MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCT-REFLT
55F 9b1                         MSFVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNM-AASAL
56F 9b2                         MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNM-AAAAL
57F 9f2 AC007594 39127-39333     MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNM-AGMFL
58p 9f3p                         MLWEFLALFAIATALFYRWASANNDFFKDRGIAYEKPVLYLGNM-AGMFL
59F 9h1                        MDQSMIALALFIILLVLLYKWSVAKYDVFSERGVSHEKPWPLIGNI-PLKAM
60F 9c1                         MVFVELSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNI-PWSVL
61F 317a1                     MWIIFLIIGLLVLGLLVLLIIAARYQRDYWRYLDIPHERPKKLWPII-RQIMT
62F 28a5                         MVLITLTLVSLVVGLLYAVLVWNYDYWRKRGVPGPKPKLLCGNY-PNMFT
63F 28d1 AI403094 AC008324     MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSF-PSVFT
64F 28d2 AC008324              MCPVTTFLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSF-PSIFT
65F 28c1 AC014191                MFGSLLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSF-PNMIW
66F 308a1 AC015216a                 MLPLVLFILLAATLLFWKWQGNHWRRLGLEAPFGWPLVGNM-LDFAL
67F 309a1 AC003055 AC009909   MFTLVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSY-PGILI
68F 309a2 AC002444 AC009909   MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTY-PGLLT
69F 310a1 AC007137                  MWLLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGITWSFL-QKAYR
70F 311a1                           MALWPLLLITLTIWILVRKWTLLRLGSSLPGPWAFPLLGNA-QMVGK
71F 312a1 AC0015424 AC010003   MFWLGFGLLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGHL-HILAK
72F 313a1 AC007809 AC007928     MLTINLLLAVGALFWIYFLWSRRSKLYFLMLKIPGPIGLPILGSS-LENII
73F 313a2 AC017371              MIVIQLLIAASLILWIRFLWSRR-KLYMLMMQLPGRMGLPLLGNS-VRYLI
74F 313a3 AC017371 AL076582     MDTFQLLLAVGVCFWIYFLWSRR-RLYMMHFKIPGPMGLPILGIA-FEYLI
75F 313a4 AC007752              MLTWTLWCGLLFLLWIYFLWSRR-RFYLLTLKIPGPLGYPILGMA-HWLMR
76F 313a5 AC017371              MLTLQIFEAFAIILCVYFLWSRR-RFYIMMLKLPGPMGFPFIGLA-FEYIR
77F 313b1 AC007571              MLASIILSGWLLLAWLYFLWSRR-RYYKVAWQLRGPIGWPLIGMG-LQMMN
78F 318a1 AC014186       MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPLRCGALLAVLLAWQQRKCWRLIW
79F 301A1    MNNLSLKA(29aa)ESSTGVATCPHLADSEEASAPRIHSTSEWQNALPYNQIPGPKPIPILGNL-MPIIG
80F 49a1    MQRLRTGESSNPKKLNVSQQPVTSVATTRTTASSLPAETTSSPAAAVRPYSEVPGPYPLPLIGNS-WRFAP
81F 12a4       MLKVRSALSLIQSQKATLSLATQKRWQTNVATAEAREDSEWLQAKPFEQIPRLNMWALSMKMSMPGGK
82F 12a5       MLKGRIALNILQSQKPIVFSASQQRWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFAKSALPGGK
83F 12c1 AC012807    MLRLTVKHGLRANSQLAATRNPDASSYVQQLESEWEGAKPFTELPGPTRWQLFRGF-QKGGE
84F 12d1 AC008187   MNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSSITEEHKTYDEIPRPNKFKFMRAF-MPGGE
85F 12e1        MLSTQWNANKQISRQIYQLCRGLAQKVRKIYFKYIFILNLEEAKPYADIPGPSKLQLIRAF-LPGGK
86F 12b2     MWKYSNKI(36aa)KSRNLFTNNGYICSQTQLELADSRIDEKWQQARSFGEIPGPSLLRMLSFF-MPGGK
87F 302a1 AC015396             MLTKLLKISCTSRQCTFAKPYQAIPGPRGPFGMGNLYNYLPGIGSY-SWLRL
88F 314a1    MAVILLLALALVLG(16aa)PLLKNTLLEDFYHAELIQPEAPKRRRRGIWDIPGPKRIPFLGTK-WIFLL
89F 315a1 AC008307 MTEKRERPGPLRWL(19aa)RCDPPPLQRFPATELPPAVAAKYVPIPRVKGLPVVGTL-VDLIA
90F 316a1 AC017388 AC010113       MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAM-HKLLF