Honeybee Cytochrome P450s from version 1.2 of the Apis mellifera genome Sept. 17, 2004

 

These sequences were submitted Feb. 11, 2004 by May Berenbaum in collaboration with

Gene Robinson (genome sequencing), Hugh Roberstson (genome annotation) and Reed

Johnson (P450 annotation).

 

On Sept. 2, 2004 Reed Johnson submitted the revised sequences from Honeybee Version

1.2.  These sequence have been further edited and revised by D. Nelson on Sept 13-17.

Many partial sequences have been combined and the number of complete genes

increased from 20 to 33.  The number of P450 genes including fragments is now

55, including 22 partial sequences. 

 

There are 4 CYP clans in insects.  CYP2, CYP3, CYP4 and mitochondrial

CYP2 is the clan with CYP18 in it.  Sometimes it is called the CYP18 clan.

CYP2 also has CYP303, 304, 305, 306, 307

CYP3 has CYP6 and 9 in it and CYP28, 308, 309, 310, 317(a CYP6 subfam)

CYP4 has CYP4, 311, 312, 313, 316, 318

the mito clan has CYP12, 49, 301, 302, 314, 315

 

The honeybee sequences have been sorted in to these main CYP clan bins.

38 genes have been named. 3 named genes are pseudogenes.

 

CYP2 clan (9 sequences, 6 complete, 3 incomplete)

 

>CYP18A1 honeybee Am1.2_13.1b (32196-34509) plus, 524 aa, 5 exons

version 1.1 = Am1.1_13.1a (71904-74217) plus, 524 aa, 5 exons (71904-72236,

72653-72774, 72894-74323, 73404-73668, 73794-74217)

60% to CYP18A1 D. melanogaster

MGGTRIEVLCTFLVFLGVLLVARCLQWLRYVRSLPPGPWGVPVFGYLPFLKGDVHLRYG

ELAKKYGPMFSARLGTQLVVVLSDHRTIRDTFRREEFTGRPHTEFINILGGYG(1)

IINTEGAMWKDQRKFLHDKLRGFGMTYMGGGKKIMESRIM(0)

REVKTFLRGLASKRGTPTDVSASLGMSISNVICSIIMGVRFQHGDARFKRFMDLIEEGFKLFGSMAAVNFIPVMR

YLPCLQKVRNKLAENRAEMAGFFQETVDQHRATFDEGTMRDLVDAYLLEIEKAKGEGRATTLFQGKNHD(1)

RQMQQILGDLFSAGMETVKTTLEWAIILMLHHPDAAIAVQEELDQVVGKSRMP

VLEDLPFLPITEATILEVLRRSSVVPLGTTHATTR(2)

DVTLHGYTIPAGSQVVPLLHAVHMDPELWEKPEEFRPSRFLSAEGKVQKPEYFMPFGVGRRMCLG

DVLARMELFLFFSSLMHTFELRSPQGSSLPSLRGNAGVTVTPDPFDVCLLPRNLDLIEDNDMISTGAILRNIGSH*

 

>CYP306A1 Am1.2_13.1a (39182-37170) minus, 499 aa, 7 exons

version 1.1 = CYP306A1 Am1.1_13.1b (76876-78884) minus, 499aa, 7 exons (78884-78557,

78493-78345, 78209-78007, 77901-77595, 77538-77383, 77298-77123,

77057-76876)

44% to 306A1 Anopheles gambiae = CYP306A1 in 18clan/2clan

CYP306A1 is the probable ortholog of CYP306A1 in diptera (flies and mosquitos)

the % identity is below the usual cutoff for subfamily membership,

but it makes sense to name orthologs with the same name.

>CYP306A1 Am1.2_13.1a (39182-37170) minus, 495 aa, 7 exons

MILDHYIAIFVLPFLLLLYVVRKNRKARRLPPGPWQLPLLGYLPWIDAEKPHETLTR

LSRVYGPVCGFRMGSVYTVLLSDPQLIRQSFAKDSITNRAPLYLTHGIMKGYG (1)

IICAEGEQWKDQRKFISNCLRNFGMVKHEGAKRDKMEERISDAVNECVS (0)

VLRDRGANGPIDPLDTLHHCLGNLVNSIVFGKTYEEEDRIWKWLRHLQEEGVKQIGVAGPLNFLPFLR (2)

FLPQYGRVIRSIVDGKDKTHEIYRQILDEHRARVDSGNGCKIDSFLAAFDEQMRKK

DGAESGYFTEPQLYHLLADLFGAGTDTTLTTLRWFLLFMAAHPMEQ (0)

EKIQSEMDLCLREGEQPTLNDRIVMPRLEAAIAEVQRIRSVTPLGIPHGTSE (0)

DVEIGGYDIPCGAMIVPMQWAIHTDPAYWRDPLEFRPDRFLSEDGTFFKPESFLPFQNG (1)

KRVCVGEELARMILFLFAGRILRAFSVRVPAGEIADLEGECGITLVPKPHRLAFVGRDR*

 

>CYP307B1 Am1.2_14.10 (757965-761727) plus, 507 aa, 3 exons

version 1.1 = Am1.1_14.9 (18918-22680) minus, 507 aa, 3 exons (22680-22278,

20154-19363, 19246-18921)

CYP307B1  55% to 307B1 Anopheles, probably the ortholog of 307B1

MIPLTATTCFLIAITFLALALILLDHLRSKKTTKSVVPGDDDQHALPEPPGPKPWPILGSL

HILGRYDVPYKAFADLVRDFDCQVIKLRMGSVPCVVVNGLENIKEVLTVKGHHFDSRPNFARYHLLFGGNKENS (1)

LAFCNWSDVQKARREMLRAHTFPRAFSTRFNELNGIIGDEMEFMVNHLDSLSGTSVHAKPLILHCCANIFITYL

CSKNFHLEHDGFRNMVENFDKVFFEVNQGYAADFLPFLMPLHHRNMARMAHWSHEIRRFVIKNIIADRVNSWND

VVPEKDYVDCLINHVKSGTEPQMSWNTALFVMEDIIGGHTAIGNLLVKVLGFLATRPEIQRLAQDEIDALGLAG

NFVGLENRRSLPYVEAIILETIRIIASPIVPHVANQDSSIAG (1)

FRIKKDTFIFLNNYDLNMSTDLWTSPEEFMPDRFVQNGRLLKPEHFLPFGGGRRSCMGYKLVQYVSFAILASIL

KNFTITPVQKEDYTIPIGNLALPEMTYKFRFERR*

 

>CYP303A1 Am1.2_Un.1361 incomplete on N-terminus (5389-7223) minus, 378 aa, 8 exons

AADG03013520.1 (WGS)

version 1.1 = CYP303A1 Am1.1_Un.2253 incomplete on N-terminus (55-1889) plus, 378 aa, 8 exons

43% to 303A1 D.mel., 44% to 303A1 Anoph. CYP303A1 in 2 clan/18 clan

may be the ortholog of 303A1, first exon below is 75% to 304A1

(1)LLLVDGNLWNEQRRFVLKHLRDFGFGRQN (1)

LYMNANEYTGNNVTQSQLGTIISMHNIFGITVLNSLWKMLAGKR (2)

YNIDDKELIYFQRILSITLNEIDMLGAPFSHFPLLRFIAPEISGYKSFVKIHEELWKFFK (0)

DEVNNHKNTFNSDSPGNLIDIYLTILNSENYGKTFSD (1)

VSEPQLVAICVDLFMAGSETTSKVLGFCFLYLVLFPHVQKKAHEEIDRVIGRNKLPTAEDKAK (2)

MTYMNAIVLESLRMFAGRSLNLPHRVQRDTKISDYKIPK (0)

NTIIITNFNGILMDESWGDPENFRPERFIDGSGNIVTPSRFLPFSAG (1)

KHRCMGENLAKTNIFIIATTLLQAFTFSEIPGEKPTIEHFIDGTTISPKPYRVNVSLRI*

 

>CYP305D1? Am1.2GroupUn.127b (70044-73538) minus, 490 aa, 8 exons (first exon is a guess)

version 1.1 Am1.1_Un.7452 incomplete on both ends (700-954) minus, 85 aa, exon 2

version 1.1 Am1.1_Un.6110 incomplete on both ends (1-622) minus, 126 aa, exons 6,7

Two fragments from v.1.1 have been combined in this sequence.  The first exon is a

best guess. BI513047.1 (EST) AADG03008281.1 (WGS) 39% to 305A2, 39% to 305B1 Bombyx

36% to 305C1 partial seq.

MNKNFVKIFNLLLYLFIDVFNNLFFIECD (1)

GPFSWPFIGNQILLKRLSRKFGGQHKAFMELSKRYNSDIITVNISYEKIIV

VSGSKFCDMILQNEEFQGRPWNEFIKVRNMGKKQG (1)

ITMNDGTEWKELRNWMMRTMKIFGFGKSEMIEMIQHQLVIFSENLNKNKLHQLKLLFVPAVINVLWNFITGELVAFNQQQK(2)

LEHFLDLLDRRSRCFDITGGLLAAFPWIRYIAPEISGYNIMCMLNKELKDFLM (0)

KTINDHKEKYIEGKEADLIDMFIQEMRKNEKSSIFT (1)

DEQLMMILIDLFLAGFTTTSTTLDFLFLIVTLFPDVQRKVQKEIDSVIPYDRLPNMEDKAK (2)

LPYVEAVISETYRLWPVFPIIGPRRVLCDTNIDKYVIPKDTTILFNTYSINKDPTLYPDPDKFMPE (frameshift)

RFIX (frameshift)

KWSFLNQMIFFTIGK (1)

GKRRCPGDILAKATIFILFVGIMQKYTLLPVPGKGPHSIKINSGITLTPQPYNVLVEKR*

 

>CYP15A1 Am1.2_Un.127a (66491-68918) plus, 504 aa, 8 exons XM_392687.1 partial

gnl|Amellifera1|165771382 BCM Apis mellifera 12/11/2003

Am1.1_Un.897 incomplete, missing exon 5 (51606-53773) plus, 357 aa, 5 exons

Am1.1_Un.10970 incomplete on N-terminus (112-677) plus, 121 aa, 2 exons

Two fragments from v.1.1 have been combined.  18clan/2clan

47% to CYP15A1 Diploptera punctata (probable ortholog)

39% to CYP15B1 Anopheles gambiae 36% to 303A1, 35% to 305A3, 31% to 304B1

MLYVVISLLLALYCIFCIYDCVKPHNFPP (1)

GPKWLPLIGCFLTFRRLKLKHKYTYVAFQELSKTYGPILGLKLGSQKLVVI

STHDLVKKVLLQDEFNGRPDGFFFRVRAFGKRK (1)

GILFTEGSMWSQCRRFTMRHLRSFGLGQSTMEKYLTVEAENLVNYLRRVST

KGPVPMHTAFDIAVLNSLWCMFAGHRFDYENEKLAEILEIVHDSFR (2)

LMDTMGGIISQMPFLRFIIPELSGYNNLMEILRKLWNFLDEEINNHEKHLSGNQPQDLIEAFLLEISSRNGVQNDSIFDR (1)

ENLLILCLDLFLAGSKTTTDTLSTSILFLSLHSEWIKILQEELDNVVGRSRSPTLEDYSSLPIMESFLAE (0)

IQRFLIWAPLGVPHKTTKDVILNGYNIPK (0 GC boundary?)

DTTVLLDFHSAHNDPAYWDHPEEFRPQRFLDANGRFCQNNANIPFGL (1)

GKRRCPGEMLARTSLFLYFAYVIHYFDIEISPEHGKPDLNGHDGFTISPKSYYLKITARSDVTNCSTI*

 

>CYP342A1 Am1.2_8.3 incomplete on N-terminus (1269-3097) plus, 505 aa, 7 exons

version 1.1 Am1.1_Un.8493 incomplete on both ends (509-1028) minus, 141 aa, 2 exons

36% to 304A1 36% to 304B1 18clan/2clan

MISFLFIIFLLLIIYKIYNSVIHVSSNTPP (1)

CLPRLPIIGSYWHLLWHDYEYPYNGIIHYVNKLQSKIVTCYFG

SHKTIIANDYKSIKEVLTKQEFNGRPINVDIVLQRAFGKSL (1)

GIFFTEGTLWHEQRRFALRHMRDFGFGRRHEIFETNVMEEIAILVDMLKEGPINDEEK (0)

KFLKNGYACFPDILYPYVANVILNIMFGERFDRSQYHKLIYFCESS

MMFQKSLDTSGGAIFQFWFLKYFGNIFGYTNAIKATYQMINFIE (0)

EYIDNKKDLDDYDKGLIGRYLKILKEKNNITSTFSQKQLIMTLVDFMFPATSALPSA

LVHAIKLVMHHPRVVNNIQEEIDRVVGTGRLVTWSDRKN (2)

LPYIEATIRESLRYETLTPLSVFHKTLKKTTLCDYDIPKDTLVVTNLVALNTDPDLWGDP

ENFRPERFLDENNELRKDFTFPFGF (1)

GHRVCPGETYSRYNMFEVFAVLMQNFNFSFVEGEPTGLDDKESGLIVTPKKTWIQVKARNMK*

 

>Am1.2_Un.3241 (94-459) minus, 96 aa, 2 exons at N-terminus up to C-helix

version 1.1 = Am1.1_Un.7901 incomplete on C-terminus (1-459) minus, 126 aa, 2 exons

40% to 15B1

MWFVILCFVIVLIKILFDYSRPINFPPG(1)

PRGLPFIGNILDIIRLINETKYYSDTWCRLAEKYGSVVGLRLGLDQPLIIVSGKSAVTEMLNRSEFDG RPSGFLYKYRCGGMQQGILFTDTDVWHSQR

 

>Am1.2_Un.6423 incomplete on N-terminus (67-247) minus, 254 aa, 4 exons

AADG03019874.1 (WGS)

Am1.2_Un.1305 incomplete on N-terminus (2043-2647) plus, 146 aa, 2 exons

Am1.1_Un.960 incomplete on both ends (8311-11562) minus, 147 aa, 2 exons

One fragment in v.1.1 was divided into two in v.1.2, but they are probably from

one gene. 43% to 305a4

(0) EVIAKHKWKKINEEGTNFIDVYLQEIQKKNSSHSFFN (1)

ENQLLYIIKDLFSAGVDTTNSTIGFIIAFLVVHQDVQSKVYDEISRVIDKDIYPSLSDKDR (2)

LPYLKAVIAEVSRLANIGPTSIPHRAVKDSTFLGFEIKKNYTLLANFKSIHMDK

EHWGDPEIFRPERFINEKGDFINDSWLMPFGL (1)

GRRKCLGETLAKNTVFLFVACMLQRLHFMLPSNHPPPCLQGIDGFVIAPPMMDIIAVQRF*

 

CYP3 clan (34 seqs, 19 complete and 15 incomplete)

 

>CYP6AQ1 Am1.2_12.14 (417204-420026) plus, 514 aa, 5 exons

CYP6AQ1 Am1.1_12.14 (315628-318450) plus, 514 aa, 5 exons (315628-316108,

316238-316604, 316677-316861, 316989-317277, 318272-318450)

45% to 6K1, 42% to 6g2m 43% to 6G1ps new subfamily in CYP6

cyan = missing seq. from EST BE844578

yellow = EST BE844462, underlined seq = EST BE844394, green = EST BE844353

magenta = EST BE844352, gray = EST BE844331 all ESTs from antennae

 

MNLLTPYWSLDILIVSSSLMIAVYLYASWKLKYWSRRGIMQITPSPLFGNFKKCILFQKSVSEIIRELYGQNEGLPFMGFY

IFYKPFFLVRDIELVKHILVKDFNTFANKHTSADSKNDRIGYSNLFIIKNPAWKYLRGKLTSVFTSGKLKKMFDLMLIIG (1)

KNLEKHLELLNLDG

NGKEVELKDLCANFTTDLIGTTAFGVNLNSLKDPNSDFRENGRLVFDYNLKRAFEFFSIFFFPNLS

KYVSIKFFGKATDYFRNSFWSVINQRIESNVKRNDLIDCLIELREKHKNDESFEGFR (1)

FDGDDLVSQAAIFFTGGFETSSTTISFTLYELALNKDIQKTVRTEIHEALAQTDGKITYDM (0)

ITNLPYLDMVVSETLRKYPPLGFLDRVALHDYKIPNSDVTIDKDTPVIIPMIAFHYD

PKYFPNPEKYDPLRFSEEVKKTRPSYVYMPFGEGPHICIG (1)

MRLGLLQSKLGIIEILKDYEVSPCEKTKIPMVLDPKGLTTTALGGLYLNIRKITIAAG*

 

>CYP6AR1 Am1.2_5.5 (430078-432827) minus, 502 aa, 5 exons

CYP6AR1 Am1.1_Un.19 (44801-47550) plus, 502 aa, 5 exons

50% to AmGroupUn.5496, 47% to AmGroupUn.792b, 38% to 6a13ps all best hits to 6as

MSWLMIETVGLIATVFFLLYYYSMSKLDYWRKRGVKGPKPLPFLGNFKDVLLAKESTMDCFERA

YKEFKDEPMVGMYGSHEPLLILRDLDLIKDVLIKDFNKFAQRTQGAIRE (0)

VEPLSEQLFRLDAERWRPLRLKLSSFFSSGKLKEMFHLFVECSDNFEKYLEKMVEKGGLVECRDAAAK

FSTDVIGACAFSIHTNALTDENSQFRKMGKQALATNLQQFLNDRLREYPFLFKIFGRFFVDHEVTNFFAN

SIKDAMDYRIQNNVHLRDVIDILADIRENPTKCGLKE (1)

ADNLFLTSQAVLFFLAGFENASLTISNALYELAWKPEIQEKARAEIVNVLQKYDGKITYDGLEEMKYLEACIF (1)

ETLRMYPVLQWLSREAMETYTFTGTKVTIPKGQQVFLPIYAIQRDPDIYPNPDNFDPERFTDDKIKTRHSMTHLPFGDGPRHCS (1)

GIRLAKKQLKVGLVTVLSKFKVEVCEKTRKIYQKDKKPLFLLQPVDGIHLKISKVSV*

 

>CYP6AS1 Am1.2_Un.6491 (264-2651) plus, 498 aa, 5 exons

CYP6AS1 Am1.1_Un.5496 (264-2651) plus, 498 aa, 5 exons

44% to 6A14, 64% to AmGroupUn.792b

MDYFQILCAISIVILTIYYYYSSKYTFWKKRGISGPKPIIFFGNFVDSIIQ

KRSTSEAVKKWYDDYKHESVFGIFGGTTPLLVINDLDMIKDVLIRDFSLFVDRGFHIFPK (0)

IEPLSEHLFLLEAERWRPMRMKLSPIFTSGKLKEM

FFLIMESAGNLEKYLDEVIKKDEMVECRELAAKFMTDVIGSCAFGINTNSLLE

EDSEFRRMGKKISTPNLKVMLGNICKEFFPPLYEIVGSIF

TLKDVNEFFINLVSDTMKYRKDNNIIRSDFINMLMQLKEHPEKMENI (1)

ELTNTLLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRNMHEKNKGVLTYTDVKEMKYLDKVFK (1)

ETLRKYPILPMLFRQAMENYTFKDTKITIPKGMKLWVPVHGIHHDPNIYPEPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCI (1)

GARFAHYQSKVGLITILRHHKVNVCEKTTIPFKADERSFLLTLKGGVHLKITKI*

 

>CYP6AS2 Am1.2_Un.601a (2171-4675) plus, 498 aa, 5 exons

CYP6AS2 Am1.1_Un.792a incomplete on C-terminus of exon 2, missing 3rd exon

(8375-10702) minus, 356 aa, 5 exons cyan is from EST BE844607 from antennae

86% to AmGroupUn.5496

cyan = places that differ between ver1.1 and ver 1.2

MDYFQILCAISIVILTIYYYYSSKYAFWKDRGISGPKPIVFFGNFGNSIVKKRSISET

VKKWYDDYKHESVFGIYEGTIPVLVINDLDMIKDVLIRDFSIFVDRGFHTFPK (0)

IEPLTQHLFLLEAERWRPMRMKLSPIFTSGKLKEMFSLIVESAGNLEKYLDEVIKKNEMVECRDLAAK

FTTDVIGSCAFGINTNSLLEEDSEFRRMGKKIFSPSLKLMIGNTCKVFFPSLYEVIGNIFTMKDVDE

FFINLVSDTMKYRKDNDIVRSDFINMLMQLKEHPEKMDNI (1)

ELTDTLLTAQAVVFFIAGFETSSSTIAFGLYELAQNQEIQDKLREEIRKMHEKNKGILTYTDIKEMKYLDKVFK (1)

ETLRKYPILSTLSRKAMENYTFKGTKITIPKGTKVWVPVYGIQHDPNIYPKPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCI

(1)

GARFAHYQSKVGLITILRNHKVNVCEKTTIPFKADERSFLLALKGGVHLKITKI*

>CYP6AS fragment Am1.2_Un.1326b incomplete on C-terminus (4-243) minus, 80 aa, 1 exon

1 aa diff to Am1.2_Un.5413

>Am1.2_Un.5413 stop codon in 3rd exon, incomplete on both ends, (1-1334) plus, 315 aa,

3 exons 60% to 6AS2, 71% to Am1.2_Un.6932 in one overlapping exon 3

New seq in ver 1.2

MDFFQIFCAICIMLLAIYYYYTSFYNYWKVRGIPGPEPTIIIGNFMEVFLKKISINDKLRFLYNKYKN

EPMFGIFEGSSPILVLNDLDLIKDVLIKDFSIFSNRGFRIFPK(0)

AEPLGEHLFALETERWRPMRAKLSPIFTSGKLKEMFPLIIECSKNMEPYLDKIAERGKYIECRDLAAK

FTTDVIGSCAFGIDMNSISDKDSEFRIIGRKLFTPTFKTIVRDVCRQFLPGLYDVIGHKLQIEEVNEF

LTNLIKDTINYRKENKIVRPDFVNTLIELKDHPEKLETIK(1)

LTDSMIASQAFV*GVAGFETSSSTISHALYELAQNQEIQDKL

 

>CYP6AS fragment Am1.2_Un.6932 incomplete on N-terminus (41-1021) minus, 209 aa,

3 exons, 92% to last 3 exons of CYP6AS2

New seq in ver 1.2

(1)LTDILLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRKVHEKNKGVLTYTDIKEMKYLDKVFK (1)

ETLRKYPILSTLSRKVMENYTFKGTKITIPKGTKIWVHGIQHDPNIYPEPEVFDPERFEDDAFASRHPMSYLPFGDGPRNCI (1)

GARFAHYQSKVGLITILRNHKVNVCEKTTIPFKADERSFLLVPKGGIHLKIIKI*

 

>CYP6AS3 Am1.2_Un.601b (7365-9709) plus, 499 aa, 5 exons

CYP6AS3 Am1.1_Un.792b (3396-5727) minus, 499 aa, 5 exons

64% to AmGroupUn.5496

MDYFQLLCVIGALLFAIYYYLTLTFDTWKNRGIPGPKPTIFFGNFQEVILKKISLA

EKTKQLYQEYKNELVFGIFQGRTPILVINDLEMIKDVLIRDFSVFPDRGIHVNPK (0)

VEPIFQTLFSLKSKTWRPLRMKLSPVFTSGKLKDMFPLILDCAKNLEEFVEKVRNSGEPVDC

RDMAAKFTTDVIGSCAFGVCMNSLSPEGSEFRRMGEQLGKFSFKKLARDFTRLYMPFLFDII

GGYLQSHEVNNFFINLIRDSIKYRQENNVYRPDFVNTLKELKEHPEKLENI (1)

ELTDALLTSQALVFFLAGFETSSTTISNALYELAQNPEMQDKLRKEIKEVYENNGGALSYTDVKEMKYLDKVFK (1)

ETLRKYPVLAALSRQATENYTFKDTKIKISKGTRIWIPVYGIQHDPNIYPEPEVFDPERFEDDAFTSRHPMTYLPFGDGPRNCI

(1)

GARFAHYQSKVGLITILRDNKVEVCAKTLIPYKSEPRNILMIPKGGKVELGITKV*

 

>CYP6AS4 Am1.2_Un.1740a (1295-3956) plus, 501 aa, 5 exons

CYP6AS4 Am1.1_Un.1753 incomplete on C-terminus of exon 1 (2509-4596)

minus, 411 aa, 5 exons

80% to AmGroupUn.42b, 58% to AmGroupUn.792b, 41% to 6a17, 44% to 6a13,

MLHHFHILTAFVAIFLALYYYLTSKFDFWKNRGVSGPRPVPFFGNAKDVLLRKIGIG

SFIAELYKRYDNEAMFGIFIGRSPNLVLRDLDLIKDVLIKDFSIFDNRGLNIPER (0)

AEPFSVNLFSVDATRWRPLRMRLSPVFTSGKLKEMFPLILECAEHLEQCLEDAVKRGGPVDCFE

IPARYTTDVIGSCAFGINMNALSDERSEFRKMGRNMFDQNMIKFTRNLLRDFFPRFYNLLGFVL

PYTESTVFMTKLIKGTIKYREENDVVRPDFVNLLMELKKHPEKLKNI (1)

EITDTLLAAQASVFFAAGFETSSTTMAHALYEMALNPDIQDKLRNEMKEFHAKNNGNLKYEDIKEMKYLDKVFR (1)

ETLRKYPPGMLLRRKCNSNYTFHGTKVSIPAGTSVIIPLYAIQIDPKFYENPDVFDPERFNEDAVAARHPMTYLPFGDGPRNCV

(1)

GARFAVYQTKVGLIKILQNFRVDVCEKTMIPYVKKINSITLAPRDGIFLKIEKITD*

 

>CYP6AS5 Am1.2_13.15b (125743-128770) minus, 499 aa, 5 exons, now complete

CYP6AS5 Am1.1_Un.42a pseudogene? stop codon in exon 4 before heme binding

site and missing exon 5 (126603-129298) minus, 439 aa, 4 exons

56% to AmGroupUn.5496 43% to 6M2 new subfamily in CYP6?

MASSFEILCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKDLILVKKSTAHFV

KDIYEKYKNEPMVGLYATRSPFLLLNDPELIKDILIRDFSKFANRGLGVFER (0)

TEPLSPHLLNLEVERWRPLRSRLSPIFTSGKLKEMFYLIIECSLNLEMYLDKLIE

KNEPIECRELTARFTTDVIGSCAFGIDMSSMTNENSEFRRMGREVFAVNFMNVMR

MKLKQFMPRLYDLLGYVMPDRTFAPFFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENI (1)

KLTDSLIAAQAFVFFLAGFETSSTTMSNALYELALNQDVQKKLREEINTFCPKNNKELKYDDIKEMEYLDKVFK(1)

ETLRMYPPASILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAIYPNPDSFDPERFDKDAMASRHPMHYLPFGDGPRNCI

(1)

GARFAVYQTKVGLITILRNHKVEVCEKTVIPYEFDPGAFLLSPKDGIYLKITKI*

 

>CYP6AS6 Am1.2_13.15c (120924-123194) minus, 497 aa, 5 exons

CYP6AS6 Am1.1_Un.42b alternate splice for exon 3? (121844-124324) minus,

497 aa, 5 exons

41% to 6a17, best matches all CYP6As 80% to AmGroupUn.1753

I = V in ver 1.1

MFDYFQILIAFVASFLALYYYLTSNFDFWKNRNVVAPKPIPFFGNTKDVVLKKIE

ISNFIAELYKKYENEAMFGIFFGGSPNLILRDLDLIKDVLIKDFSTFDERGFKISER (0)

ADPLNANLFNMDVTRWRPLRIKLSPVFTSGKLKEMFPLILKCAERLEQCLEDAVKR

GGPVDCFEISARYTTDVIGSCAFGINMNALSDERSEFRRIGKRIFDLDKNILRSFL

RQFFPRFYNLLGFVIPYSETSKFVTKFISEMIKYREENNVVKADFVNLLMELKKHPEKLQNI (1)

KITDNLLAAQAFVFFAAGFETSSTTMAHALYEMALNPNIQDKLRKEIKEFYANNNFTYEEVKKMKYLDKVFK (1)

ETLRKYPPGVFLKRKCNSNYTFKGTKVSIPAGTSVIIPVYSIQTDPKFYENPDVFDPERFNEDAVAARHPMTYLPFGDGPRKCI

(1)

GIRFGVYQTKVGLIKMLKNFKVNVCEKTMIPYIKKINSFTLAPKDGIFLKIEKNN*

 

>CYP6AS6-se1[5] Am1.2_13.15a solo exon pseudogene (132407-132573) minus, 54 aa, 1 exon

1 aa diff to last exon of CYP6AS6, but in different region on 13.15

the two sequences are on AADG03005752.1 11483 bp apart

new sequence in ver 1.2

14302 (1)IRFGVYQTKVGLIKMLKNFKVNVCEKTMIPYIKKINSFTLAPKDGIFLKVEKNN* 14138

 

>CYP6AS7 Am1.2_13.15d (115784-118302) minus, 487 aa, 5 exons AADG03005751.1 (WGS)

CYP6AS7 Am1.1_Un.42c incomplete on N-terminus (115419-117055) minus, 265 aa, 3 exons

45% to 6M2, 66% to AmGroupUn.1753 Nearly complete sequence.

BI505169.1 EST (N-terminal)

MXXXXXXXXXXXXXFLAIYYYFTSTFDFWKVRGV

PGPKPIPIFGNIKNVMLLKTSMCHYLKKLCEEYKH

EPMIGIFTRKTPILIIQDPDLIKDVLIRDFSKFANRGIPIHEK (0)

AEPLSPHLFNLEVERWRPLRTRLSPVFTSGKLKEMFPLILDCAKHLEQYLDKLVLREEFIE

CRELTAKYTTDVIGSCAFGIEMNALSDEESEFRRIGRKVFSNSFGQILRFRFRQIFPRIYN

LLGFVLPPMEVTKFLTNIIVSTMKYRQENNIVRPDFVNMLIELKKHPDKLENI (1)

KLTDTLLTAQAFVFFIAGFETSSSAISNALYELALNPEVQNKLRQEIKEYFNKHNELKYEYIKNMIYLDLVFR (1)

ETLRKYPPGPLILRKSITNYTFNNTKVSIPEESFVWIPLYAIHHDPKIYPNPDAFIPERFNDDAIATRHPMHYLPFGDGPRNCI

(1)

GARFAVYQSKIGLITILWNYKVEVCDKTMIPYEINPAAFLLTPKGGIYLKFTKIKNNEEILN*

 

>CYP6AS8 Am1.2_Un.5081 (10839-13505) minus, 500 aa, 5 exons

CYP6AS8 Am1.1_Un.4533 (10741-13406) minus, 500 aa, 5 exons

53% to AmGroupUn.2631 42% to 6P4 48% to 6N1 partial

T = R in ver 1.1

MYISLEIFCGIVVALIALYYYLTVNNNFWKNRGIAGPEPVLGFGNMKKVLL

GKESMSQFLTKIYHEYKNEPIIGIFTTRTPQLIIKDPDLIKTILIKDFSKIMNRGLLPMVS (0)

GEPISQHLFNIEAERWRPLRIHLTPVFTANKLRGMFSLILECSMHFVSYVDSLVKKGEP

VNVREVAARFTTDVVGSCGFGVEMNSLSEKESEFRRVGKSVFATNYARIIKHRIREFMP

RLYNYILYLWPTDEMAEKIIKLTRETLEYREKNNLFRPDFMNILLDLKKHPEKIGL (1)

DVTNEFLAAQAFIFFVAGFETSSSTISNALYELALNPDVQDKLRKEIKEFAAKNDGEWRYETIKEMEYLGKVFQ (1)

ETLRKYPSLPFLTRELIEDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFSDDKIKQRHPMHFLPFGHGPRNCI

(1)

GARFAIYQTKIGLINILRNFKLDVCDKTLIPYKHHPRGLLLMPLTDLYLKITRLTN*

 

>CYP6AS9 Am1.2_Un.1054b frameshift in exon 2, possibly a pseudogene because splice

site donor for intron 4 removes 2 aa from heme binding region (1823-4511) minus, 499

aa, 5 exons

CYP6AS9 Am1.1_Un.2792 incomplete on N-terminus, pseudogene??? heme binding

site probably not functional due to change in splice donor

(995-3268) minus, 367 aa, 4 exons

65% to 6AS8

Am1.1_Un.4458 incomplete on both ends (1-1218) plus, 203 aa, 2 exons

3aa diffs to AmGroupUn.2792 61% to 6AS8

AADG03012612.1 AADG03012613.1

MFINLETLCGFVIVLIAFYYYLTINNNFWKNRGIPGPKPTIGFGNMWTVMFGKESFSQLLTTIYNKYKDE

PMIGIFFRRRPVLLLKDFDLIKDVLIKDFSKFANRGFLKTNP (0)

KVPLTNHLFALEVKRWRPLRNHL (FRAMESHIFT)

SPVFTSGKLKGTFAQILNCSNDLVTHIDTLSKMEDSINMREVAAKFTTDVIGSCVFGIKMNSLSEIENEF

RRIGRNIFATNFTNILKIRLLQSTPFLHSLLCKILPDEEMEMFMRITKETMEYREKNNLVRPDFMNILLELKKHPERIADIE (1)

LTDDLLAAQAYIFFAAGFETSSTTISNALYELALNHDMQDKLREEIKEFEAKNDGEWRYETIKEMQYLGKIFQE (1)

TLRKYPALSFLSRESIIDDYTFRDTKLTISKGTLVWIPVFPIHHDPNIYPEPEKFDPERFTEDKIKERNLMHYFPFGHGPRNC

(1)

ARFAIYQTKIGLIKILRNYKVDVCSKTLIPYKYDPFSFILVPLGGLYLKITRIQD*

Am1.1_Un.4458 and Am1.1_Un.2792 from v.1.1 match best to CYP6AS9 in v.1.2. 

 

>CYP6AS10 Am1.2_Un.1054a (7016-10145) minus, 499 aa, 5 exons

CYP6AS10 Am1.1_Un.2631 incomplete on C-terminus of exon 1 (2686-5804)

minus, 495 aa, 5 exons AADG03012613.1 AADG03012614.1

gnl|Amellifera1|174017188 BCM Apis mellifera 12/11/2003

40% to 6M2 53% to AmGroupUn.6AS8

MAAFEILCGFIIFIFAFYYYLIKPQEYWKNRGVPGPKPIPIFGNFFRLTFA

RISIGDLMTKFYKEYKHEPVFGLYMRNVRVLAINNPDLIKTVLIKDFSKFAHRGLALNEV (0)

TEPLSQHLFVLEPKRWRPLRTKLSPIFTSGKLKDMFSLIIECSNTLENYVEHLISKNDRVE

VRDLAAKFTTDVIGSCGFGVDMNAMSDVQCKFRDIGREFFGPSFKQILKIRLRENLPRLYT

FLGYILPRDETTTFFTNVVLDMIKYRKTNDIYRPDFINALINIQNHPEKLDI (1)

ELTEPLLVAQAFLFFVAGFETSSLTIATALYELAQNQDIQDKLRDEITEHHKLNNGEWQYENIKNMPYLDAVFK (1)

ETLRKYVPLTVLMRQSLEDYTFESINLTIPKDTRIFIPIYAIHRDPDIYPNPEVFDINRFSKEAEATRHPMHYLPFGDGPRNCI

(1)

GARFAIFQTKIGLIKILRTYKVDVCNETQIPFINEPRTFTLAPKHDLTLKITKIEN*

 

>CYP6AS11P (pseudogene) Am1.2_Un.5080a incomplete on N-terminus (1-1697) plus, 229 aa,

4 exons with three frameshifts and a stop codon

gnl|Amellifera1|166350743 BCM Apis mellifera 12/11/2003

Am1.1_Un.4532 incomplete on N-terminus (1-757) minus, 131 aa, 2 exons

83% to 6AS8

  = differences in ver 1.1

HLPSRFTSNKL frameshift

KGMFCMIHECSKHLVNY frameshift

LDIXVEKEDPVNVRE frameshift

VAARFTTDVVGSCGFGVEMNSWSEQESEFRRLGKSIFNTNVQKILKDRFRE*RPQVYNFL

LYILPLDGISPKILKLMKETIKYRKKYDIFRPDXNIILELKKHPEKINI (1)

DITNELLAAQIFIFFAAGFETSSTLISNALYELALNPNIQDKLREEIKKFESQNDEEWKYETIKKMDYLEKVIQ (1)

ETLRKYPPVPFLNRELIDDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFSEDNIKQRHPMHFLPFGHGPRNCI

(1)

GIRFAEYQTKIGLINILRNFKLDVCDKTLIPYKLHPRGLILIPLTDLYLKITRLTN*

 

>Am1.2_1.19, incomplete on C-terminus (860909-863534) plus, 381 aa, 3 exons

in CYP6, 46% to 6AS5 missing EXXR to end

new in ver 1.2

MWNIIRELLEQFLLPGLFLGILYCFLTSTFDFWKNRGVPFRKPTVLFGNFAPMLLFRKSLPE

GIKEMYEWFKDERYFGAFRVRSPVLILRDPDLVKNICVKNFTSFSNRGIPVNSQ(0)

DPLSAHLFNLEGKKWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFEKLIDISSETDRPYE

IRELAAKFTIDVIGTCAFGIQINALTDEESEFHRAAKKLSKPSYKATLWRMLRTAMPRLY

KFLGVQVIDPGVTKFFKDVVSQMIKQRGEYGIKRHDFMDLLIELKNKGTLDEFG (1)

KLDENSIAAQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAIDSRNGNLTYDAVQDMKYLDMVIAG(1)

 

>Am1.2_13.16 incomplete on C-terminus (2365-4885) minus, 445 aa, 4 exons

Am1.1_Un.248a incomplete on C-terminus (38475-40756) plus, 338 aa, 4 exons

49% to 6Aa14, 73% to 6AS8

MYIGLEILCGIVITLIAFYCYLTINNNYWKNRGIPGPKPVPGFGNMKNVIFGKESV

SQFLTRMYNEYKDEPMIGVFSKRTPVLIVKDVDLIKTILIKEFPKFANRGLFPIFS (0)

RDPLTHHLFNLEVERWKPLRTQFTPLFTSSKLKEMFSLILECSNHLESYMDTLI

KKGEPIDMREVSARYTTDVVGSCAFGIDMNSLSEKESVFRRLGKLIFATNLRKI

LSIRIQDMLPWLYNSFLYVLPRDEKTRIIMKLMTETMEYREENNVFRPDFINMLLNLKKHPEKIDI (1)

ELTDDLLAAQIFIFFAAGFETSSSTISNALYELALNPDIQEKLRKEIKEFEARNNGEWRYEIMKEMEYLEKVFQ (1)

ETLRKYPSLPFLNRKLINDYTFESNNVTVSKDLKIWIPVYGIHHDPDIYPDPEKFDPERFSKEEIMKRHPMHFLPFGHGPRNCIG

(1)

 

>Am1.2_Un.5080b incomplete on C-terminus (3231-4470) plus, 287 aa, 2 exons

Am1.1_Un.248b incomplete on C-terminus and N-terminus of exon 2

(43061-45682) plus, 245 aa, 4 exons 78% to 6AS8

Am1.1_Un.248c incomplete on C-terminus (47350-47685) plus, 112 aa, 1 exon

94% to AmGroupUn.248b, only 6aa diffs at N-term

Am1.1_Un.248b and Am1.1_Un.248c match best to the same sequence in v.1.2, suggesting

that the aa differences between them were errors.  The C-terminal portion of

Am1.1_Un.248b matches exactly to the C-terminal part of Am1.1_Un.248a/Am1.2_13.16. 

The C-terminal part of Am1.1_Un.248b was not found on Am1.2_Un.5080b and may have been

the product of misassembly in v.1.1.

MYIGFEIIYGIVIVFIAFYYYLTINNNFWKHRGISGPKPVLGFGNMKKIIL

GEESMSQYLTKLYHKYKNESMIGIFRLRTPALIIKDPDLIKIVLIKDFSKFMNRGLLPIIS (0)

TEPISHHLFALEAERWHPLRKHLTSGFTSNKLKGMFCMIHECSKHLVNYLDNLVRKEEPVNV

REVAAKFTTDVVGNCGFGVEMNSLSEKESEFRRLGKSIFNTNLQKIIKDRIRELTPQIYNFL

LYILPLDGISPKILKLMEETITYRKQYDIFRPDFMTIILELKNHPEKFNIG(1)

 

>Am1.2_Un.7762 incomplete on C-terminus (1072-1314) plus, 81 aa, 1 exon

gnl|Amellifera1|2043985811BCM Apis mellifera 8/15/2003

Am1.1_Un.9652 incomplete on C-terminus (993-1236) plus, 81 aa, 1 exon

72% to AmGroupUn.248a

note: this exon 1 may join with Am1.2_Un.218 to make a complete sequence

MNISLEILCGIIVALIVFYYYLIINNNFWKNRKISGPKPVIGFGNMLSIILGKESTSQFLTRIYNEYKNEPMIGIFSKNNP

ALGIRNPDLIETVLIKDFHKFANRGLFPVNS (0)

 

>Am1.2_Un.218 incomplete on N-terminus (12841-15336) minus, 389 aa, 4 exons

Am1.1_Un.8460 incomplete on both ends (123-685) plus, 139 aa, 2 exons

71% to 6AS8

Am1.1_Un.8178 incomplete on both ends (801-1322) minus, 174 aa, 1 exon

64% to 6AS8

(0)REPLSQNLFGLEVERWRPLRIHFSPIFTTNKLKGLCSLILECSEQLEKYMDILIRK

GEPLDIREIAARFTTDVIGSCAFGIEMNSLSENESEFRRLGKGVFNTTFRRIVKTRIRN

LMPWLYNFFLRILPWDEITKKIVKLTTETIEYRNKNNIVRSDFINVLLNLKKHPEKIAEI (1)

ELTNDLLSAQTFVFFGAGFETSSTTISNALYELALNHDIQYKLREEIKEFEKKNDGKWTYESIKEMQYLNKIFQ (1)

ETLRKYPVVPFLNRELISDYTFENSKITIPKGLKIWIPVYGIHHDPDIYPNPEKFDPERFSEDKIKERHSMHYLPFGHGPRNCI

(1)

GSRFGTYQTKIGLVKIIRKYKVEICDKTLIPYKFNSFANFLMPSTGLYLMITDVEN*

 

>CYP6AS12P Am1.2_Un.1740b possible psuedogene (6374-9226) minus, 500 aa, 5 exons AADG03014312.1

Am1.1_Un.8712 incomplete on N-terminus (13-1433) minus, 267 aa, 4 exons

60% to 6AS5

Am1.1_Un.10510 incomplete on both ends (122-647) minus, 176 aa, 1 exon

54% to AmGroupUn.42a, 39% to 6a16m all best hits = CYP6As from aa107-274

probably a new CYP6 subfam or CYP6a

Am1.1_Un.6966 incomplete on C-terminus (878-1100) minus, 72 aa, 1 exon

40% to 28A5 N-term 38% top 6a20 57% to AmGroupUn.42a

Possible pseudogene because of stop in first exon.

  DIFFERENCES WITH VER 1.1

MAYVEILCVGIIVSMLAFYYYFTSAFNFWKIRGIPGPKPKFLFGNIRDIILSRISTPAFIKNVCDTYTN

EPMVG*YMGRNTLLLLKGPELIKDVLIRDFSKFADRGFNVHEK (0)

VEPLSQHLFNLEPKRWRPLRSKLSPMFTSKKLKEMFGLILECGRHFEKYV

DGLAARRQPVDFCEVAAKYTTDVIGSCAFGINMNAMSSEGSEFREAGRKIFEPTWNSII

RLKFKITMPTLYDLLGPLVPEREVTPFFIKVVTDAMKYKKESNVFRPDFIDTLMKLRDDPESLSDI (1)

ELTDAFLTAQAYVFFAAGFETGASTISNTLYELAQNQGMQDRLREEIREHCDKYGGELMYENIKEMEYLDKVFK (1)

ETLRKYPPGTLIPRRSVSEYTFKNTNVTIPKGTMIWIPAFPIHRDPNIYPNPDDFNPENFTEDAINNRHPMNYLAFSNGPRNCI

(1)

GARFANYQVKIGLIMILRNYKVEVCEKTVIPYQFDPNLFLLGPKGGIYLRVTKVE*

 

>Am1.2_Un.1326a incomplete, missing 3rd exon (4844-8009) minus, 430 aa, 4 exons

Am1.1_Un.2707 incomplete missing exon 3

(1-3597) plus, 368 aa, 4 exons

59% to AmGroupUn.4533 

note XM_396006.1 mRNA predicted by program GNOMON skips exon 3

MIANLEIFCGIIVIVIAFYYYITARNNFWKIRGIPGPEPLPGFGNVLMIVLGKE

APFQFLTRVYNEFKNEALIGVFMKTYPALVVKDPDLIKDIMIKDFYKFPNRGFPKSDS (0)

ADPLTQHLFLVEEEKWRPLRTQLSPVFSTGKLRGTFTQILDCSNHLVTYMDKLVEIGEP

IDVREVTAKFTTDVIGSCVFGIKMNSLSGKESEFRRFGRQIFAMNFLKILRLRIKQFLP

MLHYLLVRILPPDEETKIMLKLTRDTFKFREAHNIVRPDFMNILMELKKHPEKVPSL (1)

missing exon 3

ETLRKYPVLPYLSRRSIEDYTFEGTKVSIPKNTLICIPVYPIHHDSSIYPNPEKFDPERFSEDEVKKRHSMHYFPFGHGPRNCI

(1)

GLRFAIYQSKIALIKILSNYKIEICDKTLIPYKYDPFSFISLPLTGIFLKITKLQN*

 

>Am1.2_Un.416 incomplete on both ends (10974-18858) minus, 223 aa, 3 exons

gnl|Amellifera1|236106554 BCM Apis mellifera 12/11/2003

Am1.1_Un.2162 incomplete on both ends (1-852) plus, 223 aa 3 exons

39% to 6g1 aa175-381 probable new subfamily in CYP6 41% to 6AQ1

NSMNKYLDDEFSHD

TKTKTIMIKDVTLKYTTNVISSVAFGIQVNSFNPKTIQFYEE (1)

GLKTTFSRSMQLFISFFFPKLSPYLNTRMLGSSTNFFRKVFWNSMDNREITKTKREDLIDSLIELKNSKQDKDFS (1)

FEGDALLSQSAIFFIAGRETSISIICLTLYELAKHPEIQKRTREEINEKLKE

HGMTYEGVQSMKYLHQVVSEILRIYPPTPIIDRVAVADYK (0)

 

>Am1.2_Un.6686 incomplete on N-terminus (2630-5871) minus, 453 aa, 5 exons

missing about 54 aa

gnl|Amellifera1|2049199734 BCM Apis mellifera 8/15/2003

Am1.1_Un.2637 incomplete on C-terminus (7-2478) plus, 330 aa, 4 exons

45% to 6P4 new subfamily in CYP6? 46% to 6F1

Am1.1_Un.5730 incomplete on both ends (990-741) minus, 84 aa, 1 exon

54% to 6d4m 60% to AmGroupUn.8460 60% to 6AM1

  intron boundary revised. 44% to 6AS5

FIAEFFRDIYEHNKHHRLVGIYMLYKPYLIVNDPNLIRDILTKEFTNFHDRGIFYNEEVDPLS

GHLFQLPGKKWRNLRVKLTPTFTSGKIKQFFPILNEAGNILAKYLEEEARKGSTIDVKDIFAR (2)

YSTDIIMSVAFGISCDSFKEPNNEFRYWGKKIFDPKPLWNALILFAPQILNFFSISY

TEKSVTKFFTNMFKQTVKYRESNNIERKDFLNLLIQLMKNGYVDADDESLSNNVNAA (1)

KNKLTMMEAAAQAYVFFLAGFETSSTTVTFCLYELAKNQDIQNKVREEIQTMIKKNGDLTYNALNDMNYLHKVIS (1)

ETLRKYPPVVILNRICTNDVKLSTTDFCIPKGTCIAIPVFGLHRDSNIFPNPEKFDPERFSEENIKTRHPYVYLPFGEGPRICI

(1)

GLRFGLIQTKIAIINALLKNKFKFGPNTPSTLEFEKGSLILIGKGGIHLNIEPI*

 

>Am1.2_Un.383 incomplete on N-terminus (6360-7086) plus, 84 aa, 2 exons

Am1.1_Un.4500 incomplete on N-terminus (298-1025) minus, 84 aa, 2 exons

52% to AmGroupUn.5496 53% to 6AM1

AIFNPERFTEENKRTRHPYAYLPFGEGPRNCI (1)

GMRFALLQIKVGIISFLRNHRVETCQKTITPIKFSRRSLVTTSEKGFWLRIK*

 

New families in the 3 clan CYP335 and CYP336

 

>CYP335A1 Am1.2_14.13a (10454-12001) plus, 515 aa, 1 exon

CYP335A1 Am1.1_14.7a (400127-401674) minus, 515 aa, 1 exon

40% to 9f2m new subfamily in CYP9 63% to 335A2 39% to 9D1, 38% to 9K1

50% to 9J8 partial

MEVSHLTTFELLLLTLIFIILAKLVSILYTQFTYWKRNKVPYIRSSPLFGTAWRVFFRLVSFPNYCKYIYNYYPDARYVGVMDFAT

PTVIVRDPKLIKEIAVKNFDNFPDHRSFVTEEMDPVFGKNVFSLKGDRWREMRNTLSPSFTANKMRFMFDLVSKCSHDFVSCLHDR

LESSSSEIEGKNLFTRYSNDVIATVAFGISVNSIEHPDNEFYRRGIDVSTFSGTFRFIKFMLFRLNPRLTRMAGFTFLSRATSKFF

WRVISETVTARKRRGIVRPDMIHLLMQATDSKKKSIHQTMTIDDIVAQAFIFFLAGFDTTSTLMCYVVHELALHQDVQRRLREEVD

RVLDDGTEISYEDTLGMEYLEMVISETLRMHPPTLLIDRQCAKEFHLPPAGPGYESVTIHPGENIWFPVLAIHRDPAHFPDPDKFD

PERFNRENRNGIDPYTYIPFGVGPRKCIGNRFALMETKLLIIRLLRKFVIKPCERTMDPIVYKKGNFTLMPKDGFWVTFEKRNDH*

 

 

>CYP335A2 Am1.2_14.13c (15290-16849) plus, 519 aa, 1 exon

CYP335A2 Am1.1_14.7b (395285-396839) minus, 519 aa, 1 exon

39% to 9f2m 63% to 335A1 40% to 9K1 51% to 9E2 partial, 54% to 9J7 partial

MESPTLLFSFELLAIGLTAIVLAKFVSLLHHQYNYWRKRRVPHVGAVPVLGSSWRIFTRRMSLPNFCSLVYKHRPGSRYLGMMDCF

TPVVVVRDPNLIKEIAVKNFDHFPDHHSFINEKIDPIFGKNVFSLKGDRWREMRNTLSPSFTASKMRFMFDLVSNCSEEFVRYLYD

HPEFSSSIEAKDAFTRYTNDVIATVAFGISVNSMENRDNEFYTKGADATNFGGIFRLFKFMLFRVNPRLTRMAGLSFLSRGTATFF

HRVVRETVRARDERRIVRPDMIHLLMQARDKEDRRPVATVDNRMTIDDITAQAFIFFLAGFDTSSTLMCYVAHELALNPPVQERLR

EEVDRFMDGGNGAITYEALLKMEYMDMVTSETLRKYPPIVFIDRLCVEKFELPPAEQGYDHLIVHPDNIVWFPVYGLHHDPKYFPE

PEKFDPERFNDANKRNIVPYTYMPFGLGPRKCIGNRFALMETKILIAYMLRKFRIKRTEKTRASIEFSKTNFSLTPDHGFWIGLEK

RDP*

 

 

>CYP335B1 Am1.2_14.13h (106877-108409) plus, 510 aa, 1 exon

CYP335B1 Am1.1_14.7c (305231-306757) minus, 510 aa, 1 exon

39% to 9E2 35% to 9f2m 57% to 335B2 42% to 335A1

MDYLQLGLTLLAILVAVYYLSTRNHKLLKRHGIVHIPPTPLFGNLGPLVRRKCHMEDVIQRVYDLDPDARYVGMYEFTTPLIIIRD

PELIKTIGVKEITNFTNHRPFVDVGVDPMLGEVLFAMQGDRWREHRTMLTTLFTSSKIKSMFVLMSDCAKRFADYLSKVEREIELK

SVLTRYTNDVIARCVYGVSVDSVNEPENIFYRYGQVASQLSTFKQNLMIFVHRNSPRLARLFNLKILPVHIEKFFHRLVMDTIETR

RREGVHGLDMLQQLMDMQSRRKESEEGKRGMTVTDIANHAFSFFFGSVDTMATQISLISHMLAVNPDVQQRLQEEIDEVLSASEDK

QVGYDVIQEMKYLDAVMSEAMRYHPILLFVDRVCGETFELPPALPGARPFKLERGMNIWFPVKAIHHDPKYFENPDRFDPDRFLRD

GKGIASSGAYMPFGMGPRKCIGSRFALTEMKILLFNILAKCSFKVGSKTMVPLKFKEGVFNPVAKNGFWLKIERRENSCC*

 

>CYP335B2 Am1.2_14.13g (159215-160813) minus, 532 aa, 1 exon

CYP335B2 Am1.1_14.7d (252241-253839) plus, 532 aa, 1 exon

57% to 335B1

MEFLSLALVLAAISIIAYYYCFVRKNFNLFQEHGILHVPPSPLVGNFGPLIRGKENVHDTIQRIYNIHPDAKYVGIFEFLTPVIMI

RDLDLIKSITMKNFDQFPDHRPMFCKSVDPMLGEMLFIMDGERWKEHRNMLSPTFTSSKIKTMFVHMSECAKRFAHHLSKLPEKDR

ETEMKALLTRYTNDVIAACIYGVNVDSIKEPRNVFYMYGRVGATLIGLKKNLKIMVHRNMPWLANLLRLNILERHIAKFFTDLVVE

TVEERERNGTTNSDLIQLMMDTRNKKESGKKNLTVQNMANHAFSFFFGGFDTVSSQTCVLLHMLVENPEVQQRLQQEIDETLESNN

GQLSYDVIQEMRYLDAVINEILRLHPIAVFIDRMCVKSFELPPALPGDVPFTVKPGMNVWIPVKAIHHDPRYYDEPEKFKPERFLD

NGKNIIGSGAYFPFGIGPRICIGNRFALIEMKVLVCHILAVCDIKAGARTGIPLEFEKGVFNATAKTGFWLKIEPRKYSYHSGQIN

GLVNNHVINGACKTGI*

 

>CYP335B3 Am1.2_14.13d (145027-146580) minus, 517 aa, 1 exon

CYP335B3 Am1.1_14.7e (266474-268027) plus, 518 aa, 1 exon

58% to 335B2 ESTs BI508364 BI516506 BI505081 BI505012

MDYLTISLSLITVFVAVYYLATRNNDFFKKHGIPHVPPVPFLGNMGSLVRQKSNLHDVIDRTYNLDPGAKYVGIYEFTTPIIILRD

LDLIKTITMKYLDHFPDHRSFAYEGADPVFGSMLFAMKGERWKEHRNMLTPTLTSSKIKGMFKLMTECAVRFADFLSVLPENERET

EMKALLSRYANDVIASCVYGVSVDSINDPKNIFYVYGRRGTNVVGLKKSMFVLIHRNMPWLAKLFGLRFLEKHVQKFFYDLVYETI

ESREKLGTNRSDVLQLLMDIRDKANSSGKMTTMTVENVAIHAFTFFFGGFDSITSVTTLLTQMLAEHPDVQARLQQEIDETLRSND

GVLTYDAVHGMKYMDAVINETMRFCPVLPFLDRMCVESFQLPAPVPGGQPFTLRPGMNVWIPLAAIGRDPEYFEDPDKFDPDRFLN

PEAGIKNSGAHFPFGLGQRKCIGERFAMMEMKVLLCYVLAACNVRIGSKTTVPMKLEKGLINANVKGGFWLKIEPRKVTYYNSSRS

N*

 

 

>CYP335C1 Am1.2_14.13f (153220-154824) plus, 531 aa, 1 exon

CYP335C1 Am1.1_14.7f (258230-259825) minus, 531 aa, 1 exon

44% to AmGroup14.7d 49% to AmGroup14.7g

MLDSWSITAAIVAVLAIAYYQLIWKYKHFERIGIPCYHSIPLLGSFWEAVIQRNNFAEISRKIYNSYPDTKYMGMYDTTTPVLLIR

DTELIKAISVKHFEQFPDHRSFQNEATDPLFAKNLFALRGDRWREIRNLLSPAFTSSKMKSMFILMRDCAKEYGDYFASLTGDEST

IELKDAFTRYTNDVIATCAFGVEVNSMKDRKNKFYVYGREGTTFGSWASIKFFVTRVLPVSVCTLLRIRLIRKEISDFFIDLVSTT

IKTREEKGIVRPDMIQLMMESKGKLGAGKEMSMIDICAQAFVFFFGGFESTSTLMCFAAYEIAVNEDIQRRLQNEIDQVLEERDGE

VTYAAVNEMKFLDAIIYEALRMYPVVVATDRVCMKPFELPPNRPGEKPYLLKEGDNVWFPIYAIQRDPQYYPEPDKFDPDRFLNDT

KQMINSGLFLTFGIGPRMCIGNRFAMLETKVLLFHLFARCNLVPCSKTTIPMKLNRKGFSMTAENGFWFKIEPRSAKKEEKIAVPG

TTMLIDKIPDRYPDN*

 

>CYP335D1 Am1.2_14.13e (151195-149678) minus, 507 aa, 1 exon

CYP335D1 Am1.1_14.7g (261868-263392) minus, 507 aa, 1 exon

49% to 335C1

MAIFALLLIVLGILGSYHLLKSQNPFKEHGLPYKSYLPILGSTWESILRRKSFAVVIQEIYNLAPSARYVGFYNRTTPIVMIRDPE

LIKTIAVKNFDAFRNHRTVNDTQTDDVLLSGNLLLLRDNRWREVRSLNTPAFSTSKIRSMYRSMSEIAINVARYLSTLAPGQNIVE

MKDIFTRYANDVFATCAFGISVDSLSDRENKFYELGREALDIHSTPILKLILIFAFPKLARRLGVSLVSKEATNFFTRVVSENIKM

REEKGITRPDFIQAMIDKRNGRGRDDELTVEDITAQAFVFFFGGFETTSGLLSFAVHELAANPEIQGKVHAEIDRVLVSNNEITFE

RVNGLVYLDAVINETLRMYPIIPITDRECSKRFELPPVLPDAKPYVLKEGSHVWFPIYAIQRDPRYFEKPDCFDPDRFLDDNKKRS

DAFNGDAYMPFGAGPRNCIGNRFSMVETKVALFHILAKCRLDVCPKTTIPMELRKRGVFLTAKNGFWLRIVPRHPVT*

 

>CYP336A1 Am1.2_Group2.13 (199618-201108) plus, 496 aa, 1 exon

CYP336A1 Am1.Am1.2.15 (200938-202428) plus, 496 aa, 1 exon

34% to 6AH1 Anopheles EST BI946448 from brain

MASAFLTLVTGALLLLCFYLYLKYTYWKRNGIP

YSKGYYPIIGHFLPLIMKKQSYSEIIEEIYRDSNHSMVGMYKGMKPVLILRDINLIKTVLQSNFSKFHENAVKIDPKLDPLLAKNP

FFCYGELWQTGRKRLTYAFSNARLKILFAAVYEVCTKFRNFLDRRLESSKKYEVELKSLFLKFTSEVVANAGLGIEGFCFEDGKVQ

SIFTNLDNNDFLDTFLVGIIMHFPFLTKLLRIKFLPTKHDKFF

RTVVKKNLELRKSDPIPRNDFIQLMIEMEQTGEKIDEEIVAAHAVSFYLDGVETSSVTLNFIGCQLAIHQDVQEKLRKEVRSTLEK

HGGVLTFEALKDMTYMNQVISESQRYFSALGFLGKICTDEFELQGSDGLNYRAKPGTELLIPICGLHKDPKYWDNPEIFDPERFSD

ENKQRIEKMAFIPFGEGPRICVGMRMAMLQMKSCLATLMKDYKLEVSPKMQLPLKLSPTYFLSAPLGGGWVLISKA*

 

CYP4 clan (4 seqs, 2 complete, 2 incomplete)

 

>CYP4G11 Am1.2_Un.3078 (673-4557) minus, 545 aa, 7 exons

Am1.1_Un.2145 (673-4743) minus, 545 aa, 7 exons

CYP4G11 63% to 4g15m, 100% to AF207948 partial seq

MAAASATGFSASSVFLSLLIPALILYFIYFRISRRHLLELAEKIPGPPALPLIGNALDLFGT (1)

MFSQVLKKAENFKDVVKIWVGPKLVICLIDPRDVEIILSSNVYIDKSTEYRFFKPWLGDGLLIST (1)

GQKWRNHRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENG

KEFDCHNYMSELTVDILLETAMGVSKPTRDHNAFEYAMAVMK (2)

MCDILHLRHTKIWLRPDWLFNLTKYGKNQIKLLEIIHGLTKKVIQLKKEEYKSGKRNIIDNSAQKTESK (0)

TNNIVVEGVSFGQSVGLKDDLDIDDDVGEKKRQAFLDLLIEAGQNGVLLTDKEVKEQVDTIMFE (0)

GHDTTASGSSFFLAVMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERCLLETLRMYPPVPLIAREIKTDLKLA (1)

SGDYTIPAGCTVVIGTFKLHRQPHIYPNPDVFDPDNFLPEKTANRHYYAFV

PFSAGPRSCVGRKYAMLKLKIVLSTILRNFRVRSDVKESEFRLQADIILKRADGFKIRLEPRKQVASTA*

 

>CYP4AV1 Am1.2_Un.1387 (15087-18877) plus, 124 aa, 2 exons

Am1.2_Un.1625 (113-5079) plus, 437 aa, 7 exons

>CYP4AV1 Am1.1_Un.2000 incomplete on N-terminus (1-4856) plus, 496 aa 7 exons

39% to 4c3

  modified intron boundary

Am1.1_Un.2000 appears to have been split into Am1.2_Un.1387 and Am1.2_Un.1625 in v.1.2.

MSSSTIIMGVSWLTMILSICLMTIVVLLLVRRGKFLYALRKVPCPPAFPIIGNAYELCAVREV (1?)

AFKKMIKWGKELGDMYLIWVGMRPFIFLYKAEAIQPLLSSSVHIDKSLEYQYLQPWLGSGLVTST (1)

GEKWHFHRKLLTPTFHSGLLELYLKTTIREAQILISCLRKEIGKPEFDIVPYAKRAALDIIC (1) DSSMGCNINAQKNFENEYVQAVNT (2)

LASISQRRFLNVWMSFDPIFKLTSWGKRHDHALSVTHGFVNK (0)

IIAERKAEWKDRKDTNFNEKSHKRQALLDLLLELSKDGKVLTDDDIRDEVNTFMFAGHDTTATSVSWILYALGRHPQYQ (0)

ELIIEEYDETVGTKELTLDILSKLTWLEACIKESWRLYPVTPLIARQIYHPITIL (1)

GHEIPIGSTVLVNSFLLHRDSRYFPEPDIYRPERFLPDGPKYPSYAFVPFSAGSRNCIGWKYGT

MIVKVLILYILKNFHVESLDTEDQLRFISELVLHNADGLRLKITPRK*

 

>Am1.2_Un.1527 (1556-4363) plus, 478 aa, 10 exons

Am1.1_Un.8281 incomplete on both ends (644-1499) plus, 132 aa, 3 exons

Am1.1_Un.2540 incomplete on N-terminus (5369-5938) minus, 71 aa, 2 exons

43% to 4M5

MISAILFFIFLLATLHYFLLHHRKFGKMINLIPGPEPLPILGNIPTFHNISP (1)

SELWKFLTQLSKQYYPIYRMWTFLEAYVHICHPDDIE (0)

TILGNIKFTKKGFGYKYLKPWFNTGLLTSS (1)

GHKWHVRRKILTSAFHFNVLRQFVDIFIEDAERLIKTLESEEGIFVENLLQLTSEHTLNVIC (1)

ETAMGTSLKNKEKFQYEYRKAVYNMGCIFANR (2)

IVKPWFYYDFFFNLSPEGWQQSKLLKILHNFTRK (0)

IIQERKEYHDKTNGRYLNDFHENINENDNNNDYNDCR (1)

IRRKRLAMLDLLIEAHRNNKIDDEGIREEVDTFMFR (0)

GHDTTAISFCFSIMLLAEHKEIQ (0)

DRARAEIKAAIEENGGKLNITVLQNLPYLERCIKESLRLFPSVPRISRKLYIEVLMNYCTID (?)

43aa exon with PKG and PERF motifs

(0?) *RHPYAYVPFSAGPRNCI (1)

GQRFAMLELKTYLGLLLYNYYFEPIDYLKDVTFVSGIVLRLENPVRMKFIPVKKIC*

 

>Am1.2_Un.1327 incomplete on N-terminus (901-1990) plus, 299 aa, 3 exons

Am1.1_Un.3324 incomplete on N-terminus (901-1990) plus, 285 aa, 3 exons

50% to 4aa1 55% to 4AN3 partial

(2)GQIMLLYRMIRPWLLIEWIYRLTKYGREEEKQRKNLFDTCFKMVKEKRDLLQSKDRISNNDIKKNK

NISLLEYMVEINEKNPCFSDEDIVEECCTFMLAGQDSVGTATAMTIFLLANHPEWQNKCIEEIDEIFNG

DTRFPTISDLKEMKCLEMCIKESLRLYPSVPIIGRTLGEDIKI (1)

GKHIIPAGCSVLISPYSTHHLPHHFPDPDTFKPERFNSENSEKRHPYAYIPFSAGPRNCI (1)

GYKFAMLEMKSIISAILRKCRLQSIPGKKEIRPKFRMTIRAQGGLWVKIIERDQILKSIAA*

 

mito clan (7 sequences, 5 complete, 2 incomplete but from a single gene)

 

>CYP314A1 Am1.2_5.28 (13954-16400) plus, 516 aa, 10 exons (first exon is a guess)

CYP314A1 Am1.1_5.25 AADG02002903.1 incomplete on N-terminus (17670-19852) minus, 471 aa, 9

exons (19852-19708, 19574-19378, 19298-19111, 19031-18829,

18707-18579, 18471-18305, 18238-18160, 18072-17875, 17777-17670)

43% to 314A1, 55% to pea aphid (Acyrthosiphon pisum) P450 below

cyan is extra seq added based on CF588143

note This seq is less than 55% identical to Drosophila and Anopheles 314A1s,

but there appears to be only one orthologous seq in each species and it does not make

sense to give the ortholog a different subfamily.

 

MLLSSAWFEVIAAVLLTILIFVTSHRPAWWFWTATSHEASGKS (0)

GKFKTVSKVPGPFSLPIFGTRWIFSCIGYYKLNKIHDAYK (1)

DLNQRYGALCKEEALWNFPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRYTNLGLVNE (2)

QGQTWHDLRVALTSELTAASTVLGFFPALNIVADSFIELIRRQRVGYKVTGFEELAYKMGLE (1)

STCTLILGRHLGFLKPDSSSELATRLAEAVRIHFTASRDAFYGLPLWKLLPTCAYKQLIESEDAIYN (2)

IISEIIETTIQEKRDDAKDESVEAIFQSILRQKNLDIRDKKAAIVDFIAAGIHT (0)

LGNTLVFLFDLIGRNPAVQNKLYEETYALAPAGCDLTIDNLRKAKYLRACITESLR (2)

LIPTTTCIARILDEPIELSGYRLTAG (0)

TVVLLHTWIAGLNEENFKDAKKYLPERWTTPTTPHSPLLVAPFGAGRRICPGKRFVDLALQLILAK (0)

IIREFEIIVEEELDLQFEFILAPKGPVSLGFRDRS*

 

>CB336480 Tribolium castaneum embryonic cDNA

MFEKIFQSLDVTSLLIIAI

FFLFLEYRPPWWYRNNDCKKGVKLIPGPLALPGLGTTWIFFFGGFSFNRLHLYYENMYKR

YGPVMKEEYWCNIPVINLFEKREIVKVLKAGGKYPLRPPVEAVAHYRRSRLIDTLALG

 

>CF588143 pea aphid (Acyrthosiphon pisum) 48% to 314A1 D. pseudoobscura

  2 RVLRQSGKYPIRPPNEVTANYRKSRPDRYTNTGLVNEQGEVWAMLRNKLTPELTSPRTIR 181

182 RFLPEVNQLADDFNNLISLARDGNNVVRGFEGYCNRMGLES 304

305 TCTLILGRRIGFLDGEVSETATRLADSVTSQFRASQEAFYGLPLWKLIPTKAYKDFVAS 481

482 EDALYDIVSEFVESALIDEQQSFTDVRSVFVSILQASELDNRDKKAAIIDYIAAGIKT 655

    LGNTLVFIL 682

 

>CYP334A1 Am1.2_9.8 (72740-75349) plus, 530 aa, 10 exons (second exon is a guess)

CYP334A1 Am1.1_9.6 alternate splicing possible? (1158493-1161102) minus,

514 aa, 9 exons (1158603-1158493, 1158868-1158668, 1159034-1158959,

1159285-1159117, 1159526-1159346, 1159843-1159593, 1160068-1159927,

1160289-1160153, 1161102-1160830)

34% to 12A5m a new family in the mito clan

MTESQTASVDESLRTDTIPLLDHTATTEVSPTTFEVSTMKVDTQIFDKAPLPFDEIPGPAILKIWEKYWKYVPLLG(1)

RLTWNRNITPLKYLFNEYGCIVRINGPLSGDIVMIHR(2)

PEHIAEVFKQEGDTPVRSGIDILQHYRLNYRKYRLAGPFSM(2)

QGTEWLEIRDKVEDTFNQISSTFFTKIDTCCNELITRICKIRNRQNE(0)

VPVSFYEDLIRWAMECFCDLTFNKRLGFLEPIGYNSSSEASKLINALTTAHKYMSRCETGFQVWRFFLTPFARKLFEACDVLDN

(2)

VIGKYVRQAQCKLRIRKSHSEESSMTERSPVLEKLLLNEGIHPDDICTMLMDMIILGIQA(0)

TVNSEAFLLYHLAKNPRTQRKVYDEIISVLSNDNSSFTEKSLKNMPYLKACIQETLR(2)

LHPAIPYITRLLPKTISLHGYTIPKG(0)

TFVIMANQITSQREENFEDPFKFWPERWLSNSSKEDVHFSYLPFGHGIRSCLGKNMAEAKMMLLTAK(0)

VRQFRIEYDYADIKSRFMMVNVPNKPLRFRFVNRN*

 

>CYP315A1 Am1.2_Un.768 (10162-7910) minus, 535 aa, 6 exons

CYP315A1 Am1.1_Un.1189 (10257-12510) minus, 535 aa, 6 exons

38% to 315a1m, probable mito clan, maybe 315Bx

note This seq is less than 55% identical to drosophila and anopheles 315A1s,

but there appears to be only one orthologous seq in each species and it does not make

sense to give the only ortholog a different subfamily.

MNLAQNILKSGKSVSLSSNVIALKYNVPGCGYAGASQTSRIDDLSDISKSTDGGNRSKIEITEKLRDR

NYGTVAVATSESILQEMPEPRGIPVFGTLFSFILSGGPKKQHEYVDKRHKELGPVYKERIGPTTAVFV

NSIHEFRKIFRLEGSTPKHFLPEAWTLYNEIRKCRRGLLFM (2)

NGEEWVYFRKILNKVMLLPDPTNLMIAPCQEVAIELKRKWQKQIKTNNIISNLQVQLYQWSIE (1)

AMMATLMGSYWYSYKHQLSRDFEILAETLHEIFEYSAKLSIIPVKLAMNLRLPVWKKFVASA

DTAFEIVRMLVPEMAKLGGNGLLKKMMDEGIRAEDAICIVTDFILAAGDT (0)

TATTLQWILLLLCNHPEKQEELFKHLKDLSQEDILRLPLLKGIIKESLRLYPIAPFISRYLPEDSVIGNYFVPKG (0)

ELLVLSLYSSGRDAANFPQPNEFRPERWIRTQKGIYQGVVHPHASLPFALGARSCIGRKLAEIQISFALAE (0)

LIKSFKIECINKNQVKLILHLISVPSQSIKLKLMERN*

 

>CYP302A1 N-term Am1.2_Un.8443 incomplete on C-terminus (289-2450) minus, 202 aa, 3 exons

CYP302A1 N-term Am1.1_Un.2216 incomplete on C-terminus (289-2832) minus, 202 aa, 3 exons

45% to CYP302A1 aa19-183 in CYP302 family, mito clan (disembodied)

MCTLLKKCNQSIRKKLFIKFYSNEFTKSKIKINHSQPKAFYDIPGPKSLPIIGTLYKYLPFI (1)

GEYSFTNLYESGKKKLKCFGPLVREEIIPNVNVIWIYRPEDIAEIFKAESGLHPERRSHLALLKYRKDRPNIYNTGGLLPT (2)

NGSEWWRLRKEFQKVSSKPQDVINYLKETDCVIQEFVELCNNEKFADFLPLLSRLFLEC (1)

 

>CYP302A1 C-term Am1.2_Un.2118 incomplete on N-terminus (3101-5209) minus, 250 aa, 4 exons

CYP302A1 C-term Am1.1_Un.3145 incomplete on N-terminus (122-2230) plus, 250 aa, 4 exons

51% to 302A1 (disembodied)

note these two pieces are probably from a single gene missing about 70aa inbetween

(2)IALELVSRKKNNMKIRYNKSFLDAYLENPVLDIKDIVGMACDMLLAGIDT (0)

TSYSTAYILYHLAKNQNIQEKLRIEATQLLKNHNEPISINILRNASYTKAVIKESLRLNPISIGIGRILQTDVVLSGYRVPKG(0)

SVVVTQNQIICRLPEYFEEPNLFIPERWLREYSENNNKINYKKTVHPYVLLPFGHGPRSCIARRFAEQNMQILLLR (0)

ICRRLKISWHGDDLGMISLLINKPNALLKFNFHDILNNNSV*

 

>CYP49A1 ortholog Am1.2_Un.343b (13080-19643) minus, 531 aa, 10 exons

CYP49A1 ortholog Am1.1_Un.423a incomplete on N-terminus and C-terminus of exon 6

(214-3539) plus, 312 aa, 7 exons

AmGroupUn.10899 incomplete on both ends (1221-1394) minus, 58 aa, 1 exon

46% to 49A1, 50% to 301A1 mito clan Combined Am1.1_Un.423a and Am1.1_Un.10899,

MLKIFVIKFLCCRVKMQILNCKFTKLLKNTVKQSNNIIKTLETLTTEVEEQDWSRCRPYSEIPGPKPIPFLGNTWRFIPFI (1)

GDFKIQAVDQVSKKLYKEFGDIVKVEGLLGRPDMVFIYDANEIERIFRQEERMPYRPSMPSLNYYKHVLRKEFFKENAGVIAV (2)

HGESWYNFRSKVQQVMLQPRTARMYITSMEEASLAFLER (2)

IKKIRNKNDEVPDDFLNEIHKWSLE (1)

SIARVALDVRLGCLDDDANIETQQLIDAVTTFFKNVGILELKIPFWKLFNTPTWLKYVNALDTILS (2)

ITSRYTTVALSRTKEAEKSDKEPSLLERVLALENDTKLATILSLDLFLVGIDT (0)

TSSTVASTLYQLALHPDEQDRAYNEVCNILPSKDMQLDGKHLDKLKYLKACIKETLR (2)

MYPVVIGNGRCMTKDTIIKGYRVPKG (0)

VQVVFQHYVISNLDKYFPHSDKFLPERWLQSDGVRHSFASLPFGYGRRMCLGRRFAELEMLVVISK (0)

ILQRYKIEYHHEKLEYYINPMYTPKGSLNLKFIDR*

 

>CYP301A1 ortholog Am1.2_Un.343a (9993-12955) plus, 532 aa, 9 exons (exon 1 is a guess)

CYP301A1 ortholog Am1.1_Un.423b incomplete on N-terminus and missing exon

(3686-6941) minus, 534 aa, 8 exons

69% to 301a1 D. melanogaster

MMTGKTRYLFFKIHFLLLYVLI (2)

CMVDHDTTTIQQGKPYKDIPGPRPIPILGNTWRLFPMIGQYEISDIAKLSQIFYDEYG

KIVRLTGLIGRPDLLFVYDVDEIEKIYRQEGPTPFRPSMPCLVHYKSVVRKDFFGSLPGVVGV (2)

HGEPWREFRTRVQKPILQPQTVRKYITPIEMVTSDFIQR (2)

IQEIKGEDGEVPGDFDNEIHKWALE (1)

CIGRVALDVRLGCLSSNLTSDSEPQKIIDAAKFALRNVAILELKAPYWRYVPTLLWSRYVRNMNYFIE(2)

VCMKYIDATMERLKTKKAVDEYDLSLMERILAKETDPKIAYILALDLILVGIDT (0)

ISMAVCSILYQLATRPEEQEKIYQELVEILPDPSVPLNMSHLDKAIYMKAFIREVFR (2)

VYSTVIGNGRTLQNDTIICGYKVPKG (0)

VQVVFPTVVTGNMEKYVTDAKIFKPMRWLKESTKTLHPFASLPYGHGARMCLGRRFADLEIQVLLAK (0)

LIRSYKLEYHHKPLKYKVTFMYAPDGELKFKVLPR*