June 10, 1999

Outstanding P450s in Drosophila

The Cyp4d1 gene has been assembled from genomic sequences see Z98269, however the ESTs for 4d1 do not share the same first exon in 6/7 cases. Examining the region around the 4d1 gene has shown that there are two first exons A and B and followed by the rest of the gene. The conventional P450 sequence reported in genbank has B as the first exon, since it is closest to the rest of the gene. 6/7 ESTs have A as the first exon, skipping over the closer B exon. CYP4D1 HAS ALTERNATIVE SPLICING MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGN AHIFLGLTPAEACLKIGELAERHGDTFGLFLGPSYSVMLFNPRDVERVLG SSQLLTKSQEYSFLGRWLNEGLLVSNGRKWHRRRKIITPAFHFRILEPYV EIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICETA*MGVSINAQS NADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLHQ FTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP LSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVV GNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKL IPAGTNIGISPLYLGRREELFSEPNSFKPERFDVVTTAEKLNPYAYIPFS AGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTK EPLMFKVRERVY >CLOSEST FIRST 4D1 EXON B (NOT USED, SKIPPED IN 6/7 ESTS) AI062205 This is given in the Genbank annotation as part of the 4d1 protein sequence MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHH FIGKPPHEMVKKIFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGT LRFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAFHFKILDQFVE VFEKGSRDLLRNMEQDRLKHGESGFSLYDWINLCTMDTICETA* >MORE DISTANT FIRST CYP4D1 EXON A (THIS ONE IS USED) 6 ESTS MATCH THIS ONE AI257879 AI406141 AI295319 AI064088 AI387842 AI135092 MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGN AHIFLGLTPAEACLKIGELAERHGDTFGLFLGPSYSVMLFNPRDVERVLG SSQLLTKSQEYSFLGRWLNEGLLVSNGRKWHRRRKIITPAFHFRILEPYV EIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICETA* *********************** Cyp4g1 has 59 ESTs, more than any other P450 by a long distance. >Cyp4g1 AL009188 also U34328, AI134468 AI238257 AI107737 AI134464 AI516961 AI106721 AI402621 AI063157 AI389355 AI517399 AI108390 AI063322 AI109353 AI517684 AI107940 AI402779 AI402886 AI402810 AI238329 AI135715 AI133930 AI293299 AI108856 AI064278 AI292972 AI292892 AI135496 AI062067 AI064555 AI107765 AI109996 AI107207 AI135779 AI110101 AI387969 AI403655 AI404082 AI293025 AI107892 AI107173 AI292654 AI109079 AI063239 AI292944 AI293033 AI386573 AI514270 AI238755 AI109680 AI106986 AI135407 AI389454 AI113770 AI109410 AI108845 AI517484 AA694758 A1404254 AI063697 MAVEVVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSRE YRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLG NVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRH HRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAGKSFDVHDYMSQTT VDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYK FTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPA SKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEV NTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTF ADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVI VLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGR KYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFNVSLEKR QYATVA