Cytochrome P450s from duck-billed platypus

 

55 sequences were retrieved from Entrez protein by a search for

anatinus AND P450.  Two were false positives. Many are partials and incomplete sequences.  There is some error in assembly.

79 sequences were retrieved from the nucleotide section of Genbank by a search for anatinus AND P450.  These matched the 53 sequences found in Entrez protein.

 

Many of these genes need additional work.

 

D. Nelson Jan. 22, 2008

 

>CYP1A1 gi|149639131|ref|XP_001511800.1| PREDICTED: similar to cytochrome 1A1, partial [Ornithorhynchus anatinus]

71% to CYP1A1 XM_001511750

ETRGLLQASSPGLVSVTEILLASAIFFLAFWIIGSLSEKVPHGMKSPPGPWAWPLIGNILELRKDPHLAL

TRMSQVYGDVMQVQIGTTPVLVLSGLETLRQALVKQGEDFMGRPDLYTFQHIGDGESLSFSTDSGEVWVA

RRKLAQNALKTFSLASSPSSSCTYLEEHVSKEAVSLIGKFQELMKKRGSFDPYRYVMVSVANVICAMCFG

KRYDHNDQELLSVVSLSDKFGEFAASGNPADFIPILRYLPNHALRNFKDLNQKMVAFLQKMLMEHYRTYE

KNQVRDITDSLIEHCQDKKLDENANVQLSDKKIVNVVLDLFGAGFDTITTSLSWSLMYLVKYPEVQKKIQ

EELDMVIGRGRMPRLSDRSLLPYTEAFILESFRHSSFIPFTIPHSTTRATTLNGYYIPKGRCVFVNQWQI

NHDPELWEDPSAFRPERFLTQEGTKINKALSERVTMFGLGKRKCIGETIARWEVFLFLTILLQQIEFSVQ

SGGKLDMSRIYGLAMKHPRCEHFQVHPRF

 

>CYP1B1 gi|149408684|ref|XP_001510708.1| PREDICTED: similar to cytochrome P450 1B1 [Ornithorhynchus anatinus]

73% to CYP1B1 XM_001510658, NW_001594475 complement 1323261-1346148

EST EH001533, EH001420, EH000829

Cyan does not match

MAGQKRDRCSRPLAAGWFSDLLGHHSIARHDRPVHWNQSCGVKFSCAAYRSASECPFSGDEYIKHDEMKL

QFSDDRFAETTEDRRAHVMPVKLRQVYQRQTPTGQNKMFLLLKTSFTPVNQQQTYLLGHLVSREIKEKED

IAKGLKVWFLGFFFF

 

LIVFRFPKVQAEVQEELDRVVGRERLPCMADQPTLPYLMAFLYEAMRFSSFVPLT

IPHATTSDTSILGFHIPKDTVVLINQWSVNHDPVTWRNPEDFCPARFLDKNGFVDKDLASSVMIFSLGKR

RCIGEELSKLQLFLFTAILAHQCNFIADPDEIAKVKFSYGLTIKPKPFKINVTLRESMELLDKAVQRLQE

EEDSQ

 

>CYP1D1 gi|149633525|ref|XP_001506106.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]

70% to CYP1D1/CYP1A8P XM_001506056

MAKTKALLPTHFQRVKKGADPHANFFAEVEYSLYKGESLQFVVISPHLIYLGRNIARVGGNVSCRGYAPQ

NCAVHRLHSVVKNNYQLAKFSPALAVLHVTVVMDLMAEAGRTAVDLTGIRGQVSQPFGTFFPGLGRAEDL

VIQLFVQNPRGSFGGNEGRSLRGRRTEVARGRRKLQCPVISPCLLASYFEGQKPPSPPGPWALPVIGNLL

QLGEHPYLSFIEMRKKYGDVFLIKLGMVPVVVVNGMEPVKRVLFQDGENYAGRPNMHTFSFFANGKSLSF

STNYGDSWKHHKKMAINALKSFSKAEAKSSTCSCLLEEHVCGEVSELVKIFTELTATQGNFDPRGSLTCA

VANVVCALCFGKRYEHTDEKFLKVIKINDDLLKASSAVNPADFIPCFRYLPLRVVNAPREYYHMLNQFIM

QHVQEHYVTYDEGYLRDITDALISICYDKNSTGKTPILPDDTIISTVNDIFGAGFDTVSTCLNWSFLYLI

NYPEIQTKIQAEIDGNIGLKPPRFEDRKNLPYTEAFINEIFRHTTFLPFTIPHCTTADTILNGYFIPQKT

CVFVNIYQVNHDETLWEKPDLFRPERFLNENGELNKGLVEKVLIFGLGIRKCLGEDVARNEIFIFITNVL

QHLKLEKCSGAQLDLTPVYGLSMKPKPYHIKAEPRF

 

>CYP2A.a gi|149632665|ref|XP_001511572.1| PREDICTED: similar to LOC494798 protein [Ornithorhynchus anatinus] XM_001511522

46% to CYP2A6

MAVVKVLLHSLSASFLFYGVIVGLVVIYILTSSKRSRGKLPPGPPPLPIIGNLNLVDLNKLYQSLMELSE

NYGSMFTVHLGPRKVVVLAGYDAIKDALFNNSEAFGDRPEIPIFQKVTGGHGIGFSNGDTWKAMRRFALS

TLRDFGMGKKSIEAKIQEELNSLVKYFQSHQGKPFDTKIILNNAVSNIICSILFGDRFEYDDPEFLHLLQ

LLSDNTKLMGSSMVQLYNFYPFFGFLIGAHKTVVRNIQEITSFIQKLFKEHILNFSPNHLTGFVDAFLLK

QQQESKNPQTEFHNKNLLFSTLDLFAAGTETTSTTLRWGLLLMMKYPEIQRRVHEEIDKVIVLGQVPSVE

DRKKMPFTDAVIHEMQRFADIVPMGLSRSPTKDIHFRGFVIPKGTEVIPLLSSVFCDPSHWATPYQFNPS

HFLDAAGNFVRKDAFIPFGLGRRACAGEGLARMELFLLFTGLLQKFTFQAAPEVDKADLDLTASVGFTLT

PKPHLVCALPREEAKSQG

 

>CYP2A.a AAPN01409126.1

MAVVKVLLHSLSASFLFYGVIVGLVVIYILTSSKRSRGKLPPGPPPLPIIGNLNLVDLNKLYQSLME

27985 LSENYGSMFTVHLGPRKVVVLAGYDAIKDALFNNSEAFGDRPEIPIFQKVTGGH 27818

GIGFSNGDTWKAMRRFALSTLRDFGMGKKSIEAKIQEELNSLVKYFQSHQ

GKPFDTKIILNNAVSNIICSILFGDRFEYDDPEFLHLLQLLSDNTKLMGS

(gap)

QESKNPQTEFHNKNLLFSTLDLFAAGTETTSTTLRWGLLLMMKYPEIQSK

 

>CYP2A.b gi|149553936|ref|XP_001507121.1| PREDICTED: similar to cytochrome P450 CYP2A23, partial [Ornithorhynchus anatinus]

67% to CYP2A13 cattle XM_001507071, NW_001725301 <785-4347

MIIASVSLLTSLSVLNAWESTSNRVGRLIPXXXPLPFFGNYLHLDINQMSNSLIKVSRKYGPVFTVHLGP

RRVVVLCGYQAVKEALVDQGEEFSGRGEQATFNWLFQDFGVTFSQGERAKLLRRFSIMTLRDFGMGKRGI

EERIQEEARFLNESLRETKGSPIDPTFFLSRAVSNVISSIVFGDRFDYQDQQFLSLLQMINTSFQFSASS

AGQ

 

>CYP2A.d gi|149553938|ref|XP_001507160.1| PREDICTED: similar to cOR9K3 olfactory receptor family 9 subfamily K-like, partial [Ornithorhynchus anatinus]

71% to CYP2A6 XM_001507110 NW_001725301 6944 >11616

KVHEEIGRIIGRNRPPRLEDRAQMPYTEAVIHEIQRFSDIIPMSIAHCVMKDTKFRGYLIPKGTEVFPML

GSVLRDPQFFSAPKAFDPGHFLDAKGQFKKSDAFMAFSVGKRYCFGEKLARTELFLFLTTILQNFHFKPL

PRTADIDISPKIVGFATIPHNYDISFLPR

 

>CYP2A.c gi|149510764|ref|XP_001518574.1| PREDICTED: similar to cytochrome P450 CYP2A23, partial [Ornithorhynchus anatinus]

69% to CYP2A6 XM_001518524, NW_001684624 12334>14763

MLAAGLVTELLLACVSILVLLSIWQQWKDRSKMPPGPPPLPFIGNLLHLDPRQMSDSLI

KMSRKYGPVFT

MHLGPRPVVVLCGYQAVKEALVDQGEEFSGRGEQALFNWLFKDFGVIFSQGERAKQLRSFSITTLRDFSV

GKRGIEERIQEEAQFLI

ESLRDTKGAPIDPSFFLSRAVSNVISSIVFGDRFDYEDEQFLSLLQMISRGFQ

FIASPIGQLFDSYHCVMKYLPGPQHQAMKQLQGLEQFIAEKVRENQRTLDPNSPRNFIDSFLIKMQEDEE

NE

 

>CYP2A.e gi|149505993|ref|XP_001513381.1| PREDICTED: similar to cytochrome P450 2A13, partial [Ornithorhynchus anatinus]

74% to CYP2A6 XM_001513331, NW_001680185 <4268-11644

TALNLFFAGTETVSTTLRYGFLLLMKYPEVEAKVREEIERVIGHNRPPRFEDRAQMPYTEAVIHEIQRVS

DIIPMSLAHRVMKDTKFRGYLIPKGTEVFPLLSSVLRDPQFFPNPEAFDPGHFLDVNGQFKKSNAFMAFS

VGKRYCFGERLARTELFLFLTTILQNFRFKSPLRTEDIDISPKLVGFATIPRNYEISFLPR

 

>CYP2B gi|149515309|ref|XP_001520133.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]

66% to CYP2B6 XM_001520083

KVQEEIDQVIGQDRPPGLEDRTRMPYTDAVIHEIQRFSDLLPLGVPHIVTQDTHFRGYFLPKGTDVYPLL

SSVLHDPRHFKRPDSFDPGHFLDARGNFKKSEAFLPFST

 

>CYP2C.a gi|149570722|ref|XP_001505917.1| PREDICTED: similar to Cytochrome P450, family 2, subfamily c, polypeptide 70, partial [Ornithorhynchus anatinus]

42% to Cyp2c65 mouse XM_001505867, NW_001740623 7954 >11421

ERQQPESEFTLENLKMCVYDLFLAGTETVSITLRYALLTLLKYPKIDPQSHRESETTPRHLMIDHNKGGE

HRTELWDRALHSSPADRASVSFSALPAPTSCSCPPDTRAGPDQTPSLPPPNSTPALFQGTTVYPVLGSVL

NDPQQFPEPERFAPEHFLDAKGAFKKSGAFMVFSAGKRNCVGEGIARMELFLFLTTLLQNLRLSPPPGVR

AVDVQPGISGVANLPPPFQICVTPH

 

>CYP2C.b gi|149505995|ref|XP_001513402.1| PREDICTED: similar to transmembrane protein 132B, partial [Ornithorhynchus anatinus]

Cyan does not match XM_001513352, NW_001680185 11679 >19947

MGREEVGFPDATTAFGSEPRVSGWTVGRGLRRDPGTSSGHSAGRGEGGPVKTEKGRRGWGGYTGHGPERR

PAWGAPFSGPLEVSGFGRATEPGPYRPESCSSSPSGTDSFTPIPRDGRMARMTLQ

 

52% to CYP2C19

TPVPLEGSRRLLDGR

VPCRQLRARYGPVFSVHFGEERAVMVLGYEEVREVLLERGDEFLDRGSFPSADRTNRGLGVIMSNGKRWR

DLRRFSLSALRDLGMGKRSLEERVQDEAQCLLEEFRKTQ

 

>CYP2D gi|149416604|ref|XP_001516872.1| PREDICTED: similar to cytochrome P450, family 2, subfamily D, polypeptide 6 [Ornithorhynchus anatinus]

XM_001516822, NW_001597728 208653-217626

MAGQGEHREEEEGLGGPVHGPGAPAAPRPAPFLR

 

69% to 2D8P2

QLREKFGDVFSLQFSWTNVVVLNGLAAVKEALVQRSEETAGRPPLVTYDHLGFGPNSEG

 

RSPRGRRAVVPERARGSSARQGGAAAFI

 

68% to 2D6

LNAVPWLVTIPGLPQRIFR

AQKAFITLLDTFIEEHKKTRDPALPRDLTDAYLEQVDQAKDDPGSSFNDRNIRIVVTDLFTAGTETTSTT

LKWALLFMLLHPDVQSRVQVEIDQVIGRDRRPTMADQAKMPFTNAVIHECQRLGDIIPIGLPHLTLRDTQ

VQGFFIPEGTYLILNLSSVLKDDTVWEKPHQFYPEHFLDRDGRFVKPEAFLPFSAGRRVCLGEPLARXEL

FLFFTCAPAALHLG

 

>CYP2E1.a gi|149570232|ref|XP_001517616.1| PREDICTED: similar to cytochrome P450, partial [Ornithorhynchus anatinus]

64% to CYP2E1 XM_001517566, NW_001740221 <3802..3961,6655..>6804

LAKEYGPVFTLYLGSKRAVVLHGYEVVKEVLLDHKEEFVGRADVPGFEVHKNLGIIFNNGNLWKQTRRFS

LTTLRDWGMGKKGNEERIQEEAQRLVKELRNTN

 

>CYP2E1.b gi|149435890|ref|XP_001520913.1| PREDICTED: similar to Cytochrome P450 2E1 (CYPIIE1) (P450-J), partial [Ornithorhynchus anatinus]

63% to CYP2E1 XM_001520863, NW_001615134 <9770>22579

YRKALVGQESSVSGHWRPILVFFLSGSGIPSQIQISCHRAERNGGYTASQIDFRILYNYLLFHVSINALP

LDPTSILSSAPCNVISRILFQKHFDYKDKEFLRLMQIIREIFYLLSSPWIQIFQAFPSFLRYVPGTHHKL

INNIAKMKKFVSEQVKEHQESLDPNHPRDFTDCLLIEAEKQKQDPQLGFSMENTTITVADLLFAGTETTS

TTLRYGLLILLKYPEVE

 

>CYP2G.a gi|149524993|ref|XP_001516537.1| PREDICTED: similar to Cytochrome P450 2B11 (CYPIIB11) (P450 PBD-2), partial [Ornithorhynchus anatinus]

56% to 2G2P XM_001516487, NW_001698049 3260>10856

MAWAVSPPWLPSSAGPFLLILVLFLLLLLLLFRRGHPPARLPPGPRALPILGCLPQMWGVPLLDFLLKVN

GISFSQGERWRTLRRFSVATLRDLGMGRRGIEERVQEEVRCLLEEFRKTRGHPFDPTFPLRRSISNVICS

VVFGRRFDYADPEFGTLLRLLNDNLRRVDSVSVRLYSLFPGLLRHLPGPHNLLFEVFEEQKRFVARIVKE

HEASLDPAEPRDFMDAFLIRMQQDRKNPLSEFHLENLLVTALDLFFAGTETTSTTLKYGLLLLLKHPQIT

ERVQEEVDSVIGQNRRPALEDRARMPYTDAVIHEIQRFIDIMPLGVPHAVTRDTCFQGYTIPKGTMVFPL

LHSVLHDPDHFPDPAVFEPKRFLTEDGRFQRNAAFLPFSAGEHGVGAGAGGGVVHR

 

>CYP2G.b gi|149613548|ref|XP_001521133.1| PREDICTED: similar to MGC82323 protein, partial [Ornithorhynchus anatinus]

69% to 2G2P XM_001521083

LYDMYSSIMRYLPGPHNQIYNLIEELKNFVAEQVRGNRESLDSSNPRDFIDCFLIKMEQ

 

SVWHLIAVLRYPSPS

 

69% to 2G2P

AKVHEEIDRVIGRERIPGIEDRMGMPYTDAVIHEIQRVTDIVPMGVPRAVTRDTHFRGYILPK

 

>CYP2R1 gi|149621252|ref|XP_001518489.1| PREDICTED: similar to cytochrome P450, family 2, subfamily R, polypeptide 1 [Ornithorhynchus anatinus]

74% to CYP2R1 XM_001518439.1

NW_001784500 10815-23103

MPLLLLWYLQIVIITILVLLSAYYVPAGLSRLKWEEYGPVFTFLGSANSVLLLRLLNSRYGLGWTEHRRL

AVNSFRSFGWGQKSFQTKMATEVKYFLSAVATYKGTPFDPKQLVTGAVSNVSNVILFGGRFSYEDAGFRR

MMEMFSENVELAASPTAFLYNAFPAMGLLPFGKHRRLFENAARVYDFLSGIIERVSGNRWPRSPKHFIDA

YLDEMDREGKDPDSTLSRENLIFALGELIIAGTETTTNVLRWAVLLMALYPNIQGQVQKEIDQRVGPDRA

PTLEDKPQMPYTEAVLHEVLRFCNIVPLGIFHATSKDTVIRGYSIPQGTMVITNLYSVHFDEKYWRNPEV

FYPERFLDSRGQFVKNEALIPFSLGKRHCLGEQLARMEMFLFFTGLLQQFHLRFPNEPVSPLKPKLGMTL

QPRPYLICAEKR

 

>CYP2U1 gi|149614989|ref|XP_001517862.1| PREDICTED: similar to cytochrome P450 [Ornithorhynchus anatinus]

79% to CYP2U1, N-term does not match XM_001517812.1

NW_001778999 3518-18727

 

GIVFAPYGPVWKQQRKFSHSTLRHFGLGKLSLEPKIIEEFRNV

KEEMQKHGAAPFDPLPVIGNAVSNVICSLCFGRRFDYTNGEFKKMLSLMSRGLEISTSNPILLINVCPWL

YYLPFGPFKELRQIERDITAFLKRLIREHRESLDRTAPRDFIDMYLLHMEEEQKRDGDSSFNEDYLFYIV

GDLFIAGTDTTTNTVLWCLLYMSLNPDVQ (1)

EKVHQEIDRVIGRDRAPSLTDKVHMPYTEATIMEVQRMTVVVPFSIPRMTTEET (1)

VLLGYTIPKGTVILPNLWSVHRDPAIWEEPDNFLPERFLDEQGQLVKKETFIPFGL (1)

GKRVCMGEQLAKMELFLMFTCLMQSFTFAWPEGSGKPFLYGRFGLTLAPHPFNLIISKR*

 

>CYP2W1 gi|149632667|ref|XP_001511639.1| PREDICTED: similar to cytochrome P450, family 2, subfamily W, polypeptide 1 [Ornithorhynchus anatinus]

58% to CYP2W1 XM_001511589.1, NW_001794053 202015-222490

MRNSYRTISSLLLPVLPLLVLLCVCRLSVVWWKEPGCIQCPCSVLALTNISSIQPLIHPHTTFETLNPFA

PGCILQTAYSTFSEVSKEGGVLLAFSKNKYKPCSQGQLERQPLWLLGSHLSVQNMNLFIRLLSDPVVVFL

LGVLAFWVLRHFSTQSGRSIFKLPPGPQPLPLIGNLHLLDWRRQDKSLMKISEKYGPVFTVQFGLKKMVV

LTGYEAVKEALVNFADEFADRPPIPIFYQIQHGHGIFFSSGELWKTTRKFTISSMHKLGMGKHSMEEKII

EEFHCLVELLESFKGEPFRLKLFNKAPTNVTFTLLFGERFDYQDPTFVTLLRLIDEIMVLLGSPILQLFN

FYPFLGFLLKSPKMILVKIEEVRVILRHYMKMSRQQTDRGNVQSYIDALIQKQEAMNKETLFHDANIVAS

VLDLVMAGTETTSTTLQWAILLMMKYPKIQAKVQEEIGQVLSSGRLPRYEDHKDLPFTNAVIHEIQRFVT

LLPHVPHCLSVDIHFRDFFLPKGTPVIPLLTSVLLDKSQWETPNVFNPNHFLDAEGNFVKKEAFLPFSTG

RRVCVGESLAKMELFLFFTSLLQRFTFQPPPGTRHSDLDITPEATFTMRPQPQLAHAVPRA

 

>CYP3A.a gi|149409184|ref|XP_001512936.1| PREDICTED: similar to post-synaptic density protein 95 [Ornithorhynchus anatinus]

55% to CYP3A5 XM_001512886 NW_001594494.d 3666753-3681977

MSSILNFSIETWILLGTFLALMILYGIWPFRVFTKSGIPGPRPVPFFGNILEYSQGIIEFDKKCFQKYGK

IWRLFEGRQAMVAVLDLEIIKTVLVKEVFSSFTNRRRIGIEGIMEESIIGAEDEQWKELRILISPTFSSG

KLKEMLRIMIHYGEILVKTIWKKAEKNQNVIVKDYYGAYSLDVITSTSFGVDVNSLNKMNDTYFKEVKKL

SSVDFFSPLLALTSIFPFITPLLNLLDISLFPSDSVEYIKRFVHKIRESRHQDNQQHRADLLKLLLDSQN

PKEGLKGKKGLSDTGILAQAVAFVFAGYETTSSALSFISYNLATHPDVQQKLQEEIDKVLPNKSPLTYDA

IVQMEYLDMVINETLRLYPIGPRLERMCKKTLEINGLTIHKGTCVVIPIAVLQHDPNYWTEPDEFRPERF

SKEMREKRDPYTFIPFGVGPRNCIGMRFALLNMKVAIIGLLQNFSLRTCQETQIPLELNSMGFLTPKKPI

VLQFIPRADTKSQD

 

>CYP3A.b gi|149409182|ref|XP_001512909.1| PREDICTED: similar to apoptosis inhibitor survivin [Ornithorhynchus anatinus]

57% to CYP3A4 XM_001512859 NW_001594494.c 3638802-3657824

MSSIFSFSIETWILLGTFLTLMILYGIWPYGVFTKRNIPGPWPVPFLGNIQEYSQGLMVFDKKCSEKYGK

IWGLYEGRQAIIAVLDLDIIKKVLVKEVFSSFTNRRNTGIEGILELAVSSAEDEHWKELRTLMSRTFTSG

KLKEMLPIMTHYGEVLVRNIWRKAEKNENVTVKDYFGAYSLDVITSTSFGVDVDSLNKMNDTFVKEIKKI

SSIDFFSPLFALISTFPFMIPLLKLLNINLFPNDSVEYFKRFLHKVKERRHQDNQQHRVDFLQLMLDSQN

PKEGSKGKGGLSDAELLAQAFAFIFAGYETSSNTLSFISYNLATHPDVQEKLQAEIDTVLPNKSPLTYDA

LVRMEYLDMVINESLRLYPISSRLERMCKKTTEINGLTIPKGTCVVIPLFILQKDPNYWLEPDEFHPERF

SKEMRDKRDPYTFMPFGAGPRNCIGMRFALLSIKVAMIGLLKNFSLRTCQETQIPPEINSFGLLTAKKPI

VLRYIPRADTKIKD

 

>CYP3A.c gi|149613390|ref|XP_001520705.1| PREDICTED: similar to cytochrome P450 3A80, partial [Ornithorhynchus anatinus]

56% to CYP3A4 XM_001520655, NW_001777588 3140 >20312

NLRLNGGLDSSLTIAEYHTWKRIRTIVSPAFTSGKLKEMFPIIKHYGKILVQNIDKKVKKNEPVNMKEIF

GSYSLDVVTSTSFGVDIDSMNNPNDPFVKQINKLLSFTFLSPLILLTVVCPFLVPVFEKMNLSLFPREFL

EFFVGVTRNFKEKRQKGVHTGRVDFLQLMVDSQSSDSNSEPSEKNHSYKEMTDTEISTQAIIFIFAGFET

TSSTLNFVSYNLATHPEVQKKLQEEIDSILPNKASPTYESISQMDYLDMVVQETLRLFPPGGRIERVCKE

TIQIKGLTIPKGTVVIIPAFVLHRDPEHWPEPEKFLPERFSKEEKASHNPYVFLPFGAGPRNCIGMRFAL

LNMKAALIHLLQNFSVEPCKETPMPLELDSTGFMKPKKPIILKLVPRSGVDSED

 

>CYP3A.d gi|149409180|ref|XP_001512885.1| PREDICTED: similar to Cytochrome P450, partial [Ornithorhynchus anatinus] XM_001512835 NW_001594494.b <3597721-3635650

 

55% to CYP3A4

SMILFILMILTYGIWPYGVFTKLRIPGPRPIPFLGNILDYSQGMDEFDKKCFQKYGKIWGLYEGRKAKIA

VLDLDIIKSVLVKEVFTNFTNRQMAGIEGIMSESIFSAKDERWKELRTLVSPTFTSGKLKEMVPMMIQYG

EVLVKNLQNKVEKNQNVTIKDYFGAYNLDVITSTSFGVDIDNLNKMNNTFVKEIKKLTSINFFSPLFALI

SVLPFMIPLLKLLNINTFPNDSVEYFKRFMDKIKERTQQGNPQQRMNFLQLMLDTQNPKEGLKNKGGIIS

QKGLSDAEILAQAFSFIFAGYETSSTTLSFISYNLATHLDVQKKLQEEIDEVLPNKAPLTYDALVQMEYL

DMIINETLRLYTVGSRLERICKKTMKINGLTIPKGMTVVIPVSCLHSDPNYWVNPDEFHPERFSKEMRDK

RDPYTFMPFGAGPRNCIGMRFALLNIKVAIIGLLQNFSLRTCQETQIPLEVNSFGLLTTKKPIVLR

 

FIPRAEIKRFLRFKSHHPRPNLDQCRIPKP

 

46% to CYP3A5 aa 255-301

SYFGVYSLDVITSTSLGMDVDWNKMNDTFVKEIKKISSVNLFSPLF

 

AWKMILWNTLKDLCLKYRRHRDDQQVRTLLKDENHTQPGEKRPRLSKALPTPHLLSIVQREGGEPDTL

IPSFLHQCAEDLGLHEERMANPPLCTLGPRPPPKKDSDSLRRYRVNSQPSTTKNLVTLDHTLRPDPLMTC

 

>CYP3A.e gi|149409178|ref|XP_001512860.1| PREDICTED: similar to Cytochrome P450 [Ornithorhynchus anatinus]

53% to CYP3A4, C-term is wrong XM_001512810, NW_001594494.a 3561573-3585321

MRGERAYRPHGTGTSIELASTTFRDVFVIIIIIYGIWPFGVFTKLGIPGPRPIPFFGNILEYAQGTMHFD

KKCFQKYGKIWGFYEGWKAKIAVLDLDIIKRVLVKEVFTNFTNRQNSGIEGILKHSVFAAKDKHWKKLRT

LISSTFTSGKLKEMVPTIIHYGEILVKNIWYKAEKNQNVTVKDYFGAYSLDVITSTSFGVDVDSLNKMND

RFVKEIRKLSSVDFFPPIFVLISVLPFITPLLKLLNINIFPNDSVEYFKRFMDNIKGTHHQGNQQQQVNF

LQMMLDTQNPKEGSKAKGGVSFGKVMLSDAEILTQAFAFIFAGYESSSSVLSFIAYNLAIHPDVQQKLQE

EIDTVLPNKLPLTYEALVQMEYLDMVINETLRLYSVGPRLQRVSKKTTVINGLTIPKGMTVMIPLTCLHR

EPKYWLEPDEFHPE

 

SDHFNAWHIIPLELTARGFLIPQKPIVLQFIPRAEIKKG

 

>CYP3A.f gi|149570683|ref|XP_001520305.1| PREDICTED: similar to cytochrome P450 3A80, partial [Ornithorhynchus anatinus]

61% to CYP3A4 XM_001520255, NW_001740596 complement 2969>5783

ASPTYESIFQMDYLDMVVLETLRLFPPGGRIQRVCKETTQIKGLTIPKGTVVIIPTFVLHRDSEHWPEPE

KFLPESRFSKEEKASHNPYVFLPFGAGPRNCIGMRFALLNMKAALIHLLQNFSVEPCKETPIPLELDSTG

FMKPKKPIILKLVPRSGVDSED

 

>CYP3A.g gi|149623166|ref|XP_001517912.1| PREDICTED: similar to MGC108372 protein, partial [Ornithorhynchus anatinus]

62% to CYP3A4 C-term XM_001517862

ASPTYECISQMDYLDMVVQETLRLFPPGGRIERVCKETIQIKGLTIPKGTAVIIPAFVLHRDPEHWPEPE

KFLPESRFSKEEKASHNPYVFLPFGAGPRNCIGMRFALLNMKAALIHLLQNFSVEPCKETPIPLELDSTG

FMKPKKPIILKLVPRSGMDSED

 

>CYP3A.h gi|149556782|ref|XP_001519166.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]

53% to CYP3A5 XM_001519116

MSVNSAVSSQALNVLHMFPIIKHYGKLLVQNIDKKVKKNEPVNMKRIFGSYSLDVVTSTSFGVDIDSMNN

PNDPFVKQITKLLSFTFLSPLFLLTVVFPFLMPVFKKMNLSLFPRDTVEFFVGVTRNFKEKRQKGVHTGR

VDFLQLMVDSQSSDSNPEPSEKNHSYKEMTDTEISTQAIIFMFAGFETTSSTLNFVSYNLATHPEVQKKL

QEEIDSILPNK

 

>CYP3A.i gi|149409186|ref|XP_001512956.1| PREDICTED: similar to acyl-Coenzyme A dehydrogenase, very long chain [Ornithorhynchus anatinus]

55% to CYP3A4 XM_001512906 NW_001594494.e 3721961-3746811

MGRKRGQRAQRAPIFDGRQPILAILDPDIIKTVLVKEFHDSFPNRRNFGLNGGLDSSLTIAEYHTWKRIR

TIVSPTFTSGKLKEMFPIIKHYGKILVQNIDKKVKKNEPVNMKEIFGSYSLDVVTSTSFGVDIDSMNNPN

DPFVKQINKLLSFTFLSPLLLLTVVFPFLVPVFEKMNLSLFPREFLEFFVGVTRNFKEKRQKGVHTGRVD

FLQLMVDSQSSDSNPEPSEKDHSYKEMTDMEISTQAIIFIFAGFETTSSTLNFVSYNLATHPEVQKKLQE

EIDSILPNK

 

Cyan does not match

GSGFWMGRLGYSERQERSPSGNRSGELTADPAGAAKSQVREGGDEGGRAAGEEEETENRVK

PKVRSEGV

 

>CYP4A gi|149577062|ref|XP_001520882.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]

58% to CYP4A11 XM_001520832

MVSRMDGEMDKGPSAWPALLFLALALALIKGTQLFLRRQKLLKTTAQFPGPPPHWLFGHLFQVKGLSQSN

SWIKYCPFGTPLWIGSFAVIFNIYHPDYLKVLLKRGDPKNKAAYRFAVPWIGHGLLILNGEKWFQHRKML

TPGFHYSILRPYVKIMADSTNVMLDKWEKLTAQGETLELFQHVSLMTLDTLMKCSFSNNSSGQKDSDSKA

YIQAVNNLTSMISQRIFKFYQHNNFIYWLSPLGRCFRQACKTAHQHSEQVIAERKKTLQNVFELETIQAK

RHLDFLDILLCAKTKEGKGLSDEELRAEVDTFMFEGHDTTASAISWILYALALYPEHQQRCREEAQEILG

ERDTVQWEDLAQLTFTTMFIKESLRLYPPVPAISRELSSPITFFDGRSLPKGSFIRIHIYSLHRNPLVWK

DPEVFDPQRFTPENISQRHPYAFLPFSAGPRNCIGQQFAMNEIKVSVVQTLLRFQLEPDHSRPPEPISQL

ILKSKTGIHLHLRKLP

 

>CYP4B1 gi|149609226|ref|XP_001519517.1| PREDICTED: similar to Cytochrome P450 4B1 (CYPIVB1) (P450-isozyme 5) [Ornithorhynchus anatinus]

72% to CYP4B1 XM_001519467, NW_001773910 2638-14949

MALWKVVDLPGLSMNLSGLFPWLAGLFLTLLLLKLSKLCVRRKLFVQAFGSFPGPPAHWLFGHALEIQRG

GLDKVMVWAQDYPHAFPLWLGKFIGYLNIHEPDYAKAVFSRGDPKAPDVYDFFLQWIGKGLLVLEGSKWF

QHRKLLTPGFHYDILKPYIRVFVDSSKVMLDKWEKKITAGSSLEIVHDVGLMALDSLMKCTFGKGNSSQL

ESENAYYLAVHDLTFLMQERIDRFQYHNDFIYWLTPHGRRFLRACKATHDHTDQVIRERKEALQNERELA

VLQKKRHLDFLDILLCAKDESGEGLSDADLRAEVDTFMFEGHDTTTSGISWFLYCLALHPEHQRRCREEV

QEILGNRDAFQWEDLGKMTYLTQCIKESFRLYPPVPQVYRQLNKPVQFVDGRSLPEGALVSLHIYALHRN

PKVWSDPEVFDPLRFSPENSVGRHPYAFLPFSAGPRNCIGQQFAMSEMKVVSAQCLLRFEFLPDPSRPPE

PIPQLVLKSKTGIHLRLRKLQ

 

>CYP4F.a gi|149638109|ref|XP_001506150.1| PREDICTED: similar to Cytochrome P450, family 2, subfamily E, polypeptide 2 homolog [Ornithorhynchus anatinus]

77% to 4F22, cyan region does not match XM_001506100.1,

NW_001794381 complement 86994-118737

MLPITDQVLKLLNLEKTSFRTYTISALLLSLLVVFFRLLLHLFQVCRQFYVTCQRLRCFPQPPRRNWLLG

HLGMEKEVLMICRGRVSSELLFRLLVHGQQGHPEVLRTVLSSSSAVAPKDELFYGFLRPWLGDGLLLSRG

DKWGRHRRMLTPAFHFDILKPYMKIFNQCTDIMHAKWRRLSAGAVVSLDMFEHVSLMTLDSLQKCVFSYN

SDCQEKMSDYISAIIELSALVVKRQYRLHHHLDFIYYRTADGRRFQQACDIVHHFTTEVIQGRRHALNQQ

GAEAWLKSKQGKTLDFIDVLLLAKDEEGKYLSDEDIRAEADTFMFEGHDTTSSGLSWILFNLARYPEYQE

KCREEIQEIMKGREMDEIEWEDLTQMPFITMCIKESLRLYPPVTLISRRCTEDIKLPDGRVIPKETICLV

SIYGTHHNPTVWPEPKVFNPYRFDPENPQQRSPLAYVPFSAGPRNCIGQSFAMSEMKVVVALTLLRFKLV

VDRTKKVRRKPELILRTENGIWLNVEPLPARQ

 

>CYP4F.b gi|149575306|ref|XP_001518614.1| PREDICTED: similar to cytochrome P-450LTBV, partial [Ornithorhynchus anatinus]

69% to CYP4F3 aa 217-439 XM_001518564

RPSDYIAAILELSTLVVKRHQKLHLHMDFLYNLTAEGRRFRQACRLVHDFTDDVIQKRRRTLAHQDPESW

LQAKKGKTVDFIDVLLLAKVNEGPDNAGEDFPSFRSSYYFEGHDTTASGLSWVLYNLAQHQEYQEKCRAE

IRELVKGRETEEIEWEDLSQMPFLTMCIKESLRLHPPVTVISRCCTEDITLLDGRVIPKGNTCMISIFGT

HHNPAVWPDPEV

 

>CYP4V gi|149537528|ref|XP_001519540.1| PREDICTED: similar to cytochrome P450, family 4, subfamily V, polypeptide 2, partial [Ornithorhynchus anatinus]

67% to CYP4V2 XM_001519490, NW_001709800 <2189>13167

EST EH000864

DAIPLCPLPASAPSGSRPPRLDPARLSGEGSERGQRDPAALWTARSPDRPPRVPMVPGHGSRPEEVAGGV

AGGREGEREDSSSPGEWAFTGCLRHLRGELPGDGKGEIPAKGRLTYGTFSSVDLFQQVIQYTEEFRHMPL

WKLWIGPVPMVILYHAESVEVILSSSKQISKSYVYRFLEPWLGLGLLTSTGGKWRSRRKMLTPTFHFSIL

EEFVGVMNEHAQTLVEKFEKHVDRDAFDCFMDITLCALDIICETAMGRNIQVQTNGDSEYVRTIYRMSDL

IQRRILMPWLWLDPCYLLFQEGREHRQKLRVLHEFTDRVIAERSKELEWSRQMALKGPGSSCARRRAFLD

LLLETADDARNGLSLRDVREEVDTFMFEGHDTTAAAMSFVLYLLGSCPDAQRKVNDELDRVF

 

>CYP5A1 gi|149560697|ref|XP_001517603.1| PREDICTED: similar to Thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A) [Ornithorhynchus anatinus]

60% to CYP5A1 XM_001517553, NW_001731785 20014-50779

MALPGLLCGNLDWTAVTLGSLLLLLFVLLKWYSTSAFSQLEKLGIRHPPPTPFIGNLTLFCQGYWESHRE

LIETYGPLCGYYLGRQMYIVVSEPEMIEKILVKDFGNFTNRMVSGLIPKPLSDSVVFLHGKRWSEVRWAL

TPAFGPEKLNQMLPLIDRACDTLLTNLRVRAESGAALDIHRSFGCLTLDIVASLAFGLQVDSQRDPGDPF

VQHCRRFFEQSVPRPVLFLLHAFPFLAPLARALPSKSRDELSDFFRRAVQDVMARRSRQPAGERRRDFLQ

EMLDAHGRIGLPGPEQPDAAGPGAAPGRAPEPLTEDELVGQALVFLIAGYATAANALSFATYLLATHPEV

QGKLLREVDEFGESHPPTFSSLQEGLPYLDMVIAETLRMYPPAFRFTRVAAQDCEVMGQRIPAGAVVETA

VGHLHHDPAYWPEPEKFLPERFDPETGQRPPPCAYLPFGAGPRACLGTQLGLLQIKLALLRTLRAFRVAR

CPGTQVPLRLTSQATLGPRDGVVVQLLPRQGPPPAPGPRQPS

 

>CYP7A1 gi|149411112|ref|XP_001514400.1| PREDICTED: similar to cholesterol 7-alpha hydroxylase [Ornithorhynchus anatinus]

74% to CYP7A1 XM_001514350

MMTMSLIWGVLVAVCCCLWLITGIRRRHPGEPPLDNGPLPYLGCALQFGANPLKFLRAKQKKVGNIFTCK

IVGKYVHFLTNPFSFHTVMRHGKHFDWKKFHFTTAAKVFGHRSIDPNDGNTTENMHQTFIKTLQGDALHS

LTENMMENLQHVLKPSVPPQENPAPWVTDGLYSFCYRVMFEAGYLTLFGKELNSNKDLQKQKAQRAIYLE

NFKEFDKIFPALVAGLPIHVFKSAYNAREKLAEALLHKNLQKRDKISELVTLRMFLNDTQSTFDDMEKAK

THLAVLWAAQANTIPATFWSLFQTIRSPEALKAAVEEVHNVLKNAGQKVSFDGKPIVLTQAQLNDMPVLD

SIIKESIRLSSASMNVRAAKEDFILHLEDGSYSIRKDDVIALYPPLVHLDPEIYPDPLTFKYNRYLDENG

KTKTNFYCNGLKLKYYYLPFGSGLTKCPGRIFAIYEIKEFLILMLSYFELELVDRQPRCPPLDQSRAGLG

ILPPTNDIDFRYRLKCL

 

>CYP7B1 gi|149411182|ref|XP_001512397.1| PREDICTED: similar to oxysterol 7alpha-hydroxylase [Ornithorhynchus anatinus]

52% to CYP7B1 XM_001512347

MMSESRSHPNVNTSLFVKNCKSVQREQVFQFKFWRPKEPPLVPSWIPFLGRALQFKNDPYHFLKAQQKIH

GDVFTVLFVGKYITFILDPFQFPTITRTSKHFDFKGFANHLGQKIFNYQSLYTIPNLSKDIHESFRYLQG

KPLDKLVSQVMHSLQCIFKEKFSRMADWETEQMYTFCHAVIFEATFTTFYGKYPTADGHKVINEIRETFA

KFDANFPKLAANIPIELLGSTKKNREFLIRQFTPELMVKRQPLAEIIQFRREFLEKYKLLQDYSKAAHHF

GFLWASVGNTIPASFWALYYLLRHPEALAVVRDEIDHLLQSTGQANRPGSFIYLTREQLDNLVYLDSLIL

ESFRLNSASTNFRIIQEDFTLQLEDGRDFNLRKGDWLALFPQTMHRDPEIFEDPEVFKFDRFVENGKKKT

TFFKRGRKLKYFLMPFGSGVSMCPGRFFAVSEIKQFLILLLVHLEAEIIEEKNLVSNNERLGFGILYPNS

DISFRYRWKASLASPRSHSRAPGLYGIFKATLGYVEGFYLWKLPRPTRSFTSAVGRPREPLPPMPLLEVP

GTTLPVAGGSG

 

>CYP8A1 gi|149639813|ref|XP_001507523.1| PREDICTED: similar to prostacyclin synthase, partial [Ornithorhynchus anatinus]

65% to CYP8A1, XM_001507473

LLLRSSHPGEPPLDRGLIPWLGHALEFGKDTAHFLSRMKQKHGDIFTVLAAGRFVTVLLDPHSYDSVVWE

SSSKLDFHKYAVFLMERIFDVRLPHYDPREEKAKLKPTLLNQNLQTLTKATLLNLRTLLLPELGEGAQVW

RETGLLQFSYSTLFRAGYLTLFGNEGARYDDPAGQTQDRAHSAEVYQHFRQLDHLLMKLARSSLSSGEKE

EVAGIKVRLWRLLSTQRLRGKANKSCWVESYREHLEALRVGEEMQARAMLLQLWATQGNAGPAAFWLLLF

LLKNPKALAAVQGELERVFGQTGQPLTPKESVTQETLDNTPIFDSVLSESLRLTAAPFITREVLDDLDLP

LADGRKYRLRKGDRLLLFPFLSPQMDPEIYERPEEFKFDRFLNPDGTEKRDFYKGGKRLRNYNMPWGAGN

NVCLGKSHAINSIKQFVFFLLNNFNLELKNPEEPIPKFDKSRYGFGLLQPERDVTVRYRAKSSPER

 

>CYP8B1 gi|149538935|ref|XP_001512917.1| PREDICTED: similar to seven transmembrane helix receptor, partial [Ornithorhynchus anatinus]

48% to CYP8B1 aa 104-363 XM_001512867

RELVFHVFGYRGPSEDHSIILNASVKHLMGQGLEHMTQVMMENLAKVLPRRDGPGAAGWRHDELFHFSYS

LVFRAGYLSLFGYEEETGVGPQLDSTFYKFRKYDSFFPRLAYSVLTPWEKAQVEQLKHHFWDLLEYQKME

KWANKSHWLGDQQRRLTELGTPGSMLGRFNFMLLWASQGNTGPASFWALFYLLKHPEALRAVRAEVDGVL

REAGWQGGGSLFQVTHSMLQRTPVLDSVLEETLRLTAGPILIRSVLQDM

 

>CYP11B2 gi|149636551|ref|XP_001512763.1| PREDICTED: similar to cytochrome P-450 (11beta, aldo) [Ornithorhynchus anatinus]

50% to CYP11B2, 49% to CYP11B1 XM_001512713

MLEGLRRSARGGAGWAPALLRGLTTQVLQEGAVREVAGAPQVGALPFDAIPQSPGNSWIKVLKLWRGNGL

ETFHYQQEKLFQQLGPIYREKLGKMTSVNVMLPEDALRLFQVEGTHPRRMTVVPWLAHRLTRRHKCGLFL

LNGQDWRLSRKMLNQDIISPAGVRQYLPLLDTVAQDFSRLLQSRLQHNPRGSITVSIQQDLFCFTVEAST

FALYGERLGLLGPNPQPEGLKFIKALGRMLETTLPLLYLPPVLARLLYPRIWEQHLLSWDYIFEHADKCM

QNIYQELCLGRPLRYTGIMAELLIKADLSLESIKANMTELTAGSVDTTAYPLLFLLFELARNPEVQVTLR

EEVLAAEEAGIGANGDLLELINALPLVRGAIKETLR

 

GGENYNVPAGTLCNVALYPMGRSPAVFACPERFD

PRRWQGKDNNFRSLNFGFGLRQCIGRRFAESEMVLFLRHILKNFQVETVSREDLKTVYHFVLMPDSHPLL

TFRTLK

 

>CYP17A1.a gi|149544763|ref|XP_001519415.1| PREDICTED: similar to steroidogenic enzyme cytochrome P450 17a-hydroxylase/17,20 lyase, partial [Ornithorhynchus anatinus] cyan does not match

MPTWERRPAFGSGPTLNVQREAAFAWDLDGESNFQRLLSPARGASLQRGSPTGSLCPGNASSLGGPTGPI

PSLCFPRPGRRRSGPTPAPPFTSQLNSWGVRGTLRESRARILPSPTRALPRPSKEGPPDAPQRYHYHRLP

TKRGTGPSDAAPGWWGRLLTLGGHGHPFVPSIRLEARPLPGHTV

 

45% to CYP17A1 XM_001519365, NW_001716571 1844>10220

TTNILSQDGKDIAFSNFGPMWKQQRK

LVQSAFAMFKDGSLHVEKIVNQQAAFLCKLLAERQGTSFDFSREIFLVVSNVVSHLCFNSCFELGDPELD

QLLMNSEHIINTIAKDSLVDIFPWLRVFPNKELRLLKKSVEIRNKLLKKRFKDHQ

 

>CYP17A1.b gi|149634544|ref|XP_001511766.1| PREDICTED: similar to 17-alpha-hydroxylase/17,20 lyase [Ornithorhynchus anatinus]

CYP61% to CYP17A1 C-term XM_001511716

(gap in seq)

DNNNSRMPQEPSMTDDHVIMTIGDIFGAGVE

TTSSVLKWFIAFLLHYPQVKKKIQEEIDRKIGFSRTPALSDRNQLIYLEASIREILRIRPVTPLLIPHIA

MKDSSIGEYTIHKGTRIMINIWSLHHDEMEWRNPDRFEPDRFLDKKGEQLISPSSSYLPFGTGPRVCLGE

SLARIELFLFLAWILQRFDFEVPENGEKPNLEGKTGVVYQVLPFQVVVKLRKGWMGTEVRE*

 

>CYP17A1 combined from two sequences above

TTNILSQDGKDIAFSNFGPMWKQQRK

LVQSAFAMFKDGSLHVEKIVNQQAAFLCKLLAERQGTSFDFSREIFLVVSNVVSHLCFNSCFELGDPELD

QLLMNSEHIINTIAKDSLVDIFPWLRVFPNKELRLLKKSVEIRNKLLKKRFKDHQ

(22 aa gap)

DNNNSRMPQEPSMTDDHVIMTIGDIFGAGVE

TTSSVLKWFIAFLLHYPQVKKKIQEEIDRKIGFSRTPALSDRNQLIYLEASIREILRIRPVTPLLIPHIA

MKDSSIGEYTIHKGTRIMINIWSLHHDEMEWRNPDRFEPDRFLDKKGEQLISPSSSYLPFGTGPRVCLGE

SLARIELFLFLAWILQRFDFEVPENGEKPNLEGKTGVVYQVLPFQVVVKLRKGWMGTEVRE*

 

>CYP19 from Brandon Hale Contig15980:2526-10166 UCSC browser

76% to CYP19A1 human, N-term in a seq gap

WWILTLLLLLLLLLLAGTPLALWSGRDAAAIP (1)

GPGYCLGLGPLVSHGRFLWMGIGSACNYYNRMYGEFMRVWIGGEETLIISK (2)

SSSMFHIMKHNHYSCRFGSKLGLQCIGMHEKGIIFNNNPTLWKAIRPFFTK (1)

ALSGPGLVHMVAMCVQSTITHLDKLDEVTNELGYISVLTLMRRIMLNTSNALFLGIPMD (1)

ESEMVMKIQGYFNAWQALLLKPDIFFKVSWLYKKYAKSI (2)

KELQDAVETLLDEKRLRLSAAEKLEDHVDFASQLIFAQ (0)

DRGDLTRENVNQCMLEMLIAAPGRE (frameshift one extra G base)

SVTIFFMLLLIAKHPNVEQAIVEEIRTEI (1)

GDRDIEMEDMQKLKVVESFIFESMRYQPVVDLVMRKALQDDVIDGYPVKKGTNIILNIGRMHRREFFP

KPDEFTLENFAKN (0)

VPYRYFQPFGFGPRSCAGKYIAMVMMKSILVTLLRRYHVQELEGGIEGVHKRNDLALHP

DETGASLDMIFTPRTPGLLRQP*

 

>CYP20.a gi|149634386|ref|XP_001506378.1| PREDICTED: similar to cytochrome P450, family 20, subfamily A, polypeptide 1 [Ornithorhynchus anatinus]

85% to CYP20 N-term XM_001506328.1

CYP20.b gi|149611985|ref|XP_001506190.1| PREDICTED: similar to MGC52842 protein, partial [Ornithorhynchus anatinus]

75% to CYP20 C-term XM_001506140

NW_001794176 complement 215115-262954

13 EXONS

MLDFAIFAVTFLLLLVGAVLYLCP (0)

ASRQASGIPGMTPTEEK (2)

DGNLPDIVTKGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDLLKQHINPNRT (1)

SDPFETMLKSLLRYQSGLGGDAGESHIRKKLYENGVSKSLQSNFAVLIK (0)

LSEELLAKWLSCPESQHVPLCQHMLGYAVKSVTQVAMGSSFEDDQEVIRFRKNHDV (0)

IWSEIGKGFLDGSLDKSATRKKQYE (1)

EAVMDMESVLKKVIKDRRGRNFNQHVFIDSLLQGNLNDKQ (0)

VLEDSMIFSLAGCVITAN (1)

LCTWAIYFLTTSEDVQKKLFKEVDQVLGKGSITQEKIEQLR (2)

YCRQVLSETVRTAKLTPIAAKLQDLEGKIDHHVIPRK (0)

TLVLYALGVMLQDHSAWPSPYK (2)

FDPDRFVDESAEKNLSVLGFSGTQECPELR (2)

FAYVVATILLSVLVRKLNLHPVEGQVVETKYELVTSPKEEAWITVSKRS*

 

>CYP21.a gi|149513488|ref|XP_001516359.1| PREDICTED: similar to 21-hydroxylase, partial [Ornithorhynchus anatinus]

56% to 21A2 aa 1-180 XM_001516309

MLPLALLLLGALAALWVWGVPLLRQSKLHLPPRVPGFLHQFRPNLPNHLLRLAQAHGPLYRIHFGNQDVV

ILNSKELIQEAMIKNWLNFAGRPLTFSSKLVSLGGKDLSLGNYSPAWKDLKKLTRSALLFGMRNKMEPLV

WQLTHQLCEDFRAQPGSAVDLFQEFSRLTNRIVCTLTFGE

 

51% to CYP21A2 aa 247-313

METQAAGVVRDLMDYMLRELREKSGVWDVTEENLHMVLLDLVIGGTETTAATLTWVVLYLLHHPE

 

Cyan does not match

RADHGAWGGEVRSAGAALARPGSSEGRAALCAAPP

GREAEGSGPPRRREREGRGDVVHAGNPSLADYLKPQVPPPRADPLAGPPASCRGVRARSPSGRGWHRLPR

GGGRAGRPRGLRAPAPQRALGARRPPAPGGARVSPAGWHPGPSLHALGAAAAHPPRPAR

 

>CYP21.b gi|149464528|ref|XP_001513953.1| PREDICTED: similar to CYP21B protein, partial [Ornithorhynchus anatinus]

59% to 21A2 aa 247-366 XM_001513903

ETQAAGVVRDLMDYMLRELREKSGVWDVTEENLHMVLLDLVIGGTETTAATLTWVVLYLLHHPEIHRRLQ

EELDQELGPGRVSGSDPPASPLPYKDRERLPLLNATILPLLRLRPVVALGLPHE

 

>CYP24A1 gi|149639846|ref|XP_001509535.1| PREDICTED: similar to 25-hydroxyvitamin D3-24-hydroxylase [Ornithorhynchus anatinus]

77% to CYP24A1, XM_001509485

MGAGELGLGGSPVRLQAAYHQKFGQMFRLKLGSFESVHVGRPGPLQDLYRREGRAPLRLRIEPWKAYRHL

RGEGDGLLLLEGEDWQRVRSAFQKKLMKPKEVMKLDTKINEVLGDFIQRIDELCDENGRIKDLYAELNKW

SFESICLVLYEKRFGLLQKNAGDEALDFIMSIKTVMSTFGRMMVTPVELHKLLNTKVWQAHTEAWDTIFK

SVKSSINNRLERYSEKPSEDFLCDIYHHNSLSKKELYATVTELQIAAVETTANSLMWILYNLSRNPHVQE

TLLKEIQTVLPDKQTPNAKDLQNLPYLKACLKESMRITPSVPFTTRTLDKETTLEEYTLPKGTVVVLNTQ

VLGTNEESFKDWSRFRPERWLLEKKKINPFTHLPFGMGKRMCIGRRLAELQIHLALCWIVRKYNIVATDS

KPVEILHLGLLMPDRELPIALRRR

 

>CYP26B1 gi|149633228|ref|XP_001507383.1| PREDICTED: similar to cytochrome p450 26B1 [Ornithorhynchus anatinus] XM_001507333.1

NW_001794094 168994-185123

MTFRLPGPGSSHCAVLDEWHDLGSGGTSSKGECSPSTESTGWTGGKSHRDQPGGCRAQTGQADRIRKRSA

LAEDGELAPVEPERFGVSPEVSQPAWPLPCPPPPPPRRANHRAVRPPADLARRFEFFSLPQKLRVFALMQ

XXXXXXXXXXXXXXXLSQYDSLNAQEPRSLAPLQEES

73% to CYP26B1

VFSKIFSHEALASYLPKIQLVIQDTLRVWGGTP

EPINVYQEAQKLTFRMAVRVLLGFSIPEDDLTHLFQVYQQFVENVFSLPVDLPFSGYRRGIQAREKLQKG

LEKAIREKLQNSPDKDYSDALDILIESSKEHGREMSMQELKDGTLELIFAAYATTASASTSLIMQLLKHP

AVLEKVREELRAHGILHNGCLCEGSLHLGHRRSLHYLDCVIKEAQHALTPCSATSCTVTPHTASHTLRPM

HCDPTPYDLTYCGPSRXXXXXXXXRDGRFHYLPFGGGVRACLGKHLAKLFLKVLAVELASTSRFELATRT

FPRLTLVPVLHPVDGLSVRFCGLDSNQNEILTETEAMLGATV

 

>CYP26C1 gi|149631901|ref|XP_001506310.1| PREDICTED: similar to cytochrome P450 [Ornithorhynchus anatinus] XM_001506260

71% to CYP26C1 NW_001794005 67848-73801 cyan may be out of frame

MSPWELSGPSTALLSLGLLTLGLLVGLAGLAGLARHLWALRWSLSRDPSCPLPLPPGSMGWPFLGETLHWLLQ ()

GSRYHSSRRQRYGPVFKTHLLGRPVIRVSGAQHVRTILLGEHRLVRSHWPDSARILLGPHTLLGAVGEPHRQRRR ()

VLSQVFSRSALESYLPPIQAALRRELRGWCGAAGPVAVFAATKALTFRIAARILLGLRLEER

RCAELARTFEQLVENLFSLPLDLPFSGLRK ()

GIRARDRLHEHMEAVIAEKLRAGPGSGPGPNDALDLIIVSAREQGREVTMQELK ()

ESAVELMFAAFFTTASASTSLVLLLLQHPAAVSRIRQELSAHQLGGRCSC ()

PCPDPPGDGASAETPAHQAEETA

CRCPPDLSLDQLGRLRYLDWVVKEVLRLLPPVSGGYRTALRTFELD ()

GYQVPQGWSVMYSIRDTHETAAVYRSPPDGFDPERF ()

GPRAPEGGRGPG

RFHYIPFGGGVRSCLGQELARTVLKLLAV

ELVRTARWELATPAFPDMHTIPIVHPVDGLRLLFHRLPPDPAADPAAPRS

 

>CYP27C1.a gi|149581564|ref|XP_001509012.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]

85% to CYP27C1 XM_001508962

VATILYECRLGCLEDPIPELTSEYIEALELMFSMFKTTMYAGAIPRWLRPLIPKPWREFCRSWDGLFKFS

QIHVDKKLRDIQSQLDRGERVRGGLLTHLLLSKELTLEEIYANMTEMLLAGVDT

 

>CYP27C1.b gi|149476406|ref|XP_001519194.1| PREDICTED: similar to FLJ16008 protein, partial [Ornithorhynchus anatinus]

86% to 27C1 aa 411-542 XM_001519144

LFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYEDENFPLATEFRPERWLRKGSMDRVDNFGSIP

FGYGIRSCIGRRIAELEFHLVMIRLLQHFEIKTSPQTKTVPAKTHGLLTPGGAINVKFVSRK

 

>CYP39A1 gi|149633473|ref|XP_001511640.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]

70% to CYP39A1 XM_001511590

MNSQYGPIFTVFALGNRMTFVTEEEGINTFFKSKEVSFELAVQNPVYHTASISKEIFFLNHDKLYGLMKG

KMSTSNMHHFFGKLVEELHEHLEYLGTEGTQDLCNLVRNVLFPSSVNILFGKGLFPTSQRKIKEFEEQFR

IYDEGFEFGSQMPECLLRNWSKSKQWFLRLFEKAISDLETSKTSGDESKTLMQNMLDILKQEIKNEHTGP

SYAVLLLWASQSNAVPIAFWTLAFLLSHPSIYKNIMEDLTSVFGKAGKRKIQVSEDDLKKLPLIKWCVLE

AIRLRAPGVITRKVVKPVKILNYTVPSGDILMLSPFWLHRNPKYFPEPEVFKPERWKKANLEKNAFLDCF

VAFGGGKCQCPGRWFALMEIQIFVILILYKYDFTLLDPVPKQSSRHLIGTQQPEGPCRTKYEQRK

 

>CYP46A1 gi|149636926|ref|XP_001512720.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]

60% to CYP46 XM_001512670

MKRNLCSSRAKEYGPVVRLNAFHRISIFLTSPEAVKEFLMSPQYQKDPRVYGQLHSLFGERFLGKGIITI

QEHERWHKQRKIMDPAFSRSYLVGMMGTFNEKAEQLMEILEEKADGKMEVSLLNMMNRVTLDIIAKVAFG

METNTLHDDQTPFPHAVTTAMKGVSMIRNPMLKFLPGKRKVVDEIRSSIRFLRQTGKECIERRREAIQNN

EEIPPDILTQILKGEATEGPRDDETMVDNFISFFIAGHETTANQLAFTILELSRHPEILEKLQAEVDEVV

GSKRDIEYEDLGKLQYLSQVFKEALRLYPPGPGTSRWLDKELVVDGIRLPAHTSIFLSSYTTGRLETNFK

DPLVFNPDRFSPEAPKPYFTYFPFSLGPRSCIGQNFAQMESKVVMAKFLQRLEFQLAPGQNFTILDTGSL

RPKDGVFCTLTPRKSHCDFSGGIGGNMISEGL

 

>CYP51A1 gi|149521644|ref|XP_001517490.1| PREDICTED: similar to lanosterol 14-demethylase, partial [Ornithorhynchus anatinus]

XM_001517440 some parts of the translation in Genbank are wrong

EST EH003064 2 aa diffs

AAPN01271409.1 C-term of CYP51

 

85% to CYP51

KFPPHIFSPIPF

LGHAVAFGRSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFG

KGVAYDVPNPVFLEQKKMLKTGLNITHFKQHVPLIEKETKEYFASWGESGEKNLFEALSELIILTASHCL

HGREIRSQLTEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHRAIKKIFYEAIRRRRETREPVDD

ILQTLLDASYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTGTWLGFFLARDRRVQAQCFEEQKRVCGDDLP

PLNFDQLKDLTVLDRCLKETLRLRPPIMTMMRMARTTQ

 

TVNYTTMIHTPNNPVVRYRRRVAGEAGGGGRP*