530 indica rice P450 sequences
August 12, 2002 D. Nelson

>aaaa01000117.1 (indica cultivar-group) orth of AC092557.2
3669 PGTMGWPVVGETFSFISGFSSPAGILSFMRDRQK
3451 RFGKVFKTYVLGRMTVFMTGREAAKILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGDEH 3272
3271 KKLRRLIGEPLSIDALKKHFDFINDLAVQTLDTWLDRRVLVLEEASSVII 3122
3026 ANMLISLEPEGEEQEKFRANFKIISSSFASLPLKIPGTAFHRGLK 2892
2796 ARNRMYAMLDSVIARRRDGGEVRNDFLQTLLRKHAKDGTAADEDDGGGGGDRDADKLT 2620
2619 DAQLKDNILTLLVAGHDTTTAGLTWLIKFLGENPEALQKL 2500

>aaaa01000147.1 (indica cultivar-group) orth of AC087182.8 $F chr 10 100% 
86B like
MMALPEVQTVELLVAVSIFVAIHSLRQRRSQGLPSWPLVGMLPSLLLGLRGDMYEWLTGV 25899
25898 LASRGGTFTFHGPWLTNLHCVVTSDPRNLEHMLKTKFGSFPKGPYFRDTVRDLLG 25734
25733 DGIFGADDEVWRRQRKAASLEFHSAEFRALTASSLVELVHRRLLRVLGDAEEAGDAVDLQ 25554
25553 DVLLRLTFDNVCMIAFGVDP 25494
16855 VVEDEVFPDGTVLKKGTKVIYAMYTMGRMESIWGEDCREYKPERWLRDGRFMGESAY 16685
16684 KFTAFNGGPRLCLGKDFAYYQMKFAAASILRRYHVRVVDGHPVAPKMALTMYMKHGLKVK 16505
16504 LTKR 16493

>aaaa01000152.1 (indica cultivar-group) CYP727A1 orth of AP003765.1 $F 98% 
2748 MASPCEHHVPYTLLGALLSGGGPHAAACGGAAFLRDYAERGTNALLWAALLAVTWLIVLR 2927
2928 LAALLRLWALGARLPGPPAFPADPGLAAGDITG 3026
4982 YLSKLHGSYGPVVRLWLGPSQLLVSVKDSRVIKELLTKAEDKLPLTGKTYNLACGKLG 5161
5162 LFISSFEK
5342 VKSRRESLKSFLDEKLSVGASGSSFKIIQIVLDRIDSIMARDFLDCRYFSQHMAFNIVG 5521
5522 SALFGDAFFDWSDASAYEELMMTVAKDACFWASYAVPPFWKPDYRRYRTLCAQLKILTQG 5701
5702 IVAKSRNQNGVLSLIDLSSSQRSERMIKDPCRGVSLLDGVISSRCLNEAAEGPLSSEEI 5878
5879 CGNIMGLMLHGISTCANLIGNILTRLALYPNLQCQ 5986
6378 LHSEIVSGHSESSELKIDDVLRMKFLLATVCESARLLPAGPLLQRCSLQQG
6877 DVNLNSSITIPAGAILVIPLHLVQMEASTWGNDACQFNPNRFLKKDINFE 7038
7130 EILAAAHKGSNGINLFTDECDKTESFLPFGSGSRACVGQKFAVLGIAMLIASLLRSYE 7309
7543 VQPHPALSKEMESLVDSNSLHHIPNPKIILKKRSI 7650

>aaaa01000178.1 $FI (indica cultivar-group) 
9077 MAMAAAVLVAIALPVSLALLLVAKAVWVTVSCYYLTPARIRRVLASQGVRGPPPRPLVGN 8898
8897 LRDVSALVAESTAADMASLSHDIVARLLPHYVLWSNTY (1?)
8701 GRRFVYWYGSEPRVCVTEAGMVRELLSSRHAHVTGKSWLQRQGAKHFIGRGLLMANGATW 8522
8521 SHQRHVVAPAFMADRLK (0)
     GRVGHMVECTRQTVR 8342
8341 ALREAVARSGNEVEIGAHMARLAGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYL 8162
8161 WVPGSQ 8144
7592 YFPSKYRREIKRLNGELERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKK 7419
7418 EAGGNGGGEVGYDAQMMIDECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAV 7239
7238 CGGGAPSPDSLPKLAVLQMVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWIP 7059
7058 VLAIHHDEGAWGRDAHEFRPDRFAPGRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVALA 6879
6878 MLLSSFRFAISDEYRHAPVNVLTLRPRHGVPVRLLPLPPPRP 6753

>aaaa01000236.1 (indica cultivar-group) orth of AL606687.1 $F chr 4 100%
34409 VAAVAAYMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMHEWIAANLRRTRGTYQTCIF 34588
34589 AVPGLARRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNSDGETWVA 34768
34769 QRKTAALEFTTRTLRTAMSRWVSRSIHSRLLPILSDAAAAGGGGGGATVDLQDLLLRLTF 34948
34949 DNICGLAFGKDPETLARGLPENDFASAFDRATEATLNRFIFPECVWRFKKWMGLGMETTL 35128
35129 ARSVQHVDRW 35158
9099 SVPEDSKHVVADDVLPDGTFVPAGSSVTYSIYSAGRMKTVWGDDCLEFRPERWLSADGTK 9278
9279 FEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLLRHRLAVAPGHRVEQKMSLTLF 9455
9456 MKHGLRMEVRPR 9491

>aaaa01000238.1a $FI (indica cultivar-group) orth of AP003909.1f 2 diffs
3340 VLIMIIILLLLVLLHYYLSASTRRSSAASKSNDDVLPPSPPRLPVIGHMHLVGSNPHVSL 3161
3160 RDLAEKHAADGFMLLQLGQVRNLVVSSPRAAEAVLRAHDHVFASRPRSAIADILAYGSSN 2981
2980 ISFSPYGDYWRKARKLVAAHLLSPKKVQSLRRGREEEVGIAVAKLHEAAAAGAAVDMREL 2801
2800 LGSFTNDVLCRAVCGKSSFRREGRNKLFMELAAGNADQYAGFNLEDYFPSLAKVDLLRRV 2621
2620 VSADTKKLKEKWDSVLGDIVSEHEKKSSLRRDDQVQMDDDRDDDQEEQESDFVDILLDRQ 2441
2440 QEYNLTRHNIHAILMX 2396
2209 MFAAGTDTSYIALEFAMSELIRKPHLMTKLQDEVRKNTTTKMVSEDDLNNMPYLKAVV 2036
2035 KETLRLHPPVPLLLPRLSMAQCNANGYTIPANTRVIINVWALGRDARCWENSEEFMPERF 1856
1855 MDSGDTIDNVDFKGTDFQFLPFGAGRRICPGMNFGMASVELMLSNLMYCFDWELPVGMDK 1676
1675 DDVDMTDQFALTMARKEKLYLIP 1607
Duplicated end of exon 1
ESDFVDILLDHQQEYNLTRHNIHAILMLITYTLL 945

>aaaa01000238.1b $FI (indica cultivar-group) AP003909.1e 100%
14489 LLPLALLFYFARAAISSRDSKTRELILSKLPSPPFKLPVIGHMHLIGPLPYVSLRDLAA 14313
14312 KHGRDGLMLVRLGSVPTLVVSSPRAAEAVLRTHDLAFASRPRSMVTDIIMYGALDSCFAP 14133
14132 YSDHFRSVKKVVTVHLLNSKRVQAYRHVREEEVRLVMARLRGAAAAAAAVDLSQTLQFFA 13953
13952 NDLICRAVSGKFLCEQGRNKVFRDLMEANSNLLGGFNLEAYFPGLARMPLISKLICARAI 13773
13772 RIRRRWDQLLDMLIDDHVASARDRAKNDDDDFIHVLLSLQDEYGFTRDHIKAISIX 13608
13134 MFEAGTDTSHLVLEYAMVELTRKPHILTKLQDEVRRITPKGQHMVTEDDIVGMVYLKAVI 12955
12954 KETLRLHAPGGFTIPHLAREDCNVDGYMIPAGTRVLINLWALSRDANYWDKPDEFLPERF 12775
12774 MDGSNKNTDFKGQDFQFLPFGSGRRMCPGIHSGKVTLEIMLANLVYCFNWKLPSGMKKE 12598
12597 DIDMTDVFGLAIHRKEKLFLVPQI 12526

>aaaa01000238.1c $FI (indica cultivar-group) AP003909.1d 99%
25643 LLLPVALLLLLLRFARATTLAGDRNSELLLSKLPSPPLRLPVIGHMHLVGSLPHVSLRD 25467
25466 LAAKHGRDGLMLVHLGSVPTLVVSSPRAAEAVLRTHDLAFASRPRAMVPDIISYGATDSC 25287
25286 YGPYGDHFRKVRKAVTVHLLNSHKVQAYRPAREEEVRLVIAKLRGAAAMAGAPVDMTELL 25107
25106 HSFANDLICRAVSGKFFREEGRNKLFRELIDTNASLLGGFNLEDYFPSLARTKLLSKVIC 24927
24926 VRAMRVRRRWDQLLDKLIDDHATRLVRRHDHDQQQDSDFIDILLYHQEEYGFTRDNIKAI 24747
24746 LVX 24741
24592 MFEAGTDTSYLVLESAMVELMRKPHLLAKLKDEVRRVIPKGQEIVNEDNIVDMVYLKAVI 24413
24412 KETLRLHPPAPLYIPHLSREDCSISGYMIPTGIRVFVNAWALGRDAKFWDMPDEFLPERF 24233
24232 MDSNIDFKGHDFHYLPFGSG*RMCPGIHSATVTLEIMLANLMYCFNWKLPAGVKEEDI 24059
24058 DMTEVFGLTVHRKEKLFLVP 23999

>aaaa01000238.1d $FI (indica cultivar-group) AP003909.1f 99%
30181 VLIMIIILLLLVLLHYYLSASTRRSSAASKSNDDVLPPSPPRLPVIGHMHLVGSNPHVSL 30360
30361 RDLAEKHAADGFMLLQLGQVRNLVVSSPRAAEAVLRAHDHVFASRPRSAIADILAYGSSN 30540
30541 ISFSPYGDYWRKARKLVAAHLLSPKKVQSLRRGREEEVGIAVAKLHEAAAAGAAVDMREL 30720
30721 LGSFTNDVLCRAVCGKSSFRREGRNKLFMELAAGNADQYAGFNLEDYFPSLAKVDLLRRV 30900
30901 VSADTKKLKEKWDSVLGDIVSEHEKKSSLRRDDQVQMDDDRDDDQEEQESDFVDILLDRQ 31080
31081 QEYNLTRHNIHAILMX 31137
31312 MFAAGTDTSYIALEFAMSELIRKPHLMTKLQDEVRKNTTTKMVSEDDLNNMPYLKAVV 31485
31486 KETLRLHPPVPLLLPRLSMAQCNANGYTIPANTRVIINVWALGRDARCWENSEEFMPERF 31665
31666 MDSGDTIDNVDFKGTDFQFLPFGAGRRICPGMNFGMASVELMLSNLMYCFDWELPVGMDK 31845
31846 DDVDMTDQFALTMARKEKLYLIP 31914
Duplicated end of exon 1
ESDFVDILLDHQQEYNLTRHNIHAILMLITYTLL 32576

>aaaa01000238.1e $FI (indica cultivar-group) AP003909.1c 99%
40499 PSPVAPQPTMASYYTLLLALLCPLLLLLIKLCRAKTRDDELFDKLPSPPGRLPVIGHL 40326
40325 HLIGSLPYVSFRELAIKHGPDLMLLRLGTVPTLVVSSARAAQAILRTNDHVFASRTYSAV 40146
40145 TDILFYGSSDVAFSPYGEYWRQVKKIATTHLLTNKKVRSYSRARQQEVRLVMARINEAAV 39966
39965 ARTTVDLSELLNWFTNDIVCHAVSGKFFREEGRNQMFWELIQANSLLLSGFNLEDYFPNL 39786
39785 ARVTTVRRLLCAKAHNVNKRWDQLLDKLIDDHATKRSSSVLDLDNEESDFIDVLLSIQHE 39606
39605 YGLTRDNVKAILVIMFEGGTDTAYIELEYAMAELIRKPQLMAKLQAEVRSVVPRGQEIVT 39426
39425 EEQLGRMPYLKAVIKETLRLHLAGPLLVPHLSIAECDIEGYTIPSGTRVFVNAWALSRDP 39246
39245 SFWENAEEFIPERFLNSIAPDYNGNNFHFLPFGSGRRICPGINFAIATIEIMLANLVYRF 39066
39065 DWEIPADQAAKGGIDMTEAFGLTVHRKEKLLLVPRL 38958

>aaaa01000238.1f $FI (indica cultivar-group) AP003909.1a 99%
44400 MAEMLDGLRHDEQASLHAPQKASTMPTMSCSDLLLAMMCPLILLLIIFRCYAYATRSGGM 44221
44220 LSRVPSPPGRLPVIGHMHLISSLPHKSLRDLATKHGPDLMLLHLGAVPTLVVSSARTAQA 44041
44040 ILRTHDRVFASRPYNTIADILLYGATDVAFSPYGDYWRQIKKIVTMNLLTIKKVHSYGQT 43861
43860 RQQEVRLVMAKIVEEAATHMAIDLTELLSCYSNNMVCHAVSGKFFREEGRNQLFKELIEI 43681
43680 NSSLLGGFNLEDYFPSLARLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDN 43501
43500 NDEESDFIDVLLSIQQEYGLTKDNIKANLVVMFEAGTDTSYIELEYAMAELIQKPQLMAK 43321
43320 LQAEVRGVVPKGQEVVTEEQLGRMPYLKAVIKETLRLHPAAPLLVPHVSMVDCNVEGYTI 43141
43140 PSGTRVIVNAWAIARDPSYWENAEEFIPERFLGNTMAGYNGNNFNFLPFGTGRRICPGMN 42961
42960 FAIAAIEVMLASLVYRFDWKLPIDQAANGGIDMTETFGITIHLKEKLLLVPHLP 42799

>aaaa01000238.1g $FI (indica cultivar-group) AP003909.1b 89% with some shifts
46070 MAQMLGALLLFQDSQMSTMTRMSYSLLLPILCPLILLLLFRCYAYATRSGGL 46225
46226 LDKLPSPPGRLPLIGHMHLIGSFPHMSLRDLATKHGPDLMLLHLGTVPTLVVSSSRMAQV 46405
46406 ILRTHDRVFASRQQSAI 46456 gap
46485 YGDYWRQIKKIVTTNLLTIQEDPLL*PDRQQECVCNAKI*EATTHMAV 46628
49427 LYAKAYDVKKRWDQLLDKLIDDHSSKHRSSLLDNNEX 49320
49320 ESDFIDVLLSIQQEYGLTKDNIKANLAIMFEAGTDTSFIELEYAMAELMQKPQMIAKLQA 49141
49140 EVRGVVSKGQEIVTEEHLGRMPYLKAVIKETLRLHPAAPLLAPHVSVVDCNVEGYTTPSG 48961
48960 TRVIVNAWAIARQGP*LLGKC*GVQRFLSNTMADYNGNNFNFLPFWTGRRICPGINFA 48787
48786 ITTIEIMLASLVYRFDWKLFTSRIDMTETFGATIHLKEKLFLVPHLP 48646

>aaaa01000245.1 $FI (indica cultivar-group) 
31056 MAVVAVAVVIALLAAFLTPLAVYLARRASPPPPPRRNLPPGSLGLPLIGQSLSLLRAMRR 30877
30876 NTADRWLQDRIDRYGPVSKLSLFGAPTVLVAGPAANKVVFHHEALAPKQPRSLAAIIGRR 30697
30696 NILELVGDDHRRVRGAILQFLRPDMVRRYVGKIDSEVRRHLAARWAGRRTVAVFPLMKTL 30517
30516 AFDVIATLLFGLDRGAIREQLADAFDGMHEGLWTVPVDLPFTPFRRGLMASARARRLVEA 30337
30336 TVREKAAKLEHGESSPSDDLISCLLSLRDGGRQLLTEEEIVDNSVLALVAGHDTSAVLLT 30157
30156 FMLRHLANDPATLAAM
30022 HEEIARGKRDGEALTWEDVAKMKLSWRVAQETLRMVPPVLGSFRRAPVDVEFEGYTIPRG 29843
29842 WQIFWSPSVTHMDPAIFHEPTKFEPSRFDGTAAAAAYSFVPFGGGPRICPGMELARVETL 29663
29662 VTAHYLVRHFRWKLCLGEEKNTFLRDPMPTPHDGLPVELDHIAPLC 29525

>aaaa01000275.1 (indica cultivar-group) orth AC087550.2 $F chr 10, 100%
42347 LTVLSVSVLIAVVISKLVSYATKPRLNLPPGPWKLPVIGSLHHLVGSHAIHRSMRALAE 42171
42170 KHGRHHLMQISLGEVFAVVVSSPEAAEEILR 42078

>aaaa01000381.1a $FI (indica cultivar-group) 
67% to AP003850.1 chromosome 7 36% to 716A2
18271 MEFSLVVALIAVASSCVFVHFLARGATKKRRSPAAKKLPPGSLGLPVIGQSLGLLRA 18101
18100 MRSNSGERWVRRRIDRYGAVSKLSLFGKPTVLVAGAAANRFVFFSGALALQQPR 17939
17938 SVQRILGDRSILDLVGADHRRVRGALSEFLRPEMLRMYVGKIDGEARRHVAGCWSG 17771
17770 RAAVTVMPLMKRLTFDIIASLLFGLGPGAAARDALAGDFERV 17645
17644 MGGMWAVPVDLPFTAFRRSLRAAARARRLLAGITRERKAALERGAATRSSDLIACLLSLT 17465
17464 DDRGGAPLLSEEEIVDTAMVALVAGHDTSSILMTFMVRHLANDPDTLAAM (0)
      HEEIARSKRDGEALTWEDLTRMKLTWRVAQETLRMVPPV 17105
17104 FGNFRRALEDIELDGYVIPKGWQVFWVASVTHMDAAIFHDPDKFLPSRFDSQSSSPSTA 16928
16927 KAAPPCSYVAFGGGPRICPGIEFARIETLVMMHHLVRKFRWKLCCKEDT 16781
16780 FARDPMPTPLHGLPIEIEPRISP* 16709

>aaaa01000381.1b $FI (indica cultivar-group) 
22925 MSMDSSMPFALLLALFIPILLHLVTRHKYSSYNLPPGSLGFPLIGQSISLLRALRSNTDYQWYQDR 23122
23123 IKKYGPVSKMSVFGSPTVLMAGPASNHFVFSNQDLIFTQTKAINVLIGRSIMTLSGDEL 23299
23300 KQVRSALQGYLSPEMVTKYVWKMDEEVRRHIDLNWVGHKTIK
23553 VAPLAKRLTFNIISSVMFGQGAAPFREALAIDFEKVVRAALSIPVNIPFTKFNKGLSASR 23732
23733 RIRKLLRQIAHEREAAFQQGYCSSADDFFTYMLALRSEGKHSLTVEDIVDNAILLLIAGY 23912
23913 EMSSVLITFLIRQLANEPDIL 23975 gc boundary
24077 EQEEIARNKGPNKPLTWNDVSRMKYTWKVAMETLRTVPALLGSFRTATKDIEYRGYHIP 24253
24254 KGWQ 24265
24577 IFTAQIVTHLDAIFFDEPSKFDPSRFDNLSSIPPYCFVPFGGGPRMCPGNEFARTETSV 24753
24754 AMHYLVRQLRWKLCCKEEGYRKDATPMPVLGLPIELETRSAP* 24882

>aaaa01000393.1 $FI (indica cultivar-group) 89% to AP005114.1b
9756 MEDKLILALCLSALFVVVLSKLVSSAVKPRLNLPPGPWTLPLIGSLHHLAMTKSPQTHRSLRALS 9562
9561 EKHGPIMQLWMGEVPAVVVSSPAVAEEVLKNQDLRFADRHLTATTEEIFFGGRDVIFGP 9385
9384 YGERWRHLRKICMQELLTAARVRSFRGVREGEVARLVRELAASAAGAGAGAVGAAAGVNL 9205
9204 NERISKLANDIVMVSSVGGRCSHRDEFMEALEVAKKQITWLSVADLFPSSKLARMVAVAP 9025
9024 RKGLASRKRMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVP 8848
8847 VTDEIIVVLLF (0) 88315
4681 DMISGASETSPTVLIWTLAELMRNPRIMAKAQAEVRQAVAGKTTITEDDIVG 4526
4525 LSYLKMVIKETLRLHPPAPLLNPRKCRETSQVMGYDIPKGTSVFVNMWAICRDSRYWEDP 4346
4345 EEYKPERFENNSVDYKGNNFEFLPFGSGRRICPGINLGVANLELPLASLLYHFDWKLPNG 4166
4165 MAPKDLDMHETSGMVAAKLITLNICPITHIAPSSA* 4058

>aaaa01000394.1 (indica cultivar-group) 
13114 MDMDSSPSTQDCGGWLLYVSLAAKCGGDPCRVVGFVAVAVVAFAVTSLLHWLSPGGPAWG 13293
13294 RYWWNRRGGLGIAAAIPGPRGLPVLGSMSLMAGLAHRKLAAAAGGSPARRRLMALSLGET 13473
13474 RVVVTADPGVARELLASAAFADRPVKESAYGMLFHRAIGFAPYGTYWRALRRVASTHLFS 13653
13654 PRQVSASAAQRAVIARQMVEAMRSAAAAAAGGGVAARPFLKRASLHNVMWSVFGRKYELA 13833
13834 APESEETAELRSMVDEGYDLLGQLNWSDHLPWLAPFDLQKTRSRCSSLVPRVNRFVTRII 14013
14014 DEHRARLSLAVDA 14052 small 16aa seq gap
14189 LHGGDXLSDADXVAVLWVCT 14212
14307 EMIFRGTDTVAVLIEWVAARLVLHQDVQARVHDELDRVVGSDRAVTESDASKLVYLQ 14477
14478 AVIKEVLRLHPPGPLLSWARLATSDVHVGGFLIPSGTTAMVNMWAITHDPAVWPDPNEFK 14657
14658 PERFVAGPSSDQAAEFPIMGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLHEFDWLP 14837
14838 LSDKSRGVDLSEVLKLSCEMATPLEARLRPRRKV 14939

>aaaa01000436.1a (indica cultivar-group) ortholog of AQ576451
998  EEHTTILNKRGSLNSGFTWEEYKSLMFTSQ (0) 1087
1188 VVNEITRISNVAPGIFRRTLADVKVN 1265 (1)
1367 GYTIPAGWLVMISPMAVHLNPTLFEDPLEFNPWRWT (0) 1474
1595 DKTKQSELLRNYMPFGGGIRLCLGAEFSKLFIAIFIHVLVTEYR 1726 (2)
1814 WKEIKGGDVLRISEVIFPQGYHIQLIPHT* 1903

>aaaa01000436.1b (indica cultivar-group) 75% to AL607001.1 gene 2
24089 RYGPIFKTSLVGQPLVISLDPEVNRFVFQQEGKLFRSWYPETTNTIFGKKSLITYSGAVH 24268
24269 KFVRSFVSKLFGPANLKELLLPELERAVRESFATWAMNPSIEVKDGISN 24415
24666 MIFDLVAKKLIGFKPTKSRELRKNFQEFFHGMVSFPIYFPGTSFYRCMQ 24812
24970 GRRNVQKTLTDLLKERLSAPGEKYNDLIDQIIEELQSENPVIDVNFAIDVLSA 25128
25129 LLFASFAT 25152

>aaaa01000478.1a (indica cultivar-group) ortholog of AL607001.1 gene 2
31320 YAALCGVTLIIGWLAHWIYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYK 31141
31140 QRLERYGPLFKTS 30961
30960 LVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKFIRGVAAK 30781
30780 LFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSD
      MIFDLVAKKLIGLDVTNSRELRKNFQD 30367
30366 FFQGMVSFPIYFPGTSFYRSMQ
      GRRNVRNTLTDIMKERLSAPGKKYGDLVDLIVEELQSEKPM 28686
28685 IDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELK
      EEHGTILKKREGVNSGFTWEEYRSLKFSTQ
      VMNEITRISNVTPGVFRKTLTDVQ
28087 YSGYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRW 27977

>aaaa01000478.1b (indica cultivar-group) ortholog of AL607001.1 gene 1
39957 LVLLLRHQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLA
39713 RYGPIFKTSLVGHPVVVSADEELNHMVFQQEGQLFQSWYPDSFVEILGKDNVGEQQGAMF 39534
39533 RYLKNMVLRYFGPESLKEGIIRDVERAVSSSLCTWSTLPAVELKEAVST
      MVFDLAASKLLGLEPSRSKILRKSFFDFVRGLISFPLYLPGTAYYSCMQ
39058 QGRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF 38879
38878 VLLFASFHTTSLALTLAVKLLADHPLVLEELT 38783
      VEHETILKDREAGSELDRITWKEYKSMAFTSQ 38589
35958 YTIPAGWGVMVCPPAVHLNPYIYPDPLTFIP 35866
32561 EINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYR 32683

>aaaa01000493.1a (indica cultivar-group) 3 pseudogene fragments
100% to AP005254.1c with a deletion in the Ihelix
3400 ADASTKKHGDFLDSLLELMSAGKIACDDVTTVMFDAFGA 3516 frameshift
3515 LLRNPSIMAKVRAEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHRA 3688
3689 AEDGVEIGGYAVPKGSTVIFNVWTIMRDPAAWERPEEFMPERFLQRAEVDFRGKDFEFI 3865
3866 PFGAGRRLCPGLPMTERVVPFILASLLHAFEWRLPVGVAAETLDLSEKFTTVNVLVTPLK 4045
4046 AIPILAS 4066

>aaaa01000493.1b (indica cultivar-group) 3 pseudogene fragments
1 aa diff with AP005254.1d but shorter
9051 EKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLD 8941 frameshift
8939 SLLDLMSAGKIARDDVTSIMFDLFGAGTDTIAITVEWAMAELLRNPSVMTKARAEMNHAL 8760
8759 AGKKTIEENDVEKLPYLQAVLREAMRLHPAAPILVPHRAEEDGAEIGGYAVPKGSTVIFN 8580
8579 VWAIMRDPAAWERPEEFMPERFMDMAEEVDFRGKDYKFIPFGAGRRLCPGLLMAERVVPF 8400
8399 ILASLLHSFEWRLPGGMTAESLDLSEKFTTVNVLVTPLKAIPILASKNENIRE 8241

>aaaa01000493.1c (indica cultivar-group) 3 pseudogene fragments
100% to AP005254.1d but shorter
26182 LRRLDLQGWRRWAEKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGK 26361
26362 IARDDVTSIMFDLFGAGTDTIAITVEWAMAELLRNPSVMTKARAEMNHALAGKKTIEEND 26541
26542 VEKLPYLQAVLREAMRLHPAAPILVPHRAEEDGAEI 26649

>aaaa01000559.1 $FI (indica cultivar-group) 98% to AP003434.1a 
22050 MELSSSLAAVLHSPLFLLAALLLLPVFTLLSFSSAKKPGDGGGRRLPLPPSPRGVPFLGH 21871
21870 LPLLGSLPHRKLRSMAEAHGPVMLLWFGRVPTVVASSAAAAQEAMRARDAAFASRARVSM 21691
21690 AERLIYGRDMVFAPYGEFWRQARRVSVLHLLSPRRIASFRGVREQEVAALLDRVRRRCGV 21511
21510 RGGGETVNLSDMLMSYANGVISRAAFGDGAYGLDGDEGGGKLRELFANFEALLGTATVGE 21331
21330 FVPWLAWVDKLMGLDAKAARISAELDGLLERVIADHRERRRLSQPDGGDGDGDGDENVDH 21151
21150 RDFVDVLLDVSEVEEGAGAGEVLLFDAVAIKAIIL 21046
20444 DMIAAATDTTFTTLEWAMAELINHPPVMRKLQCEIRAAVGVPGASGGAEVTEDHLGELRL 20265
20264 LRAVVKETLRLHAPVPLLVPRETVEDTELLGYRVPARTRVIINVWAIGRPXAAWGDRAEE 20085
20084 FVPERWLDGGGGGEAVEYAAQLGQDFRFVPFGAGRRGCPGAGFAAPSIELALTNLL 19917
      YHFDWELPPHADGAAAATAARLDMGELFGLSMRMKTTLNLVAKPWSSDV 19769

>aaaa01000575.1 $FI (indica cultivar-group) 74% to AP003523.1
31724 MDMEMGKLLHRPWKWSLNSPLL
31558 LLLIVPVMIHVQLKLRRRRKNAAAGTRLPPGPWRLPVIGSLHHLAMNPKAVHRALADLAR 31379
31378 RCGGGGGVMYLRLGELPVVVASSRDAAREVLRTHDAAFATRAMSVTVRDSIGDTVGILF 31202
31201 SPYGERWRRLRGICSLELLNARRVRSFRPIREEQVARLVGAIAAAAAAPGGDQPPPVNVS 31022
31021 WQIAGALTDLTLRAIMGECGFRWREEFLETLGEAQRKASRFGVADLFPSSRLLRAVGSTA 30842
30841 VRDVRALNAKLFELVDRAIEQHREAAATTAAGGDHDDGGDDDARDDNECLLNTLMRIQKE 30662
30661 GGGTLSMSTVKAVIL (0) 30617
28748 DMFAGGSETTSTILEWAMSELVKNPQVMQKAQAQIRLALQGRSRITEDDLINLSY 28584
28583 PKNIIKETLRLHPVAPLLGXKECQESCKILGYNIPKGSIMLVNVWAIGRDHRYWDDAEVF 28404
28403 LPERFEEITVDFGGTNYEFIPFGGGRRICPGITFAHATLEWALTALLYHFDWHLPPSVTP 28224
28223 DGLDMEEEFGMNVRRKRDLHLHPVIHVGVEKGIMS* 28116

>aaaa01000680.1a (indica cultivar-group) 100% to AP003735.2b Cterm
16582 VHYLHAAISEAMRLYPPVPIDSRVAVAADALPDGTAVRAGWFADYSAYAMGRMPQLWGED 16403
16402 CREFRPERWLSDGGEFVAVDAARYPVFHAGPRACLGREMAYVQMKAVAAAVIRRFA 16235
16234 VEPVQAPASMETPPACEVTTTLKMKGGLLVRIRKR 16130

>aaaa01000680.1b (indica cultivar-group) 99% to AP003735.2a
30994 MYMQMDSSYLHLVLPAAAAAVVVAVVLLLSLWRRCQTTSNHRPQANPILGNLVAFLANGH 31173
31174 RFLDWSTGLLAAAPASTMQVHGPLGLGYCGVATASPDAVEHMLRASFHNYVDKGDRVRDA 31353
31354 FADLLGDGLFLANGRLWRLQRKLAASSFSPRLLRLFAGRVVLDQLRRRLLLFFDAAADAR 31533
31534 RVFDLQDVLKRFAFDNICSVAFGVDRDDSSPSSSSPSRLEAGGDGRDDAFFAAFDDAIDI 31713
31714 SFGRILHPTTLAWKAMKLLDVG
31781 RLRQAIGVVDEYVTAIMESKRRCSDSEEESDLLSRFTAAMMEEDGGNELGAMFDSPEAKR 31960
31961 RFLRDTVKTFVLAGKDTTSSALTWLFWFLAANPECERRVYEEVTALRGDTAGDERDDGYE 32140
32141 DLKRMHYLHAAITETMRLYPPVPLASRVAA 32230
      DVLPDGTVVRAGWFADYSSYAMGRMPQLWERDCGEFR 32340
32341 PERWLDGGGGGGRFVAVDAARYPVFHAGPRSCLGKEMAYVQMKAVAAAVVRRFSVEVVP 32517
32518 AAAANAPPSPPPHETAVTLRMKGGLRVLLTRRRGVLSHA 32634

>aaaa01000680.1c (indica cultivar-group) 99% to AP003735.2b
34356 YMVMDGTLAPLLLLLLLFLPALLLYLRRRPAAASRINNNHCPHPNPVLGNALPFLR 34523
34524 NRHRFLDWATDLLAAAPTSTIEVRGALGLGSGVATANPAVVDHFLRASFPNYVKGARF 34697
34698 AVPFEDLLGRGLFAADGRLWALQRKLASYSFSSRSLRRFSARVLRAHLHRRLVPLLDAVA 34877
34878 GSGEAVDLQDVLGRFGFDNICNVAFGVESSTLLEGGDRRHEAFFAAFDAA 35027
35028 VEISVARVFHPTTLVWRAMRLANVGSERRMRDAIRVIDEYVMAIVASEERLRLRRGEDER 35207
35208 EHEQHLLSRFAASMEEEGGELAAMFGSPGAKRRFLRDVVVSFVMAGKDSTSSGLTWLF 35381
35382 WLLAANPRCERRVHEEVSSSRHADPRRADAGEDGDGDGYDELRRMHYLHAAISEAMRLYP 35561
35562 PVPIDSRVAVAADALPDGTAVRAGWFADYSAYAMGRMPQLWGEDCREFRPERWLSD 35729
35730 GGEFVAVDAARYPVFHAGPRACLGREMAYVQMKAVAAAVIRRFAVEPVQAPASMETPP 35903
35904 ACEVTTTLKMKGGLLVRIRKR 35966

>aaaa01000680.1d (indica cultivar-group) 100% to AP003735.2b Cterm
36027 AISEAMRLYPPVPIDSRVAVAADALPDGTAVRAGWFADYSAYAMGRMPQLWGEDCREFRP 36206
36207 ERWLSDGGEFVAVDAARYPVFHAGPRACLGREMAYVQMKAVAAAVIRRFAVEPVQA 36374
36375 PASMETPPACEVTTTLKMKGGLLVRIRKR 36461

>aaaa01000680.1e (indica cultivar-group) 100% to AP003735.2b Cterm
36527 AISEAMRLYPPVPIDSRVAVAADALPDGTAVRAGWFADYSAYAMGRMPQLWGEDCREFRP 36706
36707 ERWLSDGGEFVAVDAARYPVFHAGPRACLGREMAYVQMKAVAAAVIRRFAVEPVQA 36874
36875 PASMETPPACEVTTTLKMKGGLLVRIRKR 36961

>aaaa01000733.1 $FI (indica cultivar-group) 99% to AC092559.2
5765 MATLLSKLLALPQQWQLLLLLLLLPIASLLLVIGRNTGGRRRRRHLRLPPGPARLPVLGN 5586
5585 LLQLGALPHRSLRDLARRHGPVMMLRLGAVPAVVVSSPEAAQEVLRTHDADCCSRPSSPG 5406
5405 PMRLSYGYKDVAFAPYDAYSRAARRLFVAELFSAPRVQAAWRARQDQ 5265
3896 VEKLIGKLTRPEPEPVELNDHIFALTDGIIGAVAFGSIYGTERFAGGGRKRFHHLLDDV 3720
3719 MDMLASFSAEDFFPNAAAARLFDHLTGLVARRERVFQQLDAFFEMVIEQHLDSDSSNAGG 3540
3539 GGGNLVGALIGLWKQGKQYGDRRFTRENVKAIIF 3438
3337 DAFIGGIGTSSVTILWAMAELMRSPRVMRKVQAEIRATVGDRDGGGMVQPDDLPRLAYLK 3158
3157 MVVKETLRLHPPATLLMPRETMRDVRIGGYEVAARTRVMVNAWAIGRDAARWEEAEVFDP 2978
2977 DRFEAKRVEFNGGHFELLPFGSGRRICPGIAMAAANVEFTLANLLHCFDWALPVGMAPEE 2798
2797 LSMEESGGLVFHRKAPLVLVPTRYIQL 2717

>aaaa01000805.1a partial (indica cultivar-group) 100% to AC087544.2 
4553 MEDKLLLLLALAVSVLVAVVISKLVSYATKPRLNLPPGPWTLPVIGSIHHLVGSHPIHRS 4374
4373 MRALAEKHGRDLMQVWLGELPAVVVSSPEAARDVLRSQDLAFADRYVSTTIAAIYLGGRD 4194
4193 LAFAPYGERWRQLRKLCTQRLLTAARVRSFRCVREEEVARLVRDLAASAAAGEAVDLTAR 4014
4013 VAELVNDVVVRCCIGGRRSRYRDEFLDALRTALDQTTWLTVADVFPSSKLARMLGTAPRK 3834
3833 ALASRKKMERILEQIIQERKQIKERSTGAGAGADDEAAAAGNECFLDVLLRLQKEGDTPI 3654
3653 PITNETMMLLLH 3618 sequence gap

>aaaa01000805.1b partial (indica cultivar-group) 100% to AC087544.2 
duplicate of first 46 aa
18349 MEDKLLLLLALAVSVLVAVVISKLVSYATKPRLNLPPGPWTLPVIG 18212

>aaaa01000831.1 extra Nterm seq
12751 MQQQVTEFASAGSDTHAERKQSELTAAEMGHELWVLW 12861

>aaaa01000843.1 $FI (indica cultivar-group) 63% to AAAA01005635.1 37% to 71B2
21357 MDELSIENHSPISMDELSFG
21297 SLCLVAMATLALALALMVVMGAHRRGGEKGATTGAKNLPPGPWNLPVTGSLHHLLGASP 21121
21120 PPHRALLRLSRRHGPLMLVRLGEVPTVIVSGSDAAMEGWVLKAHDPAFADRARSTTVDAV 20941
20940 SFGGKGIIFAPYGEHWRQARRVCLAELLSARQVRRLESIRQEEVSRLVGSIAGSSNA 20770
20769 AAVDMTRALAALTNDVIARAVFGGKCARQEEYLRELGVLTALVAGFSMADLFPSSRV 20599
20598 VRWLSRRTERRLRRSHAQMARIVGSIIEERKEKKASDDGVGAKDEDDDLLGVLLRLQEED 20419
20418 SLTSPLTAEVIGALVI (0) 20371
17791 DIFGAATDTTASTLEWVMVELMRNPRAMEKAQQEVRNTLGHEKGKLIGTDISELHYLRMV 17612
17611 IKETLRLHPSSALILRQS (fs) 17558
17558 QGNCRVMGYDIPQATPVLINTFAVARDAKYWDNAEEFKPERFENSGADIRTSTAHLGFVP 17379
17378 FGAGCRQCPGALFATTTLELILANLLYHFDWALPDGVSPESLDMSEVMGITLHRSSSLHL 17199
17198 HATLSRLGFVSHSGQ* 17151

>aaaa01000851.1 (indica cultivar-group) 84% to AC074282.1 $P
29253 LIEVKKWLNVGTEYCLRKAITDVHAFAMDIVRARHQSSSVQDRDDVLSRFAASDEHND 29080
29079 EVLRDIVLSFLIAGRETTSSGLSWFFWLLSSQPDVMACITNEVRVVRKATGT 28924
28923 CPDEPFGFD 28897
28865 DDTLPDGTLVHADWFVTYNAYAMGRLAAIWGEDCLEYRPERWLSEDG 28725

>aaaa01000893.1 (indica cultivar-group) Nterm 49% to AP003434.1
33765 MSSYVVVAAALLVFVVVVVAAIKNLGKGKLPPSPPSLPFVGHLHLVGELPH 33917
33918 RSLDALHRRYGSDGGLMFLRLGRAGALVVSTAAAAADLYRGHDLAFASRPPSHSAERLFY 34097
34098 GGRNMSFAPLGDAWRRTKKLAVAHLLSPRRARPRRRGR 34211

>aaaa01000919.1 (indica cultivar-group) orth of AC073556.1 $F 100% CYP86
4049 RNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTVDMPFTSYTYI 4201
4202 ADPVNVEHVLKTNFTNYPK 4258
4344 GEVYRSYMDVLLGDGIFNADGEMWRKQRKTASFEFASKNLRDFSTVVFREYSLKLSSI 4520
4521 LSQACKAGRVVDMQ 4562
4648 ELFMRMTLDSICKVGFGVEIGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKK 4821
4822 FLHVGSEALLEQSMKLVDDFTYSVIRRRK 4908
5076 DILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIAGRDTTATTLSWFTYMAMTHPAVA 5255
5256 DKLRRELAAFEAERAREEGVALADAAGEASFAARVAQFASLLSYDAVGKLVYLHACVTET 5435
5436 LRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGPDAASFRPERWLS 5615
5616 GDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYTFDLVEDHPVKYR 5789
5790 MMTILSMAHGLKV 5828

note all six genes on AAAA01000965 are nearly identical.  They are broken
with parts of genes going in opposite directions as in b and c.

>aaaa01000965.1a $PI 94E1(P) (indica cultivar-group) 1-420 fs 421-470 (minus strand)
one fs, runs off end
1413 MDTYYYSMLFVLPPILYMSYHLTRILADKKKPTTHGLKAHPLLGHLPAFVNNSHRFLDWT 1234
1233 TELIVGSPEMRMGFWIPGMRTGIITGNPADVEHILRTNFANYPKGEHAIGMLEDFLGHGL 1054
1053 FNSDGEQWLWQRKNASYEFSNRSLRRFVVDVVQAEIADRFLPLLRRAAGDGGGDGDVVVL 874
 873 DLQEVLQRFGFDTICMVAFGHDPRCLADGGVMEDARSEFMHTFGEAQDLVVGRFFDPIEV 694
 693 SWKIKKWLNVGTERRLRKAIADVHAFAMDIVRARRQSASVNDRDDVLSRFVASDEHSDEV 514
 513 LRDIVLSFLIAGRETTASGLSWFFWLLSSRPDVAARIADEVRAVREATGTRPGEPFRFDA 334
 333 LREMHYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSVTYSAYAMGRLAAIS (fs) 154
 152 GEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQMKSI 3

>aaaa01000965.1b $PI 94E2(P) (indica cultivar-group) 370517 (minus strand)
15180 ALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRP 15001
15000 ERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQMKSIVANVLEEFEVDVVKEIAGG 14821
14820 GVPEHVLSVTLRMKGGLPVKIRRKTEAY* 14734

>aaaa01000965.1c $PI 94E3(P) (indica cultivar-group) 192517 (plus strand)
15203 DTICMVAFGHDPRCLADGGVMEDARSEYMNTFGEAQDLVVGRFFDPIEVSWKIKKWLNVG 15382
15383 TEHRLRKAIAEVHAFAMDIVRTRRQSASVQDRDDVLSRFVASDEHSDEVLRDIVLSFLIA 15562
15563 GRETTASGLSWFFWFLSSRPDVAARIADEVRAVREATGTRPGEPFGFDALREMNYLHAAL 15742
15743 TESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRPER 15922
15923 WLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQMKSIVANVLEEFEVDVVKEIAGGGV 16102
16103 PEHVLSVTLRMKGGLPVKIRRKTEAY* 16183

>aaaa01000965.1d $PI 94E4(P) (indica cultivar-group) 44% to 94B4 (new subfamily?)
one frameshift, might be a pseudogene
25108 MEFYAYSMLLILPLILYMSYHLTRTLAEK 25022 (fs)
25017 KKPTTHGLKAHPLLGHLPAFVNNSHRFLDWTTELIVGSPEMRMGFWIPGMRTGIITGNP 24841
24840 ADVEHILRTNFANYPKGEHAIGMLEDFLGHGLFNSDGEQWLWQRKNASYEFSNRSLRRFV 24661
24660 VDVVQAEIADRFLPLLRRAAGDGGGDGDVVVLDLQEVLQRFGFDTICMVAFGHDPRCLAD 24481
24480 GGVMEDARSEFMHTFGEAQDLVVXRFFDPIEVSWKIKKWLNVGTERRLRKAIADVHAFAM 24301
24300 DIVRARRQSASVNDRDDVLSRFVASDEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLS 24121
24120 SRPDVAARIADEVRAVREATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSC 23941
23940 AADDTLPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFT 23761
23760 VFHAGPRMCLGKEMAYVQMKSIVANVLEEFEVDVVKEVAGGGVPEHVLSVTLRMKGGLPV 23581
23580 KIRRKNLFRGW* 23545

>aaaa01000965.1e $PI 94E5(P) (indica cultivar-group) 271513 plus strand
25463 VRARRQSASVNDRDDVLSRFVASDEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSR 25642
25643 PDVAARIADEVRAVREATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSCAA 25822
25823 DDTLPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVF 26002
26003 HAGPRMCLGKEMAYVQMKSIVANVLEEFEVDVVKEVAGGGVPEHVLSVTLRMKGGLPVKI 26182
26183 RRKRVNLFRGW* 26218 

>aaaa01000965.1f $PI 94E6(P) (indica cultivar-group) 54% to AP003232.1 15517 
one fs, runs off end FS is in same place as seq 1d probably both are pseudogenes
33366 ILYMSYHLTRTLAEK (fs)
33309 KKPTTHGLKAHPLLGHLPAFVNNSHRFLDWTTELIVGSPEMRMGFWIPGMRTGIITGNP 33133
33132 ADVEHILRTNFANYPKGEHAIGMLEDFLGHGLFNSDGEQWLWQRKNASYEFSNRSLRRFV 32953
32952 VDVVQAEIADRFLPLLRRAAGDGGGDGDVVVLDLQEVLQRFGFDTICMVAFGHDPRCLAD 32773
32772 GGVMEDARSEFMHTFGEAQDLVVXRFFDPIEVSWKIKKWLNVGTERRLRKAIA
      DVHAFAMDIVRARRQSASVNDRDDVLSRFVAS 32518
32517 DEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSRPDVAARIADEVRAVRE 32359
32358 ATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSV 32179
32178 TYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQ 31999
31998 MKSIVANVLEEFEVDVVKEVAGGGVPEHVLSVTLRMKGGLPVKIRRKTEAY* 31843

>aaaa01001005.1 (indica cultivar-group) ortholog of AL606588.1 
23647 ALVILLALLLTLVLSHFLPLLLNPKAPKGSFGWPLLGETLRFLSPHASNTLGSFLE 23480
23479 DHCS
23110 RYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSSMLVVLGEDH 22931
22930 KRLRNLALALVTSTKLK 22880
22527 FSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKAVQ 22381
22264 ARARISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGY 22100
22099 ETTSLLISMVVYFLGQSAQDLELVKVYRLLMLKKTE
21919 EHEGIRSKKEKDEFLSSEDYKKMEYT 21842
20699 SKKFTPFGGGPRLCPGSELAKVEAAFFLHHLVLNYR 20592

>aaaa01001026.1a $PI (indica cultivar-group) 3 defects, probable pseudogene
75% to AP003523.1
     MAEVVQLHHLILLLPLFILPSSSSVR (fs)
3368 RRRGACGRLPPSPWALPVIGHLHHLAGALPHRAMRDIARRHGPLVLLRLGELPVVVIASS 3189
3188 ADAARNVMKTHDLAFATRPITHMMRLVFPEGSEGIIFSPYGETWRQLRKICTVELLSARR 3009
3008 VNSFRSVREEEVNRLLRAVAAAAASATSPAKMVNLSELMSAYAADSSVRAMIGRRCKDRD 2829
2828 KFLEMLERGIKLFVTPSLPDLYPSSRLAMVVSRMPRRMRRHREEVFAFLDAIIAEHQENR 2649
2648 ASGEDEEDLLDVLLRIQREGCMEST (fs) 2580
2572 PLLSTESIRTTIG bad boundary 0 expected 2540 
1662 DLFNGGSETTATTLQWIMAELMRNPRVMQKAQDEVQRVFIGQHKVTEENLSNLSYMYLVI 1483
1482 KEALRLHPPGPPLLPRECRTTCQVLGFDVPKGTIVLVNMWAINRDPKYWDQSKEFIPERF 1303
1302 EHVDINFKGMNFEYMPFGAGRRMCPGMAFGLVNLELVLASLLYHFDWKLSDKIKVGDLDM 1123
1122 TEERGATTRRLHDLLLVPVIRVPLPLDSRS* 1030

>aaaa01001026.1b $PI (indica cultivar-group) Pseudogene of AP003523.1e
      MAGFPVYL (deletion and fs) LAA (fs) LIILPMANLIRSARHRRLAGAR (fs)
16438 PPPGPWALPVIGHLHHLAGKLPHHHKLRDLAARHGPLMLLRFGELPVVVASSAGAAREITK 16620
16621 THDLAFATRPVTRTARLTLPEGAEGIIFAPYGDGWRQLRKICTLELLSARRVQSFRAVRE 16800
16801 EEVRRLLLAVASPSPEGTTATASVVNLSRMISSCVADSSV RAIIGSGRFKDRETFLRLME 16980
16981 RGIKLFSGPSLPDLFPSSRLAMLVSRVPGRMRRQRKEMMEFMDTIIEEHQAAREASM 17151
17152 ELEKEDLVDVLLRVQRDGSLQFSLTTDNIKAAIA (0) 17253
this segment is homologous to 108 aa region before the sequence gap at 17972
gene may not be assembled correctly
RAMIGSRFKDRN*FLAMLERGIKLFVTPSLPDLYPSSRLAMVVSRMPRRMRRHREEVFAFLDAIIAEHQENRASGEDEEDLLDVLLRIQREGCMESTVSTESIRTTIG (0) 
      missing Ihelix exon 
19112 YLHLVIKETLRLHPPAPLLLARECREPCQILGFDVPKGAMVLINAWSIGRDPSNWHAPKK 19291
19292 FMPERFEQNNIDFKRTSFKYIPFGAGRRICPGMTFGLANIELLLASLLYHFDWELPHGMQ 19471
19472 AGDLDMTETLAVTARRKADLLVVPVVRVPIVG* 19570

>aaaa01001026.1c $FI (indica cultivar-group) Cterminal differs from AAAA01001026.1b
20983 MAAAASSVLAYLLVVALLAIVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGAL 21162
21163 PHVAMRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPE 21342
21343 GGEGIIFAPYGDRWRELRKICTVELLSARRVQSFRPVREEEAGRLLRAVAAASSPSPAQ 21519
21520 AAVNLSALLSAYAADSAV RAIIGSRFKDRDKYLMLLERGLKLFARHTLPDLYPSSRLAMW 21699
21700 LSRMPRRMMQHRREAYAFTDAIIREHQENRAAGAGDDKEDLLDVLLRIQREGDLQF 21867
21868 PLSTERIKTTVG (0) 21903
22325 DMFAGGSETAGTALQWIMAELIRNPRVMHKVQDEVRQTLAGRDRVTEDAISNLNYMHL 22498
22499 VIKEVLRLHPPVPLLLPRECRNTCQVLGFDVPKGAMVLVNAWAISRDPQYWDEPEEFIPE 22678
22679 RFEDSNIDFKGTNFEYTPFGAGRRMCPGIAFGLANVELMLASLLYHFDWQLPDGMDTADL 22858
22859 DMTEEMVVSARRLPTAP* 22913

>aaaa01001026.1d $FI (indica cultivar-group) 
28790 MAAFLVYVLVLVPLAVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGALPHVA 28966
28967 MRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPEGGEG 29146
29147 IIFAPYGDRWRELRKICTVELLSARRVQSFRPVREEEAGRLLRAVAAASPGQAVN 29311
29312 LSELLSAHAADSSVRAIMGDRFRDRDAFLAMLERGLKLFAKPALPDLYPSSRLAMLLSRM 29491
29492 PRRMKQHHRDMVAFLDAIIQEHQENRSAAGDDDDNDLLDVLLRIQREGDLQFPLSS 29659
29660 ESIKATIG (0) 29683
29867 DMLVGGSETAATTLHWIMAELVRNPKVMQKAQDEIRRELIGHRKVTEDTLCRLNYMHMVI 30046
30047 KEALRLHPPGSLLLPRECRRTCQVLGYDIPKGATVFVNVSAIGRDPKYWDEAEEFIPERF 30226
30227 EHSDVDFKGTHFEYTPFGAGRRMCPGMAFGLANVELTLASLLYHFNWELPSGIHAENLDM 30406
30407 TEEMRFTTRRLHDLVLIPVVHVPLPTI* 30490

>aaaa01001134.1a (indica cultivar-group) ortholog of AC116949.3 chromosome 11
16346 MIRERQKLGVGSSHDLLSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDTVSTALTTLFM 16525
16526 LLSKNPEVAAAMRAEAEAGDGGETGAAITYEHLKGLHYTHAVLHENMRLFPPVQFDSK 16699
16700 FCAAADVLPDGTYVGGDARVMYHPYAMGRMPHIWGADYAAFRPARWLTGPGASFVPANPY 16879
16880 KYPVFQAGQRVCLGKELAVTEMKAASVAVVRAFDVEVV 16993

>aaaa01001134.1b (indica cultivar-group) ortholog of AC116949.3 chromosome 11
24225 KAIKLIDGLAAAMIRERRKLGVANSHDLLSRFMASSGDDARGAADDKFLRDIVVSFLLAG 24404
24405 RDTVSSALTTLFMILSKNPDVAAAMRAEAGAAAGESAAVSYEHLKRLNYTHAVLYE 24572
24573 NMRLFPPVQFDSKFCAAADVLPDGTYVDGGARVMYHPYAMGRMPRIWGADCDAFRPER 24746
24747 WLTGAGGAFVPESLFKYPVFQAGLRVCLGKELAITEMKAVSVAVVRAFDVEVV 24905

>aaaa01001195.1a (indica cultivar-group) AP003378.1 $F chromosome 1 96% 4 diffs
9602 GTWVWLAPGVLAKDPKNFPEPEVFRPERFDPNGEEERRRHPYAFIPFGIGPRVCIGQK 9778
9779 FSIQEIKLSVIHLYRHYVFRHSPSMESPLEFQFAIICDFKYGVKLQVIKR 9928

>aaaa01001195.1b (indica cultivar-group) AP003378.1 $F chromosome 1 97% 3 diffs
18648 GTWVWLAPGVLAKDPKNFPEPEIFRPERFDPNGEEERRRHLYAFIPFGIGPRVCIGQ 18818
18819 KFSIQEIKLSVIHLYRHYVFRHSPSMESPLEFQFAIICDFKYGVKLQAIKR 18971

>aaaa01001209.1 $FI (indica cultivar-group) ortholog of AL662933.1 99%
26186 MEINSEATVTLVSVVTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSQPQVALR 26365
26366 DLAGKYGPVMFLRTGQVDTVVVSSPAAAQEVLRDKDVIFASRPSLLVSEIFCYGNLDIGF 26545
26546 APYGAYWRMLRKLCTVELLSTKMVRQLAPIRDGETLALVRNIEAAAGGKKPFTLATLIIS 26725
26726 CTNTFTAKAAFGQACGGELQEQFLTALDEALKFSNGFCFGDLFPSLRFIDAMTGLRSRLE 26905
26906 RLRLQLDTVFDKIVAQCESNPGDSLVNVLLRIKDQGELDFPFSSTHVKAIIL 27061
      DMFSGGTETTSSTTEWLMSELMRNPEVMAKVQAEVRGVFDNKSPQDHEG 27542
27543 LLENLSYMKLVIKETLRLNPVLPLLLPHFCRETCEIGGYEIVEGTRVLINSWAMARSPEY 27722
27723 WDDAEKFIPERFEDGTADFKGSRFEYLPFGTGRRRCPGDIFAMATLELIVARLLYYFDWS 27902
27903 LPDGMQPGDIDMELVVGATARRKNHLQLVASPYKPIAMQS 28022

>aaaa01001213.1 (indica cultivar-group) orth AP004028.1 $F chromosome 2 99%
6134 RRRRLLIRCSASGGNNGKGGGGSGSDPILEERRRRRQAELAARIASGEFTAQGPA 6298
6299 SVLILSHVAGAFPSSVDDLMESSLSFFRWIAPLAAGLAKLGPPGELAAALLTKVAGGGG 6475
6476 PEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPK (0)
     SFLIVSDPAIAKHILRDNSKAYSK (0)
     GILAEILEFVMGTGLIPADGEIWRVRRRAIVPAMHQK (0)
     YVTAMISLFGEASDRLCQKLDKAASDGEDVEMESLFSRLTLDVIGKAVFNYDF 7195
7196 DSLSYDNGIVE 7228
7327 AVYVTLREAEMRSTSPIPTWEIPIWKDISPRQRKVNEALALINKTLDELIDICK 7491
     RLVEEEDLQFHEEYMNEQDPSILHFLLASGDD 7676
7754 VSSKQLRDDLMTMLIAGHETSAAVLTWTFYL
8091 LTSCK*LVSLTYGQADTVLGDRLPTIEDVKKLKYTTRVINE (0)
     SLRLYPQPPVLIRRSIEEDMLGGYPIGR 8378
9054 GEDIFISVWNLHHCPKHWDGADVFNPERWPLDGPNPNETNQNFRF 9191
10423 SYLPFGGGPRKCVGDMFATFEVICFSF*RISSFNFKMS 10536
10717 QTVVATAMLVRRFDFQMAPGAPPV 10788
10863 VEMTTGATIHTTEGLKMTVTRRTKP 10937

Duplicate last exon
20680 VEMTTGATIHTTEGLKMTVTRRTKP 20606

>aaaa01001279.1 (indica cultivar-group) ortholog of AP005302.1a
AVPGLPIIGNLHQLKE 20880
20881 KKPHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 20994

>aaaa01001325.1 (indica cultivar-group) ortholog to AP003822.1 $F chromosome 7
24910 KSKRERDYIATIHEFLVVVFSLQLGMILNETLRLYPPAVAMIRTAKEDVELGGCVVPAGT 25089
25090 EVMIPIMAVHHDAAAWGDDAAEFNPARFAADDDGGRRRHPMAFMPFGGGARVCIGQNMAL 25269
25270 MEAKVALAVVLRRFEF 25317

>aaaa01001427.1 (indica cultivar-group) orth of AP002484a $F 99%
3314 PVFGMLPFLVQNLHYIHDKVADVLREAGCTFMVSGPWFLNMNFLITCDPATVNHC 3150
3149 FNANFKNYPKGSEFAEMFDILGDGLLVADSESWEYQRRMAMYIFAARTFRSFAMSTIAR 2973
2972 KTGSVLLPYLDHMAKFGSEVELEGVFMRFSLDVTYSTVFAADLDCLSVSSPIPVFGQATK 2793
2792 EAEEAVLFRHVIPPSVWKLLRLLNVGTEKKLTNAKVVIDQFIYEEIAKRKAQASDGLQGD 2613
2612 ILSMYMKWSIHESAHKQKDEQFLRDTAVGFIFAGKDLIAVTLTWFFYMMCKHPHVEERIL 2433
2432 QELKGLQSSTWPGDLHVFEWDTLRSAIYLQAALLETLR
2209 RLFPATPFEEKEALVDDVLPNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSK 2030
2029 SGRLRHEPSYKFLSFNTGPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSS 1856
1855 VILHTQNGMMVRLKRR 1808

>aaaa01001441.1 (indica cultivar-group) ortholog of >AP004129.1 $F chromosome 2
26229 CGLPLPPGSMGWPYVGETFQLYSSKNPNVFFNKKRNKYGPIFKTHILGCPCVMVSSP 26059
26058 EAARFVLVTQAHLFKPTFPASKERMLGPQAIFFQQGDYHAHLRRIVSRAFSPESIRASVP 25879
25878 AIEAIALRSLHSWDGQF 25828
25639 EELKQCYLTLEKGYNSMPVNLPGTLFHKAMKARKRLGAIVAHIISARRERQRGNDLLG 25466
25465 SFVDGREALTDAQIADNVIGVIFAARDTTASVLTWMVKFLGDHPAVLKAVT 25313
24599 FMPFGNGTHSCPGNELAKLEMLVLFHHLATKYRWSTSKSESGVQF 24465

>aaaa01001473.1 (indica cultivar-group) orth of AP002899 $F 99%
6721 IVFLQVTMILHEVLRLYPPVVFLQRTTHKEIELGGIKYPEGVNFTLPVLSIHHDPSIWG 6897
6898 QDAIKFNPERFANGISKATKFQTAFFSFAWGPRICLGQSFAILEAKMALATILQS 7062
7063 FSFELSPSYTHAPHTVLTLQPQYGSPIKLK 7152

>aaaa01001474.1 (indica cultivar-group) ortholog to AP003927.1 $P
25134 PLLVPHHARENTVVAGYDVPAGTRVLVNVWAIARDPASWLDRPDAFLPERFLPGAGSCDD 24955
24954 VVDVHGQHFELLPFESGRQIYPATNLAKKMVALGVASLLQGFAWR 24820 frameshift
24817 EDVSMEELVGLSTRRKVPLVAVAE 24746 frameshift
24743 RLPAHERR 24720

>aaaa01001499.1 (indica cultivar-group) 85% to AP004181.1 $F
8039 IRSRPAMAPPPVNSGDAAAAATGEKSKLSPSGLPIREIPGGYGVPFFSPLRDRLDYFYFQ 7860
7859 GAEEYFRSRVARHGGATVLRVNMPPGPFISGDPRVVALLDARSFRVLLDDSMVDKADTLD 7680
7679 GTFMPSRALFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAMFDAVE 7500
7499 AGLGAAVEFNKLNMRYMLDFTCAALFGGEPPSKVVGDGAVTKAMAWLAFQLHPIA 7335
7334 SKVVRPWPLEELLLHTFSLPPFLVRRGYADLKAYFADAAAAVLDDAEKSHPGIPRDELLD 7155
7154 NLVFVAIFNAFGGFKIFLPHIVKWLARAGPELHAKLATEVRAAADDGITLAAVERMP 6984
6983 LVKSVVWEALRMNPPVEFQYGHARRDMIVESHV*CFR 6873

>aaaa01001606.1a (indica cultivar-group) ortholog of AC078944.5b >99%
AAAA01032734.1 (indica cultivar-group) missing Cterm, runs off end
2001 MATWILGWLLWLPVFLISLYLVDILAHSCRRLPPGPRPLPFIGSLHLLGDQPHRSLAGLA 1822
1821 KKYGPLMSLRLGAVTTVVVSSPEVAREFVQKHDAVFADRSIPDSIGDHTKNSVIWLNPGP 1642
1641 RWRALRRIMATELFSPHQLDALQQLRQEKVAELVDHVARLARESAAVDVGRVAFATSLNL 1462
1461 LSRTIFSRDLTSLDDRGASREFKQVITDIMEAAGSPNLSDFYPAIAAVDLQGWRRRCARL 1282
1281 FTQLHRLFDDEMDHRKLHSRHGG 1213 frameshift
1211 PGENGKEKDDFLEVLLRLGARDDDIAGLDGDTLRSLF 1101
572 DLFAAGSDTSSSTIEWAMVELLKNTLSMGKACDELAQVVGSRRRIEESEIGQLPYLQAVI 393
392 KETLRLHPPVPLLPHRAKMAMQIMGYTIPNGTKILINVWAMGRDKNIWTEPEKFMPERFL 213
212 DRTIDFRGGDLELIPFGAGRRICPGMPLAIRMVHVVLASLLIHFKWRLPVEVERNGIDMT 33
32  EKFGLTLVKA 3

>aaaa01026521.1 (indica cultivar-group) ortholog of AC078944.5a 99%
AAAA01001606.1b (indica cultivar-group) 
    1 RRIMAAELFAPHRLDALRRLRREKVQELVDHVARLAEREGGAAAVDVGRVAFATSLNLLS 180
  181 STIFSRNLTSLDDHGESMEFKEVVVEIMEAGGCPNVSDFFPAIAAADLQGWRRRMACLFA 360
  361 RLHRVFDAVVEERLSERDAGEARKGDFLDVLLDVAARDNDSAGLDRDTLRSLFT 522
25247 DLFAAGSDTSSSIVEWAIAELMRNPLCMIRACDELS 25140 (0?)
25139 QAIGSGTNIEESDIGQLPYLQAVVKETFRLHPPVPLLLPRQAETTTNIAGYTIPKGARVF 24960
24959 VNVWAIGRHKDTWSQPEKFMPERFFERNIDFRGVHFELIPFGAGRRICPGLPLANRMVHL 24780
24779 VLGSLLNQFKWNLPVDIERNGIDMSEKFGLTLVKAIPLCALVTPISVESGDH 24624

>aaaa01001621.1a $FI (indica cultivar-group) ortholog of AC092749.1 >99%
9137 MVFLLVCMCSLLLMFLISYALQLFGDARRRLPPGPTPLPLIGNLLDIASDLPHRSLARLA 9316
9317 GRHGPLMAVRLGTVVAVVASSPSTAREVLQTHNGSLTGRVPPDAWHGVGHAANSVFVLPP 9496
9497 RRKWRALRRIGAEHLLSARQLDGRRLLPLLRDAVLDLLRRVSEMSAASGGGAGAPVQVGH 9676
9677 AAFAAMMDMQWRAMFSAGLEDDDARVLQDAAREAVALSLKPNLSDFYPALAAVDLQGLRR 9856
9857 RFAGRVGTVYHLVDEQIERRMRRRREAAGDDGEARSEDDLLDVLLDMSEHGKDDGKVAID 10036
10037RDLIRTFLT 10063 (0?)
12305 DIFLATVDTIASTLEWAMAELLQDRETMRKLQEELKKVLGSKTHAEYADMDRLPYLRAVI 12484
12485 KETLRLHPVVPIVPNVAEEMVEIHGHVVPRGSTILVNLWAVHRDAEAWPEPNRFLPERFM 12664
12665 LRQHGQEAAGRALGTATTEFELIPFSAGRRVCLGLPLATRMLHAMLGSLLHRFEWTLPLE 12844
12845 VKENGVDMSENLGLTMTMATPLQAIAKSI 12931

>aaaa01001621.1b $PI (indica cultivar-group) ortholog of AC092749.1 $P 1 aa diff
16168 LMAVRLGTVVSTVASSPSTARQILQTHNGSLTGRV
      AWHGVGVGHAANSVFVLPPRRKWRALRRIGAEHLLSTRQLDGACMPLLR 16414 frameshift
16416 SEMSAASGGAPVQVGHAAHAVFAAMVDMQWRAMFSAG 16526

>aaaa01001626.1 $FI (indica cultivar-group) Cterm ONE FRAMESHIFT
22316 MQLTSSTVFWLTTAVAFLLINTVILRALQKRKSSPAAAAAAPPPPVVQGVGLVRFV
      RAMARDGPLEAIREQQAKLGSVFTASAPLGTFLIGSEVSSHFYVAPDSEISMGRLY
      EFTVPIFGPGVLYGVDLETRKEQIRFNWDILKPRSLKASVGAMAEEVE (0) 22795
23040 NYFSRWGDQGTVDLKHELEQVLMLTASRCLLGKELRER 23153 (FS)
23156 VPGKLCELFGELDNGLHLISGLLPYLPIPAH
23249 RRRDRARQRLGEIITEVIRSRRNSSRGAAGTDENNDDMLQCLINSRYKDGCAMTDAE 23419
23420 TAGLVVALMFAGKHTSSGVSIWTGVHLLSNPNHLAAVVAEQDRLMASCPGRTDDYHRLD 23596
23597 YDTVQEMRSLHCCVKEALRLHPPVAAVSQAYKHFTVQTKEGKEYTIPGGHMVVSTILVNH 23776
23777 YLPHIYKDPHVFDPQRFAPGREEEKVAGRFSFLSFSAGRHACAGESFSYTQIKVLWSYLL 23956
23957 SNFEIKMVSPFLETEWSTVIPEPKGKVMVSYRRRTAPK* 24073

>aaaa01001667.1a $FI (indica cultivar-group) ortholog of AC118672.1b
3640 MELLLLCTPCVILLLSSLYLLRLFVDARRNLPPGPRPQPLIGNILDLGSQPHRSLARLAGRYGPLMTL 3437
3436 RLGTVTTVVASSPGAARDILQRHDAAFSARSVPDAARACGHDGFSMGMLPPSSALWRALR 3257
3256 RVCAAELFAPRSLDAHQRLRRDKVRQLVSHVARLARDGAAVDVGRAAFTASLNLLSSTIF 3077
3076 SADLADFGDARAESSVGDLRDLISEFTIVVGVPNVSDFFPAVAPLDPQRLRRRVARVFER 2897
2896 LQAVFDGHIERRLRDRAAGEPPNNDFLDALLDYRSPEDGRGFDRPTLQFLFT (0)
     DLFSAGSDTSAVTVEWAMAQLLQNP 2537
2536 PAMAKAREELARVIGSKQEIEESDISQLKYLEAVVKETLRLHPPAPFLLPHQAETT 2369 (fs)
2367 TEIRGYTVPRGARVLVNVWAIGQDPELWPEPEVFTPERFLEKEMDFRGKDFELLP*GSGR 2188
2187 RVCPGLPLAVRMVHLMLASLLHRFEWRLLPEVEKNGVDMAEKFGMILELATPLRAVAIPV* 2005

>aaaa01001667.1b (indica cultivar-group) ortholog of AC118672.1a
11859 MELLLLYAPCVILLVSSLYLLRLFSDARRNLPPGPRPLPLVGNLLELGAKPHRSLARLAERHGPLMTL 11656
11655 RLGAVTTIVASSPDAARDILQRHDAAFSTRPVPDIVRACGHDRFAMPWLPPSSPQCRALR 11476
11475 KVCSAELFAPRRLDAQQRLRREKARRLVSHVARMAREGAAVDVRRVVFTTLLNMLSCTLF 11296
11295 SADLADLDEGRAGSAGELADTVAEFAGTVGVPNVVDYFPAVAAFDPQRLRRRLSRVFTR 11119
11118 LFAEFDEQIERRMRERDAGEPPKNDFLDVLLDYRTTEDGRQFDRQTLRSRFT (0) 10963
10235 DLFSAGSDTSAVTVEWAMAQLLQSPSSMMKAREELTRVIGSKPEIDESDIDSLEYLQAVV 10056
10055 KETFRLHPPAPLLLSHRAETDTEIGGYTVPKGATVMVNIWA 9933

>aaaa01010113.1 $FI (indica cultivar-group) ortholog of C73729
AAAA01001707.1a PLUS STRAND CTERM 439507 MIGHT BELONG TO END OF AAAA01010113.1 34% to 88A3
6784 MSGATADWAWWLGLVAGAVPLLALAVWHCTDAFHSAAFAFRRRGTRAR
     LPPGHMGLPFVGETLALIWYFNLARRPDAFIEAKRRRYCYGDGDDDGGIYRTHLFGSPAV 1481
     LVCSPASNGFVFRSAPPGSFGVGWPVPELVGASSLVNVHGGRHARLRRFVLGAINRPG 1307
     SLRTIARVAQPRVAAALRSWAAKGTITAATEMKN (0) 6185
5443 VTFENICKIFVSMEPSPLTEKIHGWFTGLVAGFRSLPLDMPGTALHHARK (0) 5294
5218 CRRKLNSVFREELERRKVKMVTGEGGDDDDDGDLMSGLMHVEDEQGR
     RLD DDEVVDNIVSLVIAGYESTASAIMWATYHLAKSPSALAKLR 4946 (0)
2321 EENLAIAKEKNGDGFITLEDVSKMKYTAK 2235 (0)
2148 VVEETIRLANIAPMAHRVALRDVEYR 2071 (1)
1745 GYTIPKGWKVIVWIRSLHVDPAHYDNPLSFNPDRWD (0) 1638
9851 KSAELGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK (2) 9970
10088 WELLNPDAGIVYLPHPRPTDGAVMSFSEL* 10177

>aaaa01001707.1b (indica cultivar-group) PLUS STRAND NTERM aa 1262
13182 MMSGMQTPVVAVGATDWAWRLGALVAGAVPLLALAVWHCTDAFHCAAFAFRRRGTRRARR 13361
13362 LPPGHMGLPFVGETLALLWYFNLARRPDAFIEAKRRRYCYGDGDDDAGIYRTHLFGSPAV 13541
13542 LVCSPASNGFVFRSAPPGSFGVGWPDPELVGVSSIVNVHGGRHARLRRFVLGAINSPNSL 13721
13722 RSFAEVVQPRVAAALRSWAAKGTITAATEIKK (0) 
13909 VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK 14058 (0)

>aaaa01001707.1c (indica cultivar-group) MINUS STRAND aa 148507
27328 ELVGVSSIVNVHGGRHARLRRFVLGAINSPNSL
      RSFAEVVQPRVAAALRSWAAKGTITAATEMKK 27134 (0)
27014 VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK 26865 (0)
26763 QCRRKLNSVFREEVKRRKLKAKLEEHDDVMSGLMRMEDEQGRRLGDDEVVDSIVSLVLGG 26584
26583 YESTSSAIMWATYHLAKLPAVLAKLR 26506 (0)
20697 EENLAIAKEKNGASFITLDDISKMKYTAK 20611 (0)
20524 VVEETIRLANISPMLYRVALRDVEYR 20447 (1)
19953 GYTIPEGWKVIVWIRSLHVDPKYYDDPLSFNPDRWD 19846 (0)
18777 KAAKPGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK 18658 (2)
18547 WELLNPDAGVVYLPRPRPTNGAAMSFSKL* 18458

>aaaa01001712.1 $PI (indica cultivar-group) missing Cterminal exon 
not found in 20000bp of seq.
6693 MAMAQDVTGYLCLFVALLVLLKVVRKASGNGAAGRLRLPPGPWRLPVIGNLHQVAMGG 6866
6867 PLVHRTMADMARRLDAPLMSLRLGEIPVVVASSADAAREITKTHDVAFATRPLSSTIRVM 7046
7047 VSDGEGLVFTPYGALWRRLRKIAMLELLSARRVQSFRRVREEEVGRLVAAVAAAAAAR 7220
7221 PGEAVNLSQLIAELISDTAARTIIGDRFEKRQELLEGLTEGIRISSGFSLGDLFPSSRL 7397
7398 ANLIGGTTRRAEANHRKNLALIECALRQHEERRAAGDEEDDEDLVDVLLRVQKEGG 7565
7566 GEVPLTMGNVKVVIR (0) 7610

>aaaa01001902.1 (indica cultivar-group) ortholog of AC087192 $F
13741 EEFSPERFMEGGEGEGVRLAIGSKQKATTKVKMMPFGAGRRTCPGMGYAILHLEYFLANL 13920
13921 VTAFEWRRVPWEEEVDLTADYGFITTMQHPLR 14016

>aaaa01001928.1 (indica cultivar-group) 89% AP003711.1 $F 4 diffs
18830 RTSGKRLPPSPFGLPILGHLHLLTPLPHQALHRLAARHGPLLYLRLGSI 18684

>aaaa01002000.1 (indica cultivar-group) ortholog of AAAA01002000.1 99%
6046 METADLCCLLALLPLVYCLLTLFHGSRESDLRLPPGPWRLPLIGSLHHLFGRTLPHHALR 5867
5866 DLARLHGPLMLLSFGQASPVVIASTAIAAREIMRTHDDNFSTRPLSTVLKVCTRYGAGMT 5687
5686 FVPYGEHWRQVRKICSLELLSPRRILKFRSIREEEVARLVLAIASSSTPTPTPPAPVNLS 5507
5506 KLLSNYMTDATVHIIMGQCFRDRDTLVRYVDEAVRLASSLTMADLFPSWRLPRVMCATTL 5327
5326 HRAEVFVESVMEFMDRVISEHLEKRSCQGGDREEDLIDVLLRLQAEGNLEFELTTSIIKA 5147
5146 IIF 5138
     ELLAGGSEAPITTLQWAMAELMRNPDVMSRAQAEVREAYKEKMKV 4911
4910 TEEGLTNLPYLHCIIKETLRLHTPGPFVLPRECQEQCQILGYDVPKRATVVVNIWAICRD 4731
4730 AEIWDEPEKFMPDRFEGSAIEHKGNHFEFIPFGAGRRICPGMNFALANMELALASLLFYF 4551
4550 DWSLPEDVLPGDLDMTETMGLTARRKEDLYVCAIPFVQLP 4431

>aaaa01002047.1a $FI (indica cultivar-group) ortholog of AP004001.1a 99%
2682 MAMVQDITGYLCLSLALLLLTLVLHKVARKATGNGAGKPRLPPGPWRLPVIGNLHQVAMG 2861
2862 GPLVHRTMADLARRLDAPLMSLRLGELRVVVASSANAAREITKTHDVAFATRPWSSTIRV 3041
3042 LMSDGVGLVFAPYGALWRQLRKIAVVELLSARRVQSFRRIREDEVGRLVAAVAAAPAAQP 3221
3222 VNVSERIAALISDSAVRTIIGDRFERRDEFLEGLAEAIKITSGFSLGDLFPSSRLASFVG 3401
3402 GTTRRAEANHRKNFELIECALRQHEERRAAGAVDDDEDLVDVLLRVQKDGSLQMPLTMGN 3581
3582 IKAVVL 3599
4057 ELFGAGSETSANTLQWAMTELIMNPRVMLKAQAELSNVIKGKQTISEDDLVELKYLKLII 4236
4237 KETLRLHPVVPLLLPRECRETCEVMGYDIPIGTIVLVNVWAIGRDPKYWEDAETFIPERF 4416
4417 EDGHIDFKGTNFEFIPFGAGRRMCPGMVFAEVIMELALASLLYHFDWELPDGISPTKVDM 4596
4597 MEELGATIRRKNDLYLIPAVRVPLSTVL 4680

>aaaa01002047.1b $FI (indica cultivar-group) ortholog of AP003990.1a 99%
16718 MADLELEKVASFLLAALLPLVLFKLAAAKRGGGDGGMRLPPGPWRLPVIGNLHQIMAGGQ 16897
16898 LVHRTMAGLARGLGDAPLLSLRLGEVPVVVASSADAAREIMSRHDAKFATRPWSPTVRVQ 17077
17078 MVDGEGLAFAPYGALWRQLRKITMVELLSPRRVRSFRRVREEEVGRLVVAVATAATRRPG 17257
17258 EAAVNVGERLTVLITDIAMRTIIGDRFERREDFLDAAAEWVKIMSGFSLGDLFPSSRLAS 17437
17438 FVSGTVRRAEANHRKNFELMDYALKQHEEKRAAAAAAGAGAVEDDEDIVDVLLRIQKEGG 17617
17618 LEVPLTMGVIKGVIR 17662
17911 DLFGAGSETSANTLQWTMSELVRNPRVMQKAQTELRDCLRGKQSVSEDDLIGLKYLK 18081
18082 LVIKETLRLHPVVPLLLPRECQETCNIMGYDVPKGTNVLVNVWAICRDPRHWENAETFIP 18261
18262 ERFEDSTVDFKGTDFEFIPFGAGRRMCPGLAFAQVSMELALASLLYHFDWELPSGVAPSN 18441
18442 LDMEEEMGITIRRKNDLYLVPKVHVPL 18522

>aaaa01002047.1c $PI (indica cultivar-group) ortholog of AP003990.1b 99%
20381 MEKVAWCACFLFLALMVVRLRTKRRGDNNGGVKLPPGPWRLPLVGNLHQVMARGPLVHRT 20560
20561 MADLARRLDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTIRVMMSEGVG 20740
20741 LVFAPYGALWRQLRKIAMVELLSARRVQSFRRIREDEVGRLVAAVAAAQPGEAVNVSERI 20920
20921 AALVSDAAVRTIIG 20962 
20979 VAWCACFLFLALMVVRLRTKRRGDNNGGVKLPPGPWRLPLVGNLHQVMA 21125 aa 452 out of sequence
21126 DLFPSSRLASFIGGTTRRAEANHRKNFELMECALKQHEEKRAAAAAAAAGAVEDDEDI 21299
21300 VDVLLRIQKEGSLQVPLTMGNIKAVVL 21380
22004 DLFSAGSETSANTLQ*AMAELIMNPRTMLKAQAELRDALQGKQIVSEYDLVKLKYLKLII 22183
22184 KETLRLHPVVPLLLPRECQETCKVMDYDIPIGTIVLVNVWVIGRDPKYWD 22333
22334 DAKTFRLERFEDGHVDFKGMNFEYLPFGAGRRMCPGVAFAEAIMELALASLLYHFDWEFP 22513
22514 DGILPAKMDMMEVMGSTV*KKNDLYLVPNAHVPVAP 22621

>aaaa01002066.1 $PI (indica cultivar-group) ortholog of AP003434.1b $F 99%
1728 MELSSLAALLHSPLLLAVLLLVFSWLIVSSTKKRPPPPCGDGGRRLPLPPSPPGVPLLGH 1549
1548 LPLLGTLPHRKLRSMAEAHGPVMLLRLGRVPAVVASSAAAAEEVMRTRDLAFASRPRVRM 1369
1368 SERLFYGRDM 1339 frameshift and deltion
     DFVDVMLDVSEAEEGAGAGAGGVLLDTVAIKAVIL 1233

>aaaa01002142.1a (indica cultivar-group) orth of AP003514.1 $F chromosome 6 97%
6   LYETLRLYGPVSLMARTATADAELGGVRVPKGTMTMIPMAILHRDADVWGAGAGEFDPL 182
183 RFRGGVNKAAAHAGALLAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYV 350
351 HAPLDYLTLQPQCGLPIILK 410

>aaaa01002142.1b (indica cultivar-group) 60% to AP003752.1c $F like 709B
4772 LYETLRLYGPVSMLVRTATADAELGGVRVPKGTMTMMPVAILHRDADVWGADAGEFAP 4599
4552 LAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYVHAPLDLLTLQPKCGLPMVL 4376
4375 K 4373

>aaaa01002164.1a $FI (indica cultivar-group) ortholog of AC084282b $F 100%
1187 MDNAYIIAILSVAILFLLHYYLLGRGNGGAARLPPGPPAVPILGHLHLVKKPMHATMSRL 1366
1367 AERYGPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPRFESQLLVSFNGAALATAS 1546
1547 YGAHWRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRMYRAAAASPAGAARIQLKRRL 1726
1727 FEVSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQVVDEIIPHIGAANLWDYLPALRW 1906
1907 FDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGDEGEKKSMIAVLLTLQKTEPEVYTD 2086
2087 NMITALTA 2110
2837 NLFGAGTETTSTTSEWAMSLLLNHPDTLKKAQAEIDASVGNSRLITADDVTRLGYLQCIV 3016
3017 RETLRLYPAAPMLLPHESSADCKVGGYNIPRGSMLLINAYAIHRDPAVWEEPEKFMPERF 3196
3197 EDGGCDGNLLMPFGMGRRRCPGETLALRTVGLVLGTLIQCFDWERVDGVEVDMTEGGGLT 3376
3377 IPKVVPLEAMCRPRDAMGGVLRELV 3451

>aaaa01002164.1b $FI (indica cultivar-group) ortholog of AC084282.1c $F 100%
6328 MDKAYIAVFSIAILFLLVDYFRCRRRRGSGSNNGENKGMLQLPPSPPAIPFFGHLHLIDK 6507
6508 PLHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARECFTDNDVCFANRPQFPSQMPATF 6687
6688 YGAGFGFANYGAHWRNLRRIATVHLLSAHRVRGMAGVVSGEIRPMVQRMYRAAAAAGVGV 6867
6868 ARVQLKRRLFELSLSVLMEAIAQTKTTRPEADDADTDMSVEAQEFKNVLDELNPLLGAAN 7047
7048 LWDYLPALRVFDVLGVKRKIATLANRRDAFVRRLIDAERQRMDNGVDGGDDGEKKSVISV 7227
7228 LLSLQKTEPEVYKDIVIVNLCA 7293
8136 ALFAAGTETTAMTIEWAMSLLLNHPKILKKAKAEIDASVGNSRLINGDDMPHLSYLQCII 8315
8316 NETLRLYPVAPLLIPHESSADCKVNGYHIPSGTMLLVNVIAIQRDPMVWKEPNEFKPERF 8495
8496 ENGESEGLFMIPFGMGRRKCPGETMALQTIGLVLGALIQCFDWDRVDGAEVDMTQGSGLT 8675
8676 NPRAVPLEAMCKPREAMSDVFRELL 8750

>aaaa01002164.1c $FI (indica cultivar-group) ortholog of AC084282.1d $F 99%
11246 MV*AYIAIFSIAVLLLIHFLFRRRGRSNGMPLPPSPPAIPFFGHLHLIDKPFHAALSRLA 11425
11426 ERHGPVFSLRLGSRNAVVVSSPECARECFTDNDVCFANRPRFPSQMLATFNGTSLGSANY 11605
11606 GPHWRNLRRIATVHLLSSHRVSGMSGIISGQARHMVRRMYRAATASAAGVARVQLNRRLF 11785
11786 ELSLSVLMEAIAQSKTTRREAPDADTDMSMEAQELRHVLDELNPLIGAANLWDYLPALRW 11965
11966 FDVFGVKRKIVAAVNRRNAFMRRLIDAERQRMDNNDVDGGDDGEKKSMISVLLTLQKTQP 12145
12146 EVYTDTLIMTLCA
      PLFGAGTETTSTTIEWAMSLLLNHPEILKKAQAEIDMSVGNSRLISVV 12505
12506 DVHRLGYLQCIINETLRMYPAVPLLLPHESSADCKVGGYHIPSGAMLLVNVAAIQRDPVI 12685
12686 WKEPSEFKPERFENGRFEGLFMIPFGMGRRRCPGEMLALQTIGLVLGTMIQCFDWGRVDD 12865
12866 AMVDMTQSNGLTSLKVIPLEAMCKPREAMCDVLRKFM 12976

>aaaa01002175.1 (indica cultivar-group) orth of AC099043.1 $F chromosome 3 100%
4310 VIRRQTRASASASATDRQEVVSPKRRLPLRKVPGDYGPPVVGAIRDRYEYFYGPGGRDGF 4489
4490 FAARVRAHRSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSLVDKTDLFTGTFMPS 4669
4670 TDLTGGYRVLSYLDPSEPNHAPLKTLLFYLLSHRRQQVIPKFREVYGDLFGLMENDLARV 4849
4850 GKADFGVHNDAAAFGFLCQGLLGRDPAKSALGRDGPKLITKWVLFQLSPLLSLGLPTLVE 5029
5030 DTLLHSLRLPPALVKKDYDRLADFFRDAAKAVVDEGERLGIAREEAVHNILFALCFNSFG 5209
5210 GMKILFPTLVKWLGRAGARVHGRLATEVRGAVRDNGGEVTMKALAEMPLVKSAVYEALRI 5389
5390 EPPVAMQYGRAKRDMVVESHDYGYEVREGEMLFGYQPMATKDPRVFARPEEYVPDRFLGE 5569
5570 DGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLVELFLRYDSFDVEVGTSTL 5749
5750 GSSVTVTSLKKATF 5791

>aaaa01002200.1 $PI (indica cultivar-group) ortholog of AC087599.11 $P 94%
2930 PAPILVPRQSTATAVVQG*EILAKTSLFINVWAMGRYPAAWNSPEEFWPERFLASREAMD 3109
3110 FQGNNYQLILFITDRRICPDINFAVPVLETALVGLLHPTNELLGGGGGLMWLQRSCSRAR 3289
3290 RLRSTGHRRHRSGTHPAAAVAAAAT 3364

>aaaa01002235.1 (indica cultivar-group) orth to AL607001.1 gene 3 chr 4
6264 ALLCAALAAVVALLRWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKE 6443
6444 RIK
6563 RYGSIFKTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFM 6742
6743 YKYLKTLVLRLYGQENLKSVLLAETDAACRGSLASWASQPSVELKEGIST
     MIFDLTAKKLIGYDPSKPSQVNLRKNFGAFIRG 7102
7103 LISFPLNIPGTAYHECME
7455 GRKNAMKVLRGMMKERMAEPERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFASF 7634
7635 ETTALALTIGVKLLTENPKVVDALX 7706
7850 EEHEAIIRNRKDPNSGVTWAEYKSMTFTSQXXXXXX 7945
8422 RLANIVPGIFRKALQDVEIKX 8481
8589 YTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQVS 8699
9679 EITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHALVTKYR 9804
9888 WRTVKGGNIVRTPGLSFPDGFHIQLFPK 9971

AUTHORS   Chaban,C.
  TITLE     Phytochrome response in rice coleoptile - just a matter of auxin?
  JOURNAL   Thesis (2002) Department of Botany, University of Freiburg,
            Freiburg, Germany
(CYP87A3 gene) AJ459255 authors assigned should be 87A4
MQPYLQLASLRLATTIPLAPRLYDANLLAASGAAMASSMAYIAL
LCAALAAVVALLRWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKE
RIKRYGSIFKTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSL
HGFMYKYLKTLVLRLYGQENLKSVLLAETDAACRGSLASWASQPSVELKEGISTMIFD
LTAKKLIGYDPSKPSQVNLRKNFGAFICGLISFPLNIPGTAYHECMEGRKNAMKVLRG
MMKERMAEPERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFASFETTALALTIG
VKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVP
GIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGKPEITGGT
KHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYSWRTVKGGNIVRTPGLSFPDGFHI
QLFPKN
AL607001.1c $F chromosome 4 clone OSJNBA0088I22, gene 3 136970-140694 61% to
            87A2

>aaaa01002256.1a (indica cultivar-group) orth CYP72A24 $F AP002839 chr 1 100% 
18321 GVRYPAGVVLTLPLLCVHHDKDVWGADADEFRPERFAEGISKASREAPAFFPFGWGP 18491
18492 RICIGQNFALLEAKMGLSMILQRF 18563

>aaaa01002256.1b (indica cultivar-group) orth CYP72A25 $F AP002839 2 diffs
21490 RRTKANAREVRELLKGIITKRESAMKDGHAVNDDLLGLLLETNIKESQEAGSSKP 21654
21655 TMTTKDIIEELKLLYFAGSDTTAVLLTWTMVLLSMHPKWQDRAREEVLRVFGKNSPDFE 21831
21832 GINHLK 
      VTMILHEVLRLYPPILLLGRE 22008
22009 AYEETELGGVTYPPGVTFALPIACIHHDPDVWGEDVGEFKPERFAEGVSRASKDSP 22176
22177 ALVPFSWGPRICVGQNFALLEAKMALSMILQRF 22275

>aaaa01002274.1a (indica cultivar-group) ortholog of AP003805.1 $F 100%
a duplicate of 1b
2088 MEDKVLLAVGASLVLVFLSKLISSYAKKPRLNLPPGPWTLPLIGSAHHLVSWSESVHSVI 1909
1908 GKLAREHGPVMQLWLGEVPTVVASSPEAAQEILRDHDLIFADRHLTSTTAAITFGGTDVV 1729
1728 MAQYGERWRHLRKLLTQELLTVARVRSFRRVREEEVARLVRDLSAAAASGATVNLTDMVN 1549
1548 RLVNDTVLRCSVGSRCKYREEFLAALHAILHQTSALSVADLFPSSKLASMVATGPRNVLA 1369
1368 NRNKVERIIEEIIQERKNQIETDMMSGNDDVGDKAAVESKSCSLDVLLRLQKEGGTPIPI 1189
1188 TNQVITVLLW 1159

>aaaa01002274.1b (indica cultivar-group) ortholog of AP003805.1 $F 100%
22179 MEDKVLLAVGASLVLVFLSKLISSYAKKPRLNLPPGPWTLPLIGSAHHLVSWSESVHSVI 22358
22359 GKLAREHGPVMQLWLGEVPTVVASSPEAAQEILRDHDLIFADRHLTSTTAAITFGGTDVV 22538
22539 MAQYGERWRHLRKLLTQELLTVARVRSFRRVREEEVARLVRDLSAAAASGATVNLTDMVN 22718
22719 RLVNDTVLRCSVGSRCKYREEFLAALHAILHQTSALSVADLFPSSKLASMVATGPRNVLA 22898
22899 NRNKVERIIEEIIQERKNQIETDMMSGNDDVGDKAAVESKSCSLDVLLRLQKEGGTPIPI 23078
23079 TNQVITVLLW 23108

>aaaa01002288.1 $FI (indica cultivar-group) 
13560 MDISLASLVLVLLAFVLPLLYLLLQLPGKKSGGGGGDGPRLPPSPAGCLPLLGHLHL 13390
13389 LGPLPHVALRSMAAAHGPVLRLRLGRVPTVVVSSAAAAEEVLRARDAAFSSRPRSAMAER 13210
13209 ILYGRDIAFAPYGEYWRQARRVCVVHLLSAQRVSSFRRVREEEAAALADAVRAAGRGGG 13033
13032 RAFDLSGLIVAYASAVVSRAAFGDESARGMYGGADGGRAVRKAFSDFSHLFGTKPVSDYL 12853
12852 PWLGWVDTLRGRERKARRTFEALDGVLDKVIDDHRRRRDSGRRQTGDADAGHRDFVDVL 12676
12675 LDVNEMDNEAGIHLDAIEIKAIIM 12604
12529 DMFVAGSDATSKPMEWAMAELVSHPRHMRRLQDEIRAVVGGGRVTEDHVDKLPYLRAAL 12353
12352 KEALRLHAPLPLLVARETVADTEIMGYHVAARTRVVINGWAIGRDTAVWGETAEEFMPER 12173
12172 FLAGGNGGGAAAADYKVQGFEMLPFGGGRRGCPGVTFGMATVE 12044
12041 SAVASLLYHFDWEAAAADGKGGREGTPLLDMSETSGISMGLKHGLPLVAKPRFP 11880

>aaaa01002303.1 $FI (indica cultivar-group) same seq as AAAA01000575.1
except 2 aa diffs and one short frameshifted region
3994 MDMEMGKLLHRPWKWSLNSPLLLLLIVPVMIHVQLKLRRRRKNAAVGTRLPPGPWRLPVI 4173
4174 VQSAPPRHEPEGGARALADLARRCGGGGGVMYLRLGELPVVVASSRDAAREVLRTHDAAF 4353
4354 ATRAMSVTVRDSIGDTVGILFSPYGERWRRLRGICSLELLNARRVRSFRPIREEQVARLV 4533
4534 GAIAAAAAAPGGDQPPPVNVSWQIAGALTDLTLRAIMGECGFRWREEFLETLGEAQRKAS 4713
4714 RFGVADLFPSSRLLRAVGSTAVRDVRALNAKLFELVDRAIEQHREAAATTAAGGDHDDGG 4893
4894 DDDARDDNECLLNTLMRIQKEGGGTLSMSTVKAVIL 5001
6869 DMFAGGSETTSTILEWAMSELVKNPQVMQKAQAQIRLALQGRSRITEDDLINLSYPKNII 7048
7049 KETLRLHPVAPLLGXKECQESCKILGYNIPKGSIMLVNVWAIGRDHRYWDDAEVFLPERF 7228
7229 EEITVDFGGTNYEFIPFGGGRRICPGITFAHATLEWALTALLYHFDWHLPPSVTPDGLDM 7408
7409 EEEFGMNVRRKRDLHLHPVIHVGVEKGIMS 7498

>aaaa01002376.1 $FI (indica cultivar-group) ortholog to AQ256364.1
73% to 73A5
899  MDALLVEKVLLGLFVAAVLALVVAKLTGKRLRLPPGPAGAPIVGNWLQVGDDLN 1060
1061 HRNLMALARRFGDILLLRMGVRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKG 1240
1241 QDMVFTVYGDHWRKMRRIMTVPFFTNKVVAQNRAGWEEEARLVVEDVRRDPTAATSGVVI 1420
1421 RRRLQLMMYNDMFRIMFDRRFDSVDDPLFNKLKAFNAERSRLSQSFEYNYGDFIPVLRPF 1600
1601 LRRYLARCHQLKSQRMKLFEDHFVQERK 1684 (2)
3697 RVMEQTGEIRCAMDHILEAERKGEINHDNVLYIVENINVA 3816 (1)
4917 AIETTLWSIEWGIAELVNHPSIQSKVREEMASVLGGAAVTEPDLERLPYLQAVVKETLRLRMAIP 5093
5094 LLVPHMNLADGKLAGYDIPAESKILVNAWFLANDPKRWVRPDEFRPERFLEEEKAVE 5264
5265 AHGNDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQSFDLLPPPGMDKVDTT 5423 (fs)
EKPGQFSTQILKHATVVCQ (fs)
PIDA*

>aaaa01002439.1 (indica cultivar-group) orth AP004092.1 $F chromosome 2
6997 ARRRGAPVLWPLVGIVPTLFVHRDDIYEWGSAALLRAGGVFPYRGTWGGGSSG 7155
7156 VITSAPANVEHVLRANFGNYPKGPYYRERFVELLGGGIFNAD 7281
7415 LPDVPFARAFELATELSLLRFVTPPFIWKAKRLLRAGSERRLVEATRAVREFAERAVADR 7594
7595 RNEMRKVGSLRGRCDLLSRLMSSAPGADYSNEFLRDFCISFILAGRDTSSVGLAWFFW 7768
7769 LLAGHPDVESRVVGDVLAAGGDIKRMDYLHAALTEAM 7879 frameshift
7881 RLYPPVPVDFKEALADDVLPDGTPVRARQRVIYYTYAIGRDPASWGDDAAAFRPER*MRA 8060
8061 GAFAGGESPFKYAVFNAGPRLCIGKRFAYTQMKTAAAAVLSRFAVEVVPGQEVKPKLT 8234
8235 TTLYMKNGLMV 8267

>aaaa01002589.1 (indica cultivar-group) 73% to AP003244 $F similar to CYP90D
21238 CKARPPAGSLGWPLVGETLQFISAAYSSRPESFVEKRCR 21110
21018 RYGKVFRSHLWGSPAVVSADAEASRAVLQSDASAFVPWYPRSLMELMGESSILVLGGAL 20839
20838 QRRVHGLAGAFFKSPELK 20785
17641 YELCIFCVQVITETLRIGNIISGIMRKAVRDVEVKGQGDVVIPKGWCVLVYFRSVHLDAN 17462
17461 IYDDPYAFNPWRWKERDMAAATTNSGSGFTPFGGGQRLCPGLDLARLQTSIFLHHLVTNF 17282
17281 TY 17276

>aaaa01002599.1a $FI (indica cultivar-group) ortholog of AP004326.2c $F 99%
12298 MAGIMDSTTASYYTTLLCGALLLAAVVFKLKTAAAFSRHNAGVNLPPGPWALPVIGSIHC 12119
12118 LLGSLPHHAMRELSRRYGPVMLLRLGHVRTLVLSSPEAAREVMKTHDVAFANRAVTPTAS 11939
11938 ILTYGARDIVFAPFGKHLRELRKLCALELLSPRRVRSFRHVREEEAARLARSVAAAASAS 11759
11758 SAVNVSELVKIMTNDVTMRAIIGDRCPQREEYLEALDKTMDLLAGFNLVDLFPGSPLARV 11579
11578 LGGRSLRTTKRVHEKLHQITEAIIQGHGIKDTVGDEHHECEDIL 11447
11446 DVLLRFQRDGGLGITLTKEIVSAVLF 11369
11213 DLFAGGSETTSTTILWAMSELMRSPHVMEQAKYEIRQVLQGKAMVSEADIEGRLHYLQLV 11034
11033 IKETLRLHPPVPIVIPRLCSKPNSKIMGYDIPQGTSVLVNVSAIGRDEKIWKNVNEFRPE 10854
10853 RFKDDIVDFSGTDFRFIPGGSGRRMCPGLTFGVSNIEIALVTLLYHFDWKLPSETDTHEL 10674
10673 DMRETYGLTTRRRSELLLKATPSY 10602

>aaaa01002599.1b $FI (indica cultivar-group) ortholog of AP004326.2b $F >99%
22237 MAGIVDTAAFCTLLCLLLTLVVFKLKTATSSRHNAGVNLPPGPWALPVIGSIHCLLGSLP 22058
22057 HHAMRELSRRYGPVMLLRLGHVRTLVLSSPEAAREVMKTHDAAFATRAVTPTASILTYGA 21878
21877 RDIVFAPFSKHLRELRKLCTLELLSPRRVRSFRHVRDEEAARLARSVAAAAPAVVNVSEL 21698
21697 VKIMANNIIMTAIIGDTCPQRDEYLEALDKTMDLMNGFNLIDLFPGSRLARVLGARSLRA 21518
21517 TKRVHQKLHQITDTIIQGHEIIEDGSVGDDTIQETVGTHNMHGHGHKCEDILDVLLRFHR 21338
21337 DGGLGITLTKEIVSAVLF 21284
20770 DLFAAGSETTSTTIIWAMSELVRTPHVMERAQSEIHQVLQGKTVVSEADIEGRLHYLQLV 20591
20590 IRETLRLHPPVPFLIPRLCSEANSKIMRYNIPQGAMVLVNISAIGRDEKIWKNANEFRPE 20411
20410 RFKDDMVDFSGTDFRFIPGGAGRRMCPGLTFGLSNIEIALASLLYHFDWKLPNDASSCKL 20231
20230 DMRETHGVTARRRTELLLKATPLYT 20156

>aaaa01002645.1a $PI (indica cultivar-group) sequence gap at 950 sequence 
similarity stops at 236 (80% identical to AAAA01002645.1b)
ortholog to AP005385.1b $P 99% 
949 PLMRLQLGGVPVVVASSPDAAREVTCTHDAAFASRPWPPTVRRLRPHREGVVFATYGAM 773
772 WRQLRKVCIVEMLSARRVRSFRRVREEEAASLAAAVAASLSSPPARRDAVNVSALVALAV 593
592 ADATMRVVIGDRLERREEFLESMTEAVRSFTGFSLDDLFPSSRIAAAVGGMTRRAEASHR 413
412 KGNELIESAIRQHEQVRDAMAAQGGGGAMEEDLLDTLLRIQKEGALDMPLTMDNIKAVI 236

>aaaa01002645.1b $FI (indica cultivar-group) no introns 40% to 71B23
ortholog to AP005385.1a $F 99%
2048 MEQVAYWFICACAFLALVLLVRLGAARRDVVRLPPGPWRLPVVGNLHQLMLRGPLVHRTMADLA 2239
2240 RGLDDAPLMRLQLGGVPVVVASSADAAREVTRTHDLDFASRPWPPTVRRLRPHREGVVF 2416
2417 APYGAMWRQLRKVCVVEMLSARRVRSFRRVREEEAARLVASIASSSSSSPTGHDGGAAP 2593
2594 AVNVSAPIAAAVADATMRAVIGDRFERREEFLESITEAVRSFTGFSLDDLFPSSRLAAAV 2773
2774 GGMTRRAEASIRKGHQLMDSAFRQHQQLRDAMAAQPHLDDCAMEEDLLDTLLRIQKEDNL 2953
2954 DVPLTTGNIKAVLLDIF 3133
3134 GARSDTSSHMVQWVLSELMRNPEAMHKAQTELRSTLQGKQMVSEDDFASLTYLKLVIKET 3313
3314 LRLHPMVPLLLPRECRQTCKVMGYDVPQGTTVFVNVWAINRDPRHWDEPEVFKPERFHSG 3493
3494 KIDFKGANFEYIPFGAGRRICPGMTFGHATVELMLAMLLYHFDWELPKGVAPNELDMTEE 3673
3674 MGITVGRKNALYLHPIVRVSLEQASMS* 3757

>aaaa01002713.1 $FI (indica cultivar-group) runs off end of clone 
aaaa01010047.1b (indica cultivar-group) ortholog to AL772426.1 AF140486
new 81 subfamily
3811 MEISQAFVFASLLLLLLLTWLLFHLLSYQAPPPNGDGGRRIPSPPALPVVGHLHLLKKPL 3632
3631 HRSLAALAARYGGGAGLLLLRFGARPVVLVSSQAATDECFTAHDAALAGRPGLASRRLL 3455
3454 TDGCPTIATAGHGARWRHLRRLATVHALCARRLAATSPARDAEARAMAARLYSSSSSSS 3278
3277 AASAVVVGVKPAAYGFVASVIMTMVAGERMAEEDVLRFKAITEAGLAAAGAANRQDFLPF 3098
3097 LRLLDFGRARRRLAGIAKERHDFGQRIVDEYRRRHRRRLAVAADDSSSSPPRRTVIGDL 2921
2920 LRQQESSPESYADEVIRTVCL 2858 (0?)
5877 SLLQAGTDTSASTIEWAMALLLNNPDVLRKATDEIDSVVGMSRLLQEPDLANLPY 6041
6042 LRCIITETLRLYPLAPHLVPHEASRDCMVAGHVIARGTMVLVDVYSMQRDPRVWEDPDKF 6221
6222 IPERFKGFKVDRSGWMMPFGMGRRKCPGEGLALRTVGMALGVMIQCFQWERLGKKKVDMS 6401
6402 EGSGLTMPMAVPLMAMCLPRVEMESVLKSL* 6494

>aaaa01002757.1 (indica cultivar-group) orth of AC104473.1 chr 3 77% to 90B
19732 RACRYGKIYRSSLFGERTVVSADAGLNRYILQNEGRLFECSYPRSIGGILGKWSMLVLVG 19553
19552 DPHREMRAISLNFLSSVRLRAVLLPEVERHTLLVLRAW 19439
16638 AYFFLFYVDISSMMFTVYFYCSLQSRAAILGVIERKMEERVEKLSKEDASVEQDDL 16471
16470 LGWALKQSNLSKEQILDLLLSLLFAGHETSSMALALAIFFLEGCPKAVQELRVQRIT 16300
15284 QVINETLRLGNVVRFLHRKVIKDVHYKGYDI 15105
15104 PSGWKILPVLAAVHLDSSLYEDPQRFNPWRWKVSR 15000
14088 SSSFMPYGGGTRLCAGSELAKLEMAVFLHHLVLNFRWELAEPDQAFVFPFVDFPKGLPIR 13909
13908 VHR 13900

>aaaa01002827.1 $FI (indica cultivar-group) one frameshift
12880 MAFFLVACLPWVCFILLSLYVFQLFADARRRLPPGPWPPKPLIGDLLALGKGDQQ 12716
12715 HRSLARLADRYGPVMSLRLGTVLTVVVSTPDAMREIFHKNKDNLAGRPTADAFNAMGHSA 12536
12535 NSLLGLEHPGVRWRAIRRFSTAELLAPRRLAALQPLCRDKVRGLVRGVSELAARGEPVHV 12356
12355 RRVALDMALSLI (fs) 12320
12322 LSAIYSVDLDPESTAVFRSVVEEAMLLIGTANLSDLFPAIAALDLQGVRRRVA
      ELFTITYRQYDEQVARRRPERDAGEAGKNDLLNVVLDMEREWQQKGSVLSHDAMRVLFT (0) 
8887  DLYGAGASTTSVLIEWAIADLLQNPESMRKIKEEITNVIGTNAQIQESDIARLPYLQAVV 8708
8707  KETLRLRAVAPLVPRRAEATIEVQGFTIPKGTNVILNLWAINRDARAWNDPDKFMPERF 8531
8530  IGNDINYLGQNFQFVPFGVGRRICLGLPLAQKVMYLVLGTLVHQFEWTLPEELKDTGIDM 8351
8350  TEKCGMVLCLANPLKVMAKKM* 8285

>aaaa01002847.1a $FI (indica cultivar-group) ortholog to AC087550.2a 99%
14507 MDDKLLQLLLLALAVSVVSSIVTISKLVYRATNKPRLNLPPGPWTLPVIGSLHHLVMRSP 14328
14327 SIHRSMRALAEKHGPLMQVWLGEVPAVVVSSTEAAEEVLKNQDARFADRFITTTLGAI 14154
14153 TFGGGDLAFAPYGERWRHLKMLCTQQLLTAARVRSFRRIREEEVARLVRDLAASAGGGSE 13974
13973 VAVNLSERVARLVNDIMVRCCVGGRSKHRDEFLGALCTALSQTSWLTVADLFPSSRLARM 13794
13793 LGTAPRRALASRKKMELILEQIIQEREEMTTDRSGDGEAGPTNECFLDVLLRLQK 13629
13628 EGDTPIPITMELIVMLLF 13575
12405 DIVSGGTETSTIVLNWTMAELIRTPRVMAKAHAEVRQTFQAKSTITEDDDISGL 12244
12243 TYLKMVIKESLRMHCPVPLLGPRRCRETCKVMGYDILKDTTVFVNVWAMCRSSIYWNDAE 12064
12063 EFKPERFENKCIDYKGSNFEFVPFGSGRRMCAGMNLGMADVEFPLASLLYHFDWKLPDGM 11884
11883 SPEDIDMQEAPGLFGGRRTSLILYPITRVAPSDLQVI 11773

>aaaa01002847.1b $FI (indica cultivar-group) ortholog to AC087550.2b >99% 1 diff
21763 MEDKRPLALTVLSVSVLIAVVISKLVSYATKPRLNLPPGPWKLPVIGSLHHLVGSHAIHR 21584
21583 SMRALAEKHGRHHLMQISLGEVFAVVVSSPEAAEEILRNQDVTFADRFLSTTIGVITFGG 21404
21403 NDMAFAPYGERWRQLRKLCTLELLSAARVRSFRRIREEEVARLVRDLAASAAAGEAVNLS 21224
21223 GRIAKLINDVVVRCCVGGRSEHRDEFLDALRTALDQTTWLTVADVFPSSKLARMLGTAPR 21044
21043 KALASRKKIEHILEQIIQERKRIMDRSSHGGDGDGEAMNTSECFLDVLLRLQKDGNTPIP 20864
20863 ITNEVIVVLLF 20831
18797 DMFSGGSETSSSTLIWTMAELIRKPKVMAKAHVEVRQAFQGKNTITEDDGVNELTYLKMV 18618
18617 IKESLRMHCPVPLLGPRKCRETCKVMGYDIPKDTTVFVNAWAICRDPKYWDDAEEFQPER 18438
18437 FENKSIDFKGSNFEFLPFGSGRRMCAAMNLGIANVELPLASLLYHFDWKLPDGMMPEDVD 18258
18257 MQDAPGILVGKRSSLIMCPVTRVAPSNPQVIAS 18159

>aaaa01002889.1 i (indica cultivar-group) ortholog of AL606442.1 $F >99% 1 diff
10926 MASLMEVQVPLLGMGTTMGALALALVVVVVVHVAVNAFGRRRLPPSPASLPVIGHLHLLR 11105
11106 PPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIRSHEAKISERPLTAVARQFA 11285
11286 YESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRAGLVSLLRHVLSQPEAEAVD 11465
11466 LTRELIRMSNTSIIRMAASTVPGSVTEEAQELVKVVAELVGAFNADDYIALCRGW small seq gap
      DALLEEMIRHKEEARMRKKTDTDVGSKDLLD 11825
11826 ILLDKAEDGAAEVKLTRDNIKAFII 11900
11999 DVVTAGSDTSAAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRLPYLQAAY 12178
12179 KETLRLRPAAPIAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLEFRPERFL 12358
12359 AGGGGEGVEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCMDNKLIDM 12538
12539 EEADGLVCARKHRLLLHAHPRLHPFPPLL 12625

>aaaa01002943.1 (indica cultivar-group) orth AP003232.1h $F chr 1 98%
20140 LSILPLLYFLCQRNDPKKQPHAHGLKSYPVVGIVPHFTKNKDRFLEFTTEIMK 20298
20299 RSPTQTMSFKALGLTGGGVITANPANVKYTLKTNFGNYPKGELAVSMVVDFLGHGIFNSD 20478
20479 GEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVERLLPLLERAERDGRTLDVQDVLERFA 20658
20659 FDNICQVAFDEDPACLAEDSMARP
20742 FMRAFNDAQIAVRDRFMSPVKSLWRFKRLFNMEPERRMREALATIHGFAERIVRERRERG 20921
20922 KAGLARSDDFLSRFAASGEHSDESLRDVVTNFLLAGRDTTSSALTWFFWVLSGRP 21086
21087 DVEDKIVRALHAVRRASGSTSDATFSFDRADR 21182

Alt. Ihelix to PKG region orth AP003232.1h $F 98%
21223 SDDFLSRFAASGEHSDESLRDVVTNFLLAGRDTTSSALTWFFWVLSGRPDVEDKI 21387
21388 VRALHAVRRASGSTSDATFSFDELRDMQYLHAAITESMRLYPPVAMDTHSCKEDD 21552
21553 FLPDGTFVGKGWLVTY*AYAMARVET 21630

>aaaa01002989.1 $FI (indica cultivar-group) 91% to AP004233.1 
6020 MEQAAGLVYQLFQQEMFPWTFSVLALFPFLLL frameshift
     SLHYLATNNRTPTTCKETKNHHPPPPSPPRLPIIGHLHLIGDLLHVSLRELA 5770
5769 HRYGPDLMLLHLGQVP (?)
5107 NLIVSSPRAAEAVLRTHDLVFVSRPYSLIADILLYGPSDIGLSPYGEQWRQSRRIVTTHL 4928
4927 LTNKKVRSYRVAREEE 4871 (0?)
4088 VHKVMAKVHELSTKGMAVDMTELFSTFSNDLICRLVSGKNFQGDDGRNKLFRQLFKANS 3909
3908 VLLAGFNLEDYYPSLARLKAVSRVMCAKARKTRKLWDELLDKIIDDRMSKQQCEHDRGND 3729
3728 DQDEMDFVDVLLLQERGITREHLKAIL 3648 (0?)
3552 DMFQAGTETTSVVLVFAMAELMHKPHLMAKLQAELRTNISKQGQELLTECDLTNMTYLNA 3373
3372 VIKETLRLHPPTPLLLPHLAMADCDIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLSE 3193
3192 RFVDGGSAANVDLTGTDFQFLPFGAGRRICPGINFASASMEIILANLLYHFDWDVPAEAA 3013
3012 IDKAGIDMAEAFGLSVQLEEKLLLVPIEYKDSM 2914

>aaaa01002996.1a $FI (indica cultivar-group) ortholog of AP004001.d >99%
13279 MEEPTSCYGYYHYLALAVAVLVLVRVTRTRGGGSDGVRLPPGPWRLPVIGSLHHLAGKPL 13458
13459 VHRALADLARRMDAPLMYLRLGEVPVVVATSPGAAREVMRTHDVAFATRPVSPTVRIMTA 13638
13639 DGEGLVFAPYGALWRQLRRIAILELLSARRVQSFRRVREEEAARLAAAVAAAAPHGEAAV 13818
13819 NVSERIAVLIADSAVRAMIGDRFKKRDEFLEALAEGLKLVSGFSLADLFPSSWLASFVTG 13998
13999 AARRAQENHRKNFELMDRAIEQHQERRAAAAAASGDVVEDDDLVDVLLRIQKGGGLDVPL 14178
14179 TMGIIKAVIL 14208
14345 DLFSAGSETSATTIQWAMSELMRNPRVMKRAQAELRDNLQGKPKVTEEDLADLNYLKLII 14524
14525 KETLRLHLPAPLLLPRESRESCKIFGYDVPKGTTVFVNAWAIGRDPKYWDDPEEFKPERF 14704
14705 EDSKIDFKGLDFEFLPFGSGRRMCPGIMFAQPNIELALATLLYHFDWSLPAGVKPSELDM 14884
14885 TEEMGITVRRKNDLYLHAVVRVPLHATTP 14971

>aaaa01002996.1b $FI (indica cultivar-group) ortholog of AP004001.1e 99%
16497 MAQDVAEYLSIFLALVVAPLLLLRVARRARGNGAGRPRLPPGPWRLPVIGSLHHLMGKPQ 16676
16677 VHRAMADLARRHGAPLMYLRLGEVPFVVASSPDAAREVLRAQDANFASRPWSPTLRVMMA 16856
16857 DGKGLTFARHGAHWRLRKICVLELLGPRRVRSFRRVREEEVARLLAAVAAAAAAGADAVV 17036
17037 NVSERAAVLVTDTTVRAMIGDRFEMRDEYLEGVAEVGKLLLGLSLGDLFP 17186
17187 SSRLASLVSGTARRAAASHRKMFELMDCAIRHHQERKAAMDADEDILDVLLRMQKEGGHD 17366
17367 APLTMGDVKDTIL 17405
17534 DLFAAGTETSTATLQWAMSEVVRNPRIMQKAQAELRNKLQGKPSVTEDDLVGLTYLKLVI 17713
17714 KETLRLHPAAPMLVPRECGESCKVLGYDVPRGTNVLINAWAIGRDPNYWDDTETFKPDRC 17893
17894 ENNKYDFRGTDFEYIPFGSRRKICPCPAFTHAILELALAALLYHFDWELPCGVAQ 18058 frameshift
18055 SGEVDMAEETGVVVRPKNDLYLRPVVRVPPGAASSGNGGT 18174

>aaaa01003020.1 $PI (indica cultivar-group) ortholog of AP004796.1 100% AP004991.1 100%
1825 VDSYEHIRAEEIRALVRNLFGCASHAVAVRECLVNATLRNILHMSVGEKWSGVYGSADGEVFRR 2016
2017 TESSAVTMEWAMAELLRCPDAIATATDELDRVVGRARWVAESDLPDLPYVDAVVKGALRL 2196
2197 HPVGPLLVPHHAMEDTVAACNDVPVGTHVLVNVCAIARNPTSWPDRLDVFLPERFLPGGGA 2379

>aaaa01003099.1a (indica cultivar-group)  Nterm aa 494
ortholog of AP005448.1a 100%
7681 TISDTMWLTTVALLLTTVVIWTALQKRKRGEACPAAVAPPPIVQGTALVRFLRAMARDG 7857
7858 PLEVIREQLAKLGSVFMASAPLGLFKVTFLVGAEL 7962

>aaaa01003099.1b (indica cultivar-group)  Nterm aa 3160
ortholog to AP005448.1b 100%
10626 VTSSTIARGAMSWVAATVALLLTTAVILTALQKRKISSPAAAAPPVVRGAGLVRFA 10793
10794 RAMARDGPLEAIREQQAKLGSVFTAIAPFGLFKVTFLIGPEVSSHFYLAPESEMGQGSIY 10973
10974 RFTVPLFGPEVGYAVDPDTRAEQMRLFWDVLKPRSIEARVGAMAEEVQ 11117

>aaaa01003099.1c (indica cultivar-group)  Nterm aa 61160
ortholog to AP005448.1b 100%
11261 DGPLEAIREQQAKLGSVFTAIAPFGLFKVTFLIGPEVSSHFYL 11437
11438 APESEMGQGSIYRFTVPLFGPEVGYAVDPDTRAEQMRLFWDVLKPRSIEARVGAMAEEVQ 11617

>aaaa01003099.1d (indica cultivar-group)  Nterm aa 61160
ortholog to AP005448.1b 100%
11761 DGPLEAIREQQAKLGSVFTAIAPFGLFKVTFLIGPEVSSHFYL 11937
11938 APESEMGQGSIYRFTVPLFGPEVGYAVDPDTRAEQMRLFWDVLKPRSIEARVGAMAEEVQ 12117

>aaaa01003099.1e (indica cultivar-group) nearly  gene, runs off end
ortholog to AP005448.1b $F 99% plus one frameshifted region
21127 LQKRKISSPAAAAPPVVRGAGLVRLRARHGEGRAAGGDPRAAGEAGERVTAIAPF 20963
20962 GLFKVTFLIGPEVSSHFYLAAESEMGQGSIYRFTVPLFGPEVGYAVDPDTRAEQMRLFWD 20783
20782 VLKPRSIEARVGAMAEEVQ 20726 (0?)
18574 NYFSRWGEQGTVDLKKELERVLMLIASRCLLGREVRESMVDEVYELFRDLDNGLHLIS 18401
18400 TMLPYLPTPAHRRRDRARQRLGEIFTEVIRSRRNSGTAGNGDDVLQRLIDGRYKD 18236
18235 ERALTDVEVVGLLVALVFAGKHSSSSVSTWTGINLLSHPNHLAAVIAEQDRLMASRARTD 18056
18055 DDHDRVNYDTVQEMTTLHRCIKEALRLHPPAVAMFRQARKHFTVQTKEGKEYTIPGGHTV 17876
17875 LSTILVNHHMPNVYKDPHVFDPSRFARGRGEDKAAGPFSFLAFGAGRHSCAGESFAYTQI 17696
17695 KVIWSHLLRNFELKMVSPFPETSWRMVTPEPKGTVMISYRRR 17570

>aaaa01003110.1 $FI (indica cultivar-group) ortholog of AC073867.4 $F 99%
15437 MADMVKFTMEWLQDPLSLAIVVTVAVLIMRMQRRRAAPFPPGPKPLPIVGNMAMMDQLTH 15616
15617 RGLAALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATTAIAYLTYDRA 15796
15797 DMAFAHYGPFWRQMRKLCVVKLFSRRRAETWLAVRDESAALVRAVAASRGEAAVNLGELI 15976
15977 FNLTKNVIFRAAFGTRDGEGHDEFIAILQEFSKLFGAFNIGDFIPWLSWADTNGINARLV 16156
16157 AARTALDRFIDKIIDEHMERGKNPDDADADMVDDMLAFLAEAKPHAGKAAAAAAAAGDGA 16336
16337 DDLQNTLRLTRDNIKAIIM 16393
20528 DVMFGGTETVASAIEWAMAEMMHSPDDLRRVQEELAAVVGLGRDVAESDLDKLPFLRC 20701
20702 VIKETLRLHPPIPILLHETAADCLVAGYSVPRGSRVMVNVWAINRDRAAWGPDADAFPPS 20881
20882 RFAAGAAAEGLDFRGGCFEFLPFGSGRRSCPGMALGLYALELAVARLAHGFNWSLPDGMK 21061
21062 PSELDMSDIF 21091

>aaaa01003137.1 $FI (indica cultivar-group) ortholog to AU173996.1
44% to 76C4
2741 MDVNQLWLLWATLAVSLLYYISNRRRRVGGRRRCPPGPMPLPLVGNLLNLRGHLPPALAR 2920
2921 LARTYGPVMMLKMGLTTTVVISSGDAAREAFTKHDRHLAARTVLDVTRSLDFADRSMIWL 3100
3101 PSSDTVWKTLRGVTAASIFSPRGLAALRGVRESKVRDLVGYFRGRAGEVVDVRHAVYGCM 3280
3281 LSLVSSAFFSVDVVDLSAESENEFRQSMTFLMEVVSKTNVSDFFPFLRPLDLQGWRRLTE 3460
3461 RYLGRVTCFLDDVIDRRFAADASANRHGDFLDSLLDLVSTGKIVRENVTTILLDVFIAGS 3640
3641 DTITATVEWAMAELLRNPSEMAKVRAEMDGALGGKKTVDEPDIARLPYLQAVVKEAMRLH 3820
3821 PAAPLLLPHRAVEDGVEVGGYCVPKGSMVIFNVWAIMRDPAAWERPEEFMPERFIRRGDD 4000
4001 DEVDFWGKTFEFIPFGSGRRVCAGLPMAERVVPFMLASLLRAFEWRLPDGVSAEELDMRH 4180
4181 RFTIANFRAIPLKAVPVVVS* 4243

>aaaa01003187.1a (indica cultivar-group) orth of AP003278 $F chr 1, 82% to 72A22
12486 FAGADTTSVLLTWTMLLLSMHPEWQDRAREEILGLCGKNKPDYDGLSRLKIVSIL
      VTMILYEVLRLYPPFIELTRKTYKEMEIGGIT 12130
12129 YPAGVIINLPVMFIHHDPEIWGSDVHEFKPERFSEGISKASKDLGAFLPFGWGPRICIGQ 11950
11949 NFALLEAKMALCLILQRLEFE 11887

>aaaa01003187.1b (indica cultivar-group) orth of AP003278 $F chr 1, 82% to 72A22 these two seem identical
20687 FAGADTTSVLLTWTMLLLSMHPEWQDRAREEILGLCGKNKPDYDGLSRLKIVSIL
      VTMILYEVLRLYPPFIELTRKTYKEMEIGGIT 20331
20330 YPAGVIINLPVMFIHHDPEIWGSDVHEFKPERFSEGISKASKDLGAFLPFGWGPRICIGQ 20151
20150 NFALLEAKMALCLILQRLEFE 20088

>aaaa01003216.1a (indica cultivar-group) runs off end of clone (partialI)
ortholog of AP005419.1
2851 DLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPY 3015
3016 IEAIVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEF 3195
3196 VPERFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVK 3375
3376 EDLSMEEIFGLSMPRKFPLEVVVEPKLSSHLYKGD* 3483

>aaaa01003216.1a (indica cultivar-group) ortholog to AP005570.1a >99%
2851 DLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEAIV 3030
3031 KETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFVPERF 3210
3211 LGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDLSM 3390
3391 EEIFGLSMPRKFPLEVVVEPKLSSHLYKGD* 3483

>aaaa01003216.1b (indica cultivar-group) ortholog to AP005570.1c >99%
identical to exon 2 of AAAA01003216.1d (duplicate)
6615 DLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLTYVDAI 6439
6438 VKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEEFMPER 6259
6258 FIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVTREQLS 6079
6078 MEEIFGLSTPRKFPLEAVVEPKLPAHLY 5995

>aaaa01003216.1c (indica cultivar-group) ortholog to AP005570.1b >99% exon 1
9579 MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH 9400
9399 SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW 9220
9219 SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASGRVVALKDYLSAAS 9040
9039 LNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWLGWLDLQ 8860
8859 GYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDALLNVASDPSLEVKFSRD 8680
8679 SVKAFTQ 8659

>aaaa01003216.1d (indica cultivar-group) ortholog to AP005570.1c >99%
14529 MLPPWASFVAVVLATVLFLKTVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLS 14350
14349 KKYGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPY 14170
14169 GAYWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGVVVLKDYLSTVSLNV 13990
13989 ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRM 13810
13809 KKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREGVKAFTQ 13627
12917 IDRYVQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLT 12738
12737 YVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEE 12558
12557 FMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVT 12378
12377 REQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLY 12279

>aaaa01003237.1a (indica cultivar-group) 77% to AP003850.1 $F chr 7 gene 2
259 VFTAQSVTHLDANIFPEPSNFDPARFENNSSIPPYCFVPFGGGPRMCPGNEFARTETLV 435
436 TMHYLVTQFRWK 471

>aaaa01003237.1b (indica cultivar-group) orth of AP003850.1 $F chr 7 gene 3
5921 LALLIPILLHVVIRRKYSSYNLPPGSLGFPVIGQTISLLRALHNNTDYQWCQDR 6082
6083 IEKYGAVSKMSLFGSPTVLLAGPAANHFVFSNQDLIFTETKAINALVGRSILTLSGE 6253
6254 ELKQVRGALHGYLRPEMVTKYMRKMDEEVRRHIDLNWVGHKTVT
     VASLARRLAFDIICSVIFGQGVGPIREALAADFETMVKAM 6613
6614 LSIPVNIPFTKFNKGLNGSRRIRKVLRQIARDMEGALQQGYSSSADDFFTYMLVLRSKGT 6793
6794 HTLTVEDIVDNAIVLLAAGYETSSVLITFLIRCLANEPDIFGKITD
     EQEEIARSKGPNEPLTWDDVSRMKYTWKVALETLRTISPI 7150
7151 FGSFRTAIKDIEYQGYHIPKGWQVSI 7228
7787 HLDGKFFNDPIKFDPTRFDNQSLIPPYCFVPFGGGPSMCPGNEFARTETLVAMHYLVRQ 7963
7964 FRWK 7975

>aaaa01003237.1c (indica cultivar-group) 73% to AP003850.1 $F chr 7 gene 2
18910 IALFIPILLHLVTRFKYSSYNLPPGSLGFPFVGQSISFLRALRSNTDHQWYQGR 19071
19072 IGKYGPVSKMWLFGSPAVLMAGPAANRFIFSNKDLLF 19182
19881 LTLDIICSVIFGQEAGSVREALATDFPAMVRAALSIPVKIPFTRFSRGLSASQRIRELLR 20060
20061 GIARERETLLQQQQAHGASAADDFFTYMLALRAEGAHSLTVEDIVDNAIFLLIAGYETTS 20240
20241 VLITFMLWHLDKEPEVLSKITEGEQL
      IARNKGPEDALTWDDVSRMKYTWKVAMETLRTIPPIFGSFRTATRDIEYQGY 20569
20570 HIPKGWMV 20593

>aaaa01003239.1a $PI (indica cultivar-group) exon 2 ortholog to AP004346.1c 96%
2517 DAFAGGIDTTVVTTTWIMSELMRNPTVMQ 2431 frameshift
2432 KAQAEVHNIVKNKSKVYEENIQNMKYLKMIIKENCKLHPPGTLLIPRHTMKTCTIGGYN 2253
2252 VPSKTRIYVNVWAMWRDPNIWDNPEQFYLERFEDKGIDFRGSHFELLT 2109 (?)
1820 FGSGQRICPGIAMGVANVELVVANLLYCFDWQLPKGTKEEDIDMDEIG*LAFRK 1659

>aaaa01003239.1b i (indica cultivar-group) exon 2 ortholog to AP004346.1b 95%
17640 LQDAFVGGIDTTAVTTTWIMSELMRNPRVVQKA*AEVHNIVKNKSKVCKEDIQNMKYLKM 17461
17460 IIKENFRLHPPGTLLIPRQTMKTCTIGGYSVPSETRIYVNVWAMGRDPNICDNPEQFYPE 17281
17280 RFEDKGIDFRGSHFELLPFGSGQRICPGIAMGVANVELVVANLLYCFDWQLPKGMKEEDI 17101
17100 DMDEIGQLAFRK 17065

>aaaa01003282.1 (indica cultivar-group) 87% to AL607001.1 chr 4, gene 2
15979 YAALCVVTLLIGWLTHWVYKWMNPPCNGRLPPGSMGFPVVGETFQFFRASPSVDMPSYYK 15800
15799 QRLE 15785
15612 RYGPLFKTSLVGQPLVVSLDPEVNRFIFQQEGKLFRSWYPETANNIFGKKSLTTYNGTVH 15433
15432 KFIRSFASKLFGLENLKESLLPELENSMRESFASWASKPRIEVQDGVSD
      MIFDLVAKKLIGLNVTQSRELRKNFQEFFQGMVSFPIYFPGTSFYRCMQ 14961
14802 QGRKNVRNTLTDVMKERLSAPEKKYGDLVDLIVEELQSEKPVIDENFAIDALAALLFTSF 14623
14622 ATLSSTLTVALKFLNDNPKIVEEL 14551
14129 EEHDVILKKREVMNSGFTWEEYKSLKFTTQVIS 14031
13755 YTIPSGWLVMISPMAVHLNPELFEDPLKFDPWRWTVSGKHF 13633
MPFGGGIRLCLGAEFSKLFIALFLHILLTEYR
WKEIEGGEVLRISEIMFPQGYHIQL 13182

>aaaa01003340.1 $FI (indica cultivar-group) ortholog of D48181 (less the Nterm) about 50% to 87A2
AAAA01009800.1 (indica cultivar-group) ortholog of D48181 Nterm
4887 MAVLASWLIRLVSLKWNSSHPCKADEGSRLPPGSRGLPLLGESLEFFTSSTSLELPVFFKRRLNR 5081 (2)
11460 YGPVFRTNMVGQDLIVCLDPEVNSFVFQQEERLFQCWYPDSFMRIIGADNIITTLGSSHK
      YIRNLILRLFGPENLRRAMLQDVHRTAQASLLSWLDRPSIELKDAVSS (0?)
      MIFSVTAKKLISYDSLASDGKMWKQFDAFIRGLLAFPIGIPGTAFYKCMQ (?)
Extra 25aa exon here? See 87A2
      SIDFIDVLLEELNEEKPLISENVALDLIFLLLFASFETTASAITAVVRFLTDNPEALQEL (0?)
      EEHDNIQKRRVDLNSEITWEEYKSMKFTSH (0?)
      VIHEALRLANIAPVMFRKATEDVHIK (1?)
13238 GFFIPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWK 13345 (0)
13765 DTAEPTGGASKDFMAFGGGLRLCVGADFAKLQTAIFLHCLVTKYR 13899 (2)
14151 WKAIKGGTMVLGPGLRFPEGFHIQLFPKP* 14240

>aaaa01003402.1 (indica cultivar-group) orth of AP000616.1 $F chr 6 like CYP88
16136 VYRTFMFSSPTILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDDHRRIRK 16315
16316 LTAAPINGFDALTTYLSFIDQTVVASLRRWSSPESGQVEFLTELRRMTFKIIVQIFMSGA 16495
16496 DDATMEALERSYTDLNYGMRAMAINLPGFAYYRALRARRKLVSVLQGVLDGRRAAAAKGF 16675
16676 KRSGAMDMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPDI 16855
16856 FAR 16864

>CYP88A5 AP000616 = aaaa01003402.1 100% to indica seq above
MAAAWAAGDLWVLAAAVVAGVVLVDAVVRRAHDWVRVAALGAERRSRLPPGEMGWPMVGS 125254
MWAFLRAFKSGNPDAFIASFIRR 125323
FGRTGVYRTFMFSSPTILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDD 128171
HRRIRKLTAAPINGFDALTTYLSFIDQTVVASLRRWSSPESGQVEFLTELRRMTFKIIVQ 128351
IFMSGADDATMEALERSYTDLNYGMRAMAINLPGFAYYRALRARRKLVSVLQGVLDGRRA 128531
AAAKGFKRSGAMDMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFL 128711
QENPDIFARAKAEQEEIMRSIPAT 128891
QNGLTLRDFKKMHFLS 128939
KVVDETLRCVNISFVSFRQATRDIFVNG 129528
YLIPKGWKVQLWYRSVHMDDQVYPDPKMFNPSRWE 129811
GPPPKAGTFLPFGLGARLCPGNDLAKLEISVFLHHFLLGYX 130056
LKRANPKCRVRYLPHPRPVDNCLATITKVS 130411

>aaaa01003423.1 (indica cultivar-group) 55% to AP003244 $F
10043 FTFLQVINETLRVGNIISGVFRRANTDIHYK
10248 DYTIPKGCKIFASFRAVHLNNEHYENARTFNPWRWQ
      INNKLQNAVGANIFTPFGGGPRLCPGYELARVVVSIFLHHLVTR 10607
10608 FR 10613

>aaaa01003438.1 $FI (indica cultivar-group) ortholog to AP003723.1 100% Cterminal part
AAAA01022256.1 (indica cultivar-group) 100% Nterminal part
1463 MVDMNDVLLVVSAAVLAAMWWRRCSRTGGADGLPPGPPGWPVVGNLFQVILQRRPFMYVV 1642
1643 RDLREKYGPIFTMRMGQRTLIVVTDADLIHDALVKQGAAFASRPEDSPTRLLFSVGKCTV 1822
1823 NSAPYGPLWRALRRNFVAEIVSPPRVKGFSWIREWAVGSHLRRLRAEFAATGAVRMMANC 2002
2003 RLSICSILICICFGAKIPDELIREIEEVLKDVMMMTMPKLPDFLPLLTPLFTKQLAAARE 2182
2183 LRRRQLGCLAPLVRARREFIRGGGERNADGNTVVGGVEMVSAPGEAYVDSLFDLEPPGRG 2362
2363 KRLGEDELVTLCSEVMSAGTDTSATALEWAMMHLVLDAGVQDKLYGEVVSKVGTTARITE 2542
2543 ADVEAMPYLQ 2572
 463 AVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENPATWPDPEA 633
 634 WRPERFLEGGEGFDTDITATRALRMMPFGAGRRICPAATLGVLHIQLMLANMVREFRWVP 813
 814 PAGEGPPDPTETFAFTVVMKNPLRAALVERRVGGELATGGGGGAAASA 957

>aaaa01003512.1 i (indica cultivar-group) ortholog to AP004346.1a 95%
6414 SYNYLDVAFAPYSDYWREMRKLFVVELTSVSRVHSFAYARTAEVARLVDTLAASPPGVPF 6593
6594 DISCTLYQLLDGIIGTVAFGKVYGAAQWSTERAVFQDVLSELLLVLGSFSFEDFFPSSAL 6773
6774 ARWGDALAGVERRRRRIFRQVDGFLDSVIDKHLEPERLSAGVQEDMVDALVRMWREQQDR 6953
6954 PSGVLTREHIKAILM 6998
8541 NTFAGGIDTTAITAIWIMSELMRNPRVMQKAQAEVRNTVKNKPLVDEEDIQNLKYLE 8711
8712 MIIKENFRLHPPGTLLVPRQTMQPCLIGGYNVPSGTRVFINIWAMGRDPMIWDNPEEFYP 8891
8892 ERFEDRNIDFRGSHFELVPFGSGRRICPGIAMAVASLELVVANLLYCFDWKLPKGM*EED 9071
9072 IDMEEIGQLSFHRKVELFIVPVKHEQCEP*DQLMGH 9179

>aaaa01006865.1 (indica cultivar-group) orth of AC090482.3 $F 
aaaa01028153.1 (indica cultivar-group) orth of AC090482.3 $F
aaaa01094999.1 (indica cultivar-group) 93% to AC090482.3 $F orth?
aaaa01003531.1 (indica cultivar-group) orth of AC090482.3 $F
 5277 YAALVTAGMAVLATACWLVFVKRNTSRPSEADGRRLPPGSRGFPIIGETLEFLTESPANQ 5456
 5457 LPAFFKRRLDR 5489
445 RYGPIFKTNMIMEDLIVSLDPEVSNFVLQQEEKLFQIWYPGSFMRINGAESIITTHGLLH 266
265 RHIRNLVLRIFGPRNLRQEIIQEMHKTAEASLSSWLNYPSIELKEAVSS 116
18190 MIFSVTAKKLISYDSSTSDGKMWKHYDAFAQGLITLPLCIPGTAFYKCMQ
14945 GRKNVMKMLKEMLNERKKIEGRHESIDFLDVLIEEVKEDNPSMTENTALNLLFSLLFG 14766
14765 SFDTTSSGITGMLKFLTDNPEALRELT 14670
1696 ASKDFMPFGGGLRLCVGAHFAKLQMAVFVHCL 1791

>AC090482.3 $F 45% to 87A2 in the CYP85 clan 2 diffs with AQ868994
       MAVLATACWLVFVKRNTSRPSeadgr (frameshift?) 
135052 RLPPGSRGFPIIGETLEFLTESPANQLPAFFKRRLDR 134942 
116833 RYGPIFKTNMIMEDLIVSLDPEVSNFVLQQEEKLFQIWCPGSFMRITGAESIITTHALLHR 116651
116650 HIRNLVLRIFGPGNLRQEIIQEMHKTAEASLSSWLNHPSIELKEAISS 116519 (0?)
113034 MIFSVTAKKLISYDSSTSDGKMWKHYDAFAQGLITLPLCIPGTAFYKCMQ 112876 (0?)
98384  GRKNVMKMLKEILNERKKIEGRHESIDFLDVLIEEVKEDNPSMTENTALNLLFSL 98211
98210  LFGSFDTTSSGITGMLKFLTDNPEALRELT (0?)
97814  EHNNIRRRRADLNSEITWEEYKSMKFTSH 97704 
97599  VIHEALRLASITPMMFREAIEDVHIK 97519 (1)
96537  GFAIPKESKIMICPSTVHLNPVVYEDPI 96457 frameshift
       TFNPLRWK (0)
95926  DIAEPAGGASKDFMPFGGGLRLCVGAHFAKLQMAVFVHCL 95831
95446  LSTLVSWKAIKGGRMVLSPGLRFLEGFHIQLFPKD* 95339

>aaaa01003554.1 (indica cultivar-group) ortholog to AP005285.1 gene 4
3364 MDTSTLLIALTLVLLLLLLLLLTARRRRSGRPRLRLPPEPAGLPLVGHLHLFRKPLHRTL 3543
3544 ARLAARHGAVFRLRLGSRRVAVVVSSAPAAEECLGAHDVAFAGRPRLPSAGILSYGWSTM 3723
3724 GTAAYGPYWRHVRRVAVAEILSAHRVRQFAGAHDREARATARRLCRAASRQRHHGAGAAA 3903
3904 GRVRVELKSRLFELLMNTMMAMICDKTYYGA (2) 3996
4070 DDDGEVSEEARWFREMVEETMALSGASTVWDFLPAVLRWVDVGGVGRRLWRLRESRTRF 4246
4247 LQGLIDDQRKEMEHDGDGRELPAAAARPRSMIGVLLSVQRQ 4369 100 ns in seq
missing Cterminal 

>aaaa01003568.1 $FI (indica cultivar-group) 
15269 MALSSMAAAQESSLLLFLLPTSAASVFPPLISVVVLAALLLWLSPGGP 15412
15413 AWALSRCRGTPPPPGVAGGAASALSGPAAHRVLAGMSRAVEGGAAVMSLSVGL 15571
15572 TRLVVASRPETAREILVSPAFGDRPVKDAARQLLFHRAMGFAPSGDAHWRGLRRVSAAHL 15751
15752 FGPRRVAGSAPEREAIGARIVGDVASLMSRRGEVPLRRVLHAASLDHVMATVFGKRHGDL 15931
15932 SIQDGELLEEMVTEGYDLLGKFNWADHLPLLRWLDLQGIRRRCNRLVQKVEVF 16090
16091 VGKIIQEHKAKRAAGGVAVADGVLGDFVDVLLDLQGEEKISDSDMIAVLW
16332 EMIFRGTDTVAILMEWVMARMVMHPEIQAKAQAEVDAAVGGRRGGVADGDVASLPYIQ 16505
16506 SIVKETLRMHPPGPLLSWARLAVHDARVGGHAVPAGTTAMVNMWAIAHDAAVWPEPEAF 16682
16683 RPERFSEGEDVGVLGGDLRLAPFGAGRRVCPGRMLALATAHLWLAQLLHAFDWSP 16847
16848 TAAGVDLSERLGMSLEMAAPLVCKAVAR 16931

>aaaa01003683.1 (indica cultivar-group) orth AP000391 $F 1 diff
     GDFLTTAMKDLFGDGIFATDGDMWRHQRKLASYEFSTKVLR 4183
3882 QDLLMRATMDSIFKVGFGFELNTLSGSDESGIQFSKAFDEANSLVYYRFVDIMWKLKR 3709
3708 YLNIGSEAKLKRNIQIIDSFVMKLIHQKR 3622
3278 EDILSRFVLASEQDPGTMDDRYLRDIVLNFLIAGKDTTGNTLTWFFYLLCKNPIVQDKVA 3099
3098 LEIREFVEWSKEDNTIESFTKRLDEGAISKMHYLQATISETLRLYPAVP 2952
2415 QDAKMADEDDVLPNGYRVVKGDGINYMIYAMGRMTYLWGEDAQEFRPERWLVNGVYQQES 2236
2235 PFKFVSFN 2212

>aaaa01003782.1 $FI ortholog of AC068924.9a 99% 5 diffs in two locations
15354 MDNLYLILGAILAAAVVPFILFRGNGGKRGRRLPPGPPAVPLLGSVVLLTKALTDVEPEL 15175
15174 LLQRLIARYGPIVSLRMGTRVSVFVADRRLAHAALVEGGAALADRPGVPASRLLGENDNI 14995
14994 ITRAGYGPVWRLLRRNLVSETLHPSRARLFAPARYWVHRVIVDKLAASGQAPHDVVDTLQ 14815
14814 YAMFCLLVNMCFGERLDEATVRAVEDAQRDLLIYITSQMAVFAYFPAITKHLFRGRLEKI 14635
14634 YALRRRQRELFMPLINARREYKKHGGGEKTTNKETTLEHSYVDTLLDIKLPEDGNRALT 14458
14457 DDEIIKLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLHDEITAKTGDDQPEVTEEDV 14278
14277 HGMPYLRAVVLEGLRKHPPGHFVLPHRAAEDVEVGGYLIPKGATVNFMVAEIGRDEREWA 14098
14097 KPMEFIPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLSFAMHHLEYFVANMVREF 13918
13917 EWKEVAGDEVEFAEKREFTTVMAKPLRARLVPRRTT 13810

>aaaa01003818.1 (indica cultivar-group) 86% to AP003289 $F similar to 94C1
18138 GSINDDKYLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRDEVFRVAGGRDPTA 18317
18318 ASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGTRVTYHAYAM 18497
18498 GRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCIGKDLAIMEMKAVIVAV 18677
18678 VLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR 18788

>aaaa01003868.1 $FI (indica cultivar-group) ortholog to AP004769.1 $F 100%
5261 MEETWLFLLFSISLVAVLLATARRRRSSSIKARLPPGPSPLLFLAKFLRLRRSIFDLGPL 5440
5441 LRDLHARHGPVISIRLFGTTLVFVADRRLAHRAL
5545 VQGGSTFADRPPLPELGRLFTSDTRDINSSPYGPYWRLVRRNLASEALSPARVALFA 5715
5716 PARRRARDVLVRGLRDRGGDGSRPVELRPLLRRAMFELLLYMSLGARLAPEALEEVERLE 5895
5896 LWMLRAFTSFPVFSFFPAITKRLFRNQWAAHVAVRRRVGEIYVPLINARRAGDGDGDDPP 6075
6076 CYTDSLLQLRVAEEGDRPLTDDEIIALCSEFLNAGTDTTVTLVEWIMAELVNRPDIQAKV 6255
6256 HDEVRRRPELTEADLQAMPYLKAVVLEGLRLHPPAQFLLPHGVQSDAEVGGYVVPRGAEL 6435
6436 NVWVAELGRDEVVWTAAREFMPERFMDGGEVEVDVTGSREITMMPFGVGRRMCPGYTVGT 6615
6616 LHAEYLVGSLVRELEWLPETEGEAADMAEELDFTTVMKHPLRARVLPRPSSLY 6774

>aaaa01003879.1 $FI (indica cultivar-group) ortholog to AP004757.1 97%
4645 MAQMLAAFLLDDLISHEHGHESLGAPPQAGTMAWYSLVLMTSLLFPLLVLLVMRCYVTRS 4824
4825 GAKLLDKLPSVPGRLPVIGHLHLIGSLPHISLRNLATKHSPDMMLLHLGAVPTLVVSSSR 5004
5005 VAQSILHTHDDIFASRPYSPIANILFYGATDVGFSPYNEYWWQIKKITTTHLLTVKKVRS 5184
5185 YVSARQREVRIVIARITEAASKHEVVDLTEMLSCYSNNIVCHVVCGKFS*KEGWNQLLRK 5364
5365 LVKVNTSLLGGFNIEDYFPSFTRLAAVRRLLLSCAKAHNINKRWDQLLEKLIDDHTTKHI 5544
5545 RSSSMLNHYDEEAGFIDVLLSIQHEYGLTKDNIKANLAAMLMAGTDTSFIELEYAMAELM 5724
5725 QKPHVMGKLQAEVRRVMPKGQDIVTEEQLGCMPYLKAVIKETLRLYPPAPLLMPHLSMSD 5904
5905 CNINGYTIPSGTRVIVNVWALARDSNYWENADEFIPERFIVNTLGDYNGNNFHFLSFGSG 6084
6085 RRIYPGINFAIATIEIMLANLVYRFDWELPADQAAKGGIDMTETFGVAVHRKEKLLLIPH 6264
6265 LHLR 6276

>aaaa01003917.1 $FI (indica cultivar-group) ORTHOLOG OF D39760 43% to 96A1
8147 MNLFDLFFVLQLLLSGVCVLVICYRYQRLKSMKKCSLGVVQWPIVGVLPAIVANMHRLLDGVTFLLAT 8350
8351 SQLNFQCRFWLAGFRFFVTCDPDNVRHIFTSNFDNYPKGDVFADMFDVLGGGIFNTDGER 8530
8531 WRRQRNKAQMLMTTPRFRAFVARSSLDKVEKGLLPFLAHVADARKTCDLQDVFTRWSLDA 8710
8711 TCHLVFGVDPGCLDIGLPEVPFARAMDDVLRTIFLRHTMPVSFWKTMRWLGIGHEKRNAA 8890
8891 ARRTVESFVASAIAKHRADDESKSRQGGGGGGDKQSVADLLSSFLCDDEIAGSADADVYI 9070
9071 RDMAMNLLVAGRDTTSSALSWFFYLLSTNPRVEQKLLQELAPIASRKPQLQQGRLFPGNG 9250
9251 GMVTFDASEVRNLLYLHAALCEAMRLYPPVPLEHKAAVADDVLPSGHEVMAGDKVLVFYY 9430
9431 SMGRMKRVWGKDCREFRPERWITEDGKLRYVPSNKFVAFNSGPRTCLGKEMALVQMKVTA 9610
9611 AAMAWNFAVEVVPGHVVEPRLSVILHMKNGLLVRVKRREPVMNT* 9745

>aaaa01004037.1 $FI (indica cultivar-group) ortholog to AL732378.3 99%
12867 LPPGPRNLPVVGSAHRLVNTLAHRVLRDLADVHGPLMHLRVGQVPVVVVTSKELARD 12697
12696 ILKTHDANFATRPKLVAGGIVAYDWTDILFSPSGDYWRKLRRLCIQEILSAKRILSFEHI 12517
12516 REDEVRMLADEIRAVGPSVAVDLSARLHRITNTIVSRAAFGNKRSNAADFLVAIKQSVIM 12337
12336 ASGFYVPDLFPRFSVLLCWLTGMRRTLHGIRDTIDSILEEIISEKEEAKQQQDNNL 12169
12168 VDVLLSLKDKGDFGFPITRDTIKAIVL 12088
11880 DIFAGGSGTSANAMEWAMSELMMNPRVMNKVQAEIRDAFHGKQSIGEADLRARDLKYLKL 11701
11700 VMKETLRLHPPAPLLVPRESIDACEINGYMIPAKARVIVNAWAISRDPRYWEDAEEFKPE 11521
11520 RFAEGGIDFYGSNYEYTPFGSGRRMCPGYNYGLASMELTLAQLLHSFDWSMPDGATEV 11347
11346 DMTEAPGLGVRRKTPLLLCAAPYVASPI 11263

>aaaa01004091.1 (indica cultivar-group) orth of AC108875.1c $F chr 5 similar to 51A2
12032 GSVIFPYIPIPSHIRRDKAHAKLAKIFSKIVRSRRDSNRPAEQDVLQYLIDSKHRDGSS 12208
12209 TTEQEVTGWIISMVFAGKHTSTNSTTWTGACLLTHDKFLTEALDEQKHMIQKHGDHIDYN 12388
12389 VLLDMDILHCCIKEALRMHPVAPIIYRKAQKSFVVRTREGDAYDIPEGHNLLSP 12550
12551 MIFNNRLPYIYKDPHMYDLDRFAPKREEDKVGGMFSYTSFGGGRHICIGEAYAYMQIKV 12727
12728 IWSHLLRNF 12754

>aaaa01004178.1a  (indica cultivar-group) ortholog of AP003752.1e 97%
3568 ASWAFIAVVVKLVWWPRAITRRLGAQGVAGPGYRFFSGNLSEIRRLRAEGANLVLD 3735
3736 VSSHDFVPIVQPHIRTWIPLY 3798 (1?)
3894 GKTFLYWFGTRPNICLADMNMVRQVLSDRTGMFPKYIDNMQFARLLGKGLVLTDDDEWKR 4073
4074 HYKVVHPAFDMDKLKMMTETISDCARSMMFEWESELGMKGGSTEIELSRWFEELTVDVIS 4253
4254 RTAFGSIYREGKQVFLAQRKLQFLAFSAFLTIQIPGFSYLLTKKNMKTWSLDKKVRSMLM 4433
4434 NIIKSRLTNKETMGYGNDLLGLMLEACVPEHGGSQPQLSMDDIIAECKT 4580
4581 FFFAGHDTTSQLLTWTMFLLSTHQHWMEKLRKEVRMVCNDEVPTGDMLNKLK 4736
4737 LVNMFLLETLRLYGPVSLVTRRDGTDVKLGSIKVPKGTILTIPIATIHRDKEVWGEDA 4910
4911 DEFKPERFENGVLKAAKHPSALLSFSIGLRSCIGQNFAMIEAKTIIAMILQRFSFTLSPK 5090
5091 YVHTPISVITLRPKYGLPMILR 5156

>aaaa01004178.1b  (indica cultivar-group) ortholog of AP003752.1b 99%
10535 GWMVAAAVAAVVASWAFDAVVKLVWRPRAITRRLRAQGVGGPGYRFFSGNLGEIKRLRD 10711
10712 EGAGVVLDVSSHDFVPIVQPHFRKWIPLY 10798
10911 FRIYLRAAGKTFMYWFGARPTICLADVSMVRQVLSDRTGMYPKNVSNPYFARLLGKGLVL 11090
11091 TDGDEWKRHRKVVHPAFNMDKLKMMTVTMSDCAQSMISEWESELGTKGDIVEIELSRRFE 11270
11271 ELTADVISHTAFGSSYKEGKQVFLAQRELQFLAFSTFLSIQIPGSSYLPTKKNLKTWSVD 11450
11451 KKVRSMLTDIIKSRLNNKDVAGYGNDLLGLMLEACAPEHGESQPQLSMD 11597
11598 EIIAECKTFFFAGHDTTSHLLTWTMFLLSTHPEWQEKLREEVAMECDGKVPT 11753
11754 GDMLNKLKLVNMFLLETLRLYGPVAFIQRRVNAELELGGITVPEGTVLSIPIATIHRD 11927
11928 KEVWGEDADIFKPERFENGVSKAGKYPNALLSFSSGPRACIGQNFAMIEAKAVIAMILQR 12107
12108 FSFTLSPKYVHAPTDVITLRPKYGLPMILK 12197

>aaaa01004178.1c  (indica cultivar-group) ortholog of AP003752.1a 100% 
16266 MGYGWALAAVLATWCLLDALSRLVWRPRAVAAALRRQGVRGPGYRLLVGSLGDIN 16430
seq gap
16665 GRVFLYWFGWTPDMCVADVEVAKQVLSDRTGLFPKNVTTPMLLKLFGRGLVLANGDEWQR 16844
16845 HKKVVHPAFNTDKLK
16978 MMTATMAGVARSMVSRWEEKVASHGGKVVIELSSQFEELTADVISHTAFG 17127
      SYAEGKQVFMAIKELQFIAFSSLLS 17204
17205 VQIPGS
17282 RYFPTKKNLKVWRLDRKVRSTLMQIISNRLAAAAKEKAGGGGGGYGEDLLGLMLEASAPP 17461
17462 ELGTKRRQPPVLSMDEIIDECKTFFFAGQETTSHLLSWTMFLLSTHPDWQDKLREEAVRE 17641
17642 CAGAGAGDDDDQLPTYDMLGKLKLVGMQF 17728

>aaaa01004200.1 (indica cultivar-group) 
16322 MAAVQLDFGLLVGFLFLATCLAVAIRSYLRSGGAAIPSPPALPVIGNLHQLGR 16480
16481 GRHHRALRELARRHGPLFQLRLGSVRALVVSSAPMAEAVLRHQDHVFCGRPQQRTARGTL 16660
16661 YGCRDVAFSPYGERWRRLRRVAVVRLLSARRVDSFRALREEEVASFVNRIRAASGGGV 16834
16835 VNLTELIVGLTHAVVSRAAFGKKLGGVDPAKVRETIGELADLLETIAVSDMFPRLRWVDW 17014
17015 ATGLDARTKRTAAKLDEVLEMALRDHEQSRGDDDDGGGGDGEPRDLMDDLLSMANDGGGD 17194
17195 HGHKLDRIDVKGLILV (1)
      NMFIA (frameshift) 
      GTDTIYKSIEWT 17374
17375 MAELIKNPAEMAKVQAEVRHVAAAAHGDEDEDTVAVVREQQLGKMTLLRAA 17527
17528 MKEAMRLHPPVPLLIPREAIEDTVLHGHRVAAGTRVMINAWAIGRDEAAWEGAAEFRPGR 17707
17708 FAGGGDAAGVEYYGGGDFRFVPFGAGRRGCPGVAFGTRLAELAVANMACWFEWELPDGQ 17884
17885 DVESFEVVESS 17917

>aaaa01004251.1 $FI (indica cultivar-group) ortholog of AQ157412 contig
44% to 87A2
2320 MEKSEIFVGAHSYAALCAFTLIIGWLAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFR 2499
2500 TSPSIDMPIYYKRRLER (2) 2550
2709 YGPIFKTNIGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAH 2885
2886 KLIRSFVCKLYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSN (0) 3032
3130 MIFGLAAKHLIGLDITNSGELKKNFQEIFQVMVSIPFPIYFPGTSFYRCMQ (0) 3282
3407 GRRNVWTTLTNVMKKRLSAPGNKFGDLVDLIVEELRSENPTI
     DESFAIDTLSGLLFASFAPLSCTLTTTFKFLNDNPEVFDKLK (0) 3658
3778 EEHEMILKKREGANSGFTWEEYKSLKFSTQ (0) 3867
3965 VVNEINRITTVIPGGFRKALTDVEVN (1)
4133 GYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWT (0)
4343 EEKRISMQRNFMPFGGGIRMCPAVEFNKLFITLFLHIVVTEYR 4471 (2)
4752 WKDIDGGNVKRISEVLVAQEYHIQLVPQT* 4841

>aaaa01004255.1 $PI (indica cultivar-group) ortholog of 73A35P
16157 MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPV 16038
16037 PVFGNWLQVGDDLNHRNLAALARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGS 15858
15857 RTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDG 15678
15677 LRADPA 15660 (fs)
15660 RRRL*LMMYNNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF 15481
15480 LRGCLRICEEVKETRLKLFKDFFLEERK
      KAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVA
15092 AIETTLWSMEWAIAEL 15045
      VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLP 14944
14943 YLQAVVKETLRLRMAIPLLVPHMNLRDAELAGYGIPAESKVLVNAWYLANDPGRWRRPEE 14764
14763 FRPERFLEEERHVEANGNDFRYLPSGAGRRSCPGIVLALPILGVTIGRLVQNFELLP 14593
14592 PPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF* 14491

>aaaa01004333.1 (indica cultivar-group) orth AP004013.1 $P chr 8 98% 1 diff
1885 LRLPPSPFGLPILGHLHLLTPLPHQALHRLAARHGPLLYLRL 2019

>aaaa01004359.1 (indica cultivar-group) ortholog of AQ577123
deletion of Ihelix to heme
1854 MDPWLVLWLVLASMAFALLHLRRRARRGAPPLPPGPRPLPIIGNMLMMDQLTHRGLAAMAARY 2042
2043 GGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRPASIAIAYLTYGRADMAFSHYGHF 2222
2223 WRQVRKLSALRLFSRRRAQSWRAVRDESAKLVGAIARRAGEAVDLGELIFGLTKDVIFRA 2402
2403 AFGTRDGGGHGELEVLLQEFSKLFGAFNVGDFIPWLAWLDPHGINRRLRAARAALDSVID 2582
2583 RIIDEHVSNPAGDEDADMVDDMLAFLDEAGRDHTGGGGELQGTLRLTR
     gap in seq.
     GRRACPAIVLGMYELELVVARLVHAFGWAPPGGVAPEE 2942
2943 LDMADGFGLTAPRAARLRAVPTPRLTCPM* 3032

>aaaa01004378.1 (indica cultivar-group) orth AC116603.1 $F chr 10, 97%
13156 RTLPPPPPAGTRPLPLIGSLHLLGDQPHRSLAGLAKTYGPLMSLRLGAVTTVVVSSPDVA 12977
12976 REFLQKHDAVFATRSAPDAAGDHTRNSVPWLPPGPRWRELRKIMATELFATHRLDALH 12803
12802 ELRQEKVSELVDHVARLARDGAAVDVGRVAFTTSLNLLSRTIFSRDLTSLDDRGASKEFQ 12623
12622 QVVTDIMGAAGSPNLSDFFPALAAADLQGWRRRLAGLFERLHRVF 12488
9748 LLKDLFAAGSDTSSSTVEWAMAELLRNPLPMAKACDELQRVIGSTRRIEESDIGRLPY 9575
9574 LQAVIKETFRLHPPVPFLLPRQATTTIQILGYTIPKGAKVFINVWAMGRDKDIWPEAEKF 9395
9394 MPERFLERATDFKGADFELIPFGAGRRICPGLPLAVRMVHVVLASLLINFKWRLPIKVER 9215
9214 DGVNMTEKFGVTLAKAIPL 9158

>aaaa01004390.1 $PI (indica cultivar-group) Nterm missing and one frameshift
12657 SDRPVKDAARGLLFHRAMG 12713
12714 FAPSGDYWRALRRVSANHLFTPRRVAASAPRRLAIGERMLDRLSALAGGEIGM 12872
12873 RRVLHAASLDHVMDTVFGTRYDGDSQEGAELEAMVKEGYDLLGMFNWGDHLPLLKWL 13043
13044 DLQGVRRRCRTLVQRVDVFVRSIIDEHRQRKRRTGGNGGGEELPGDFVDVLLGLQGEEKM 13223
13224 TESDMVAVLWVTKDPSDEMIFRGTDTVAILLEWI 13403
13404 MARMVLHPDIQAKAQAELDAVVGRERAVSDGDVAGLRYLQCVVKEALRVHPPGPLL 13571
      SWARLAVRDAHVGGHA frameshift 
13622 VPAGTTAMVNMWAIAHDPELWPEPDEFRPERFAEEDVSVLGGDLRLAPFGAGRRACPGKT 13801
13802 LALATVHLWLAQLLHRFEWAPVGGGVHLLERLNMSLEMEKPLVCKAKPRW* 13954

>aaaa01004413.1 (indica cultivar-group) orth to AP002092 $F 100%
323 KGSMPGAPLVVPFLGSAAHLIRDPVGFWDVQAALARKSGAGLAADFLFGRFTVFIRDS 496
497 ELSHRVFANVRADAFHVVSHPFGKKLFGEHNLVYLVGEEHKDLRRRIAPNFTPRALSTYA 676
677 VIQQRVIISHLRRWLDRSASNGGKAEPIRVPCRDMNLETSQTVFVGPYLTEKARERFDRD 856
857 YNLFNVGFITLPVDLPGFAFRRARLAGARLMHTLGDCARQSRQRMLGGGEPECLLDYLMQ 1036
1037ETVREIDEATAAGLPPPPHTSDVEVGALLFGFLFAAQDASTSSLCWAVSALDSHPNVLAR 1216
1217VRAEVAALWSPESGEPITAEMMSAMKYTQAVAREVVRYHPPATLVPHIAVEAFQLT 1384
1385AQYTIPKGTMVFPSVYESSFQGFQDADAFDPDRFFSEARREDVVYKRNFLAFGAGPHQ 1558
1559CVGQRYALNHLVIFMALFVSLVDFRRERTEGCDV 1660

>aaaa01004425.1a (indica cultivar-group) orth AL662964.1b $F chr 4
5389 FLPLISRRRRTQHRDDADGGVFRPYVDSLLDLRVPVGDDDVAGEGKEEHH 5240
5239 LSHRALTDDEMVGLVSEFLGGGTESVVSCVEWTLAHLVIEPEIQDKLRREVAAAEAD 5069
5068 RHGGERSTTPAAYLRAVILESLRMHPPVPLTMRDVRSPQAVEHLSLPDGGARVHFILGD 4892
4891 IGRDGKAWTDPDEFRPERFMAGGEAEGVGPLPGPREVRMMPFGAGRRYCPGMGLGV 4724
4723 AHACLLVAALVREFEW 4676

>aaaa01004425.1b (indica cultivar-group) orth AL662964.1a $F chr 4, 99% 
12375 PVALVTGRRRRRSDNLTSVPYGPHWRVLRRNLTAGIFHPSRLGLLAPLQRDAVDDLVAGI 12554
12555 SESAAGGAVPVVVRDVAYAAVFRLAARMCFGDGVGERQVRALRRVIREFVLDVGVANNVF 12734
12735 PVSTSTALARLRRWRRIRRLLSSRRRQAELYLPLIDERRRRMAARRRDRDDDGGTFRP 12908
12909 YVDALIELRVPGDGESTPAPLTDDEMVSLLMEFLAASTETVVSCIEWTLAHLVLNAEAQS 13088
13089 KLRREVGDGEHVHGRHRGRTPYMRAVILESLRLHPPVPFVIREVVGGAAPPVLD 13250
13251 ELAAMPMPGGGARVHFVIGDIGRDSKAWRDPKEFRPERFMAGGEAEGVGPVPGPK 13415
13416 EVRMMPFGAGRRSCPGMGVAMAHVGLFVAAQVREFEWTPAGGGVDLTQQDDFFNVMRT 13589
13590 PL 13595

>aaaa01004457.1 $FI (indica cultivar-group) CYP94B4 58% to 94B3
9557 MAWFVAAWSCLLVVVMVSSMRLSRSASSSCGSSCGHGGW
9440 GPRSYPVIGCLVAFYRNRRRLLDWYTEMLAASPSQTIVVDRLGARRTVVTANPA 9279
9278 NVEHILRARFANYPKGKPFTDVLGDLLGMGIFNVDGELWHAQRKLVSHEFSARALRDLEV 9099
9098 TVLEAEARDRLVPALAAASRGGGVVDMQDVLRRFAFDVICRVSLGVDPGCLDPALPAPRL 8919
8918 AAAFDTAAGIIARRGAAPVAAVWKVKRALDAGSERRLREEVGVIHEAVMGLIRSRRKERA 8739
8738 LLLVNGNGVGGGGGARSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTW 8577
8576 FFWLLMRHRGVEAQVLDEIAATRRARGAGEEGGDDGEGEGLDLDDYRRMRVLHAALCET 8400
8399 MRLYPPVAWDSKHAAADDVLPDGTAVGRGDRVTYFQYGMGRMEAIWGADAADFSLDRWLS 8220
8219 LPRGGGDGAAAAAASPAAAAFAGVSPFKYPVFQGGPRTCLGKEMAFVQMKFVASAVLRRF 8040
8039 ELRPVDEGRTPAFVPLMTAHMAGGLNVTVRRRTPAPATSTAANGTGGELTSS* 7881

>aaaa01004481.1 (indica cultivar-group) orth AP003612.1 $F chromosome 6 100%
11759 LNETLRLYPPAVATIRRAKFDVTLGGGGDGDAGGIHIPRDTELLVPIMAIHHDARLWGPD 11938
11939 AAQFNPARFASGAARAAKHPLAFIPFGLGSRMCIGQSLAILEAKLTMAVLLQRFDLA 12109
12110 LSPTYVHAPTVLMLLHPQYGAPLIFRPR 12193

>aaaa01004523.1 (indica cultivar-group) orth AL606448.1 $P two short pseudogene fragments 1 diff
1027 WRVRAFGDLLGNGIFNSDGETWVAQRKTPA 938

>aaaa01004558.1 $FI (indica cultivar-group) 96% to AAAA01013573.1 43% to 714A1
7614 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 7793
7794 RQELKLSQKQGTNNFISTLFPHFLLWRETYGMYML 7898 (?)
8802 GPVFLYSTGAMEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTENGDEWA 8981
8982 YQRKIIAPEFFMDKIK 9029 (0?)
9125 GMIQLIEDATVPVLEAWEDMIDDEGGCREIVVDDYLRNLSADVIARAC 9268
9269 FGSSFTKGEEIFCKLRQLQ 9325
9674 YLPTKSSQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLVNAIIDGAQDGRSAAEAEDFI 9850
9851 VGNCKTIYFGGHESTAVTAIWCLMLLATHPEWQERARAEAMEVCRGRSTLDVDALRRLKI 10030
     VTMVIQETLRLYPPASVMMREALTDVKLGSIEVPRGT 10259
10260 IVQVPRLMLHLDKEAWGADADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMA 10439
10440 ELKVVLARLLTKFAFSPSPRYRHSPAFRLTIEPGFGLPLMVTKLP 10574

>aaaa01004597.1a (indica cultivar-group) ortholog to BI808700.1 (3 diffs)
runs off end of scaffold
2   WAIMRDPTAWERPDEFMPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAERVVPFI 178
179 LASLLHAFEWRLPDGMSAEELDVSEKFTTANVLTVPLKAVPILASSASELQAS* 340

>aaaa01004597.1b $PI (indica cultivar-group) missing Nterm 42% to 76C4
89% to Nterm of AU172561.1 6 diffs with BI808700.1
RRLPPGPTPLPVIGNVLSLRGNMHHALARLARERYGPVMA
LKLGLVTAVVVSSPDAAREAFTKHDRRLAARAVPDTSRVRGFADRSMIWLPSSDTRWKTL
RGVVATHVFSPRSIAAARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLVSNAFFS
GDVVDVGEESAHGLREAVEDIILAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYDTVFDIL
DNITNSRLADASAGNHAGDFLDSLLGLMSYGKIARDDVTTIMFDVFGAGTDTIAITVQWA
MAELLRNPSIMAKARTEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHQ
AAEDGVEIGGYAVPKGSTVIFNVWAIMRDPTAWERPDEF
MPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAERVVPFIL (2) 14530
Inverted orientation
ASLLHAFEWRLPDGMSAEELD 
Small deletion
14623 VTVPLKAVPILASSASELQAS* 14688

>aaaa01004604.1 $FI (indica cultivar-group) 52% to 701A3 ortholog of AF088220 AP005302.1c
4885  MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPPP 5019 (1)
8461  AVPGLPIIGNLHQLKEKKPHQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKE (0?) 8622
9972  AMIDKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQ (0?) 10136
10237 FRGTRERMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQ (0?) 10371
10526 SLGEDVSSVYVEEFGREISKDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIVSTTEFR
10721 RDAIMNALIKKQKERIARGE (0)
10866 ARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIAKNPDKQ (0) 11033
11380 ELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDDTTLAGYD 11556
11557 IAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAGRRTCAGSLQ 11736
11737 AMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRGRM* 11892

>aaaa01004667.1a $PI (indica cultivar-group) Cterm 
1103 LHGGTTAEDVDVSEKFKSANVLAVPLQAVPVL 1008

>aaaa01004667.1b $FI (indica cultivar-group) ortholog of AP003623.1  
7298 MENSQVWLLWGALSVAVLFYLSTLRRRYAGGKPLPPGPTPLPLIGNLHLAGGTFHHKLR 7122
7121 DLARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVF 6942
6941 IPSSDPQWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLIAYLRAHAGKEVLLGQAMYTG 6762
6761 LLNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWT 6582
6581 TKRFNRVFSIMGDIIDRRLAHIRDGKPRHDDFLDSLLELMATGKMERVNVVNMLFEAFVA 6402
6401 GVDTMALTLEWVMAELLHNPAIMARVRAELSDVLGGKEAVEEADAARLPYLQAVLKEAMR 6222
6221 LHPVGALLLPHFAAEDGVEIGGYAVPRGSTVLFNAWAIMRDPAAWERPDEFVPERFLGRS 6042
6041 PPLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWKLPGGMTAEDVDVSE 5862
5861 KFKSANVLAVPLKAVPVLIK 5802

>aaaa01004834.1a (indica cultivar-group) ortholog of AP005285.1 gene 2
8825 MAVDAMFGSVAVALLAVVVAAAALR 8751
     Missing 48 amino acids shown from ortholog
rwrrrrrrgggrplpgpvalpvvghlhlfrrplhrtlarlaarhgaav
7227 MGLRFGSRRVAVVSSAPAAEECLGPHDLAFANRPRLPSGEILAYEWSTMGTASYGPYWRH 7048
7047 IRRIAVTELLSAHRVQHFADVNVREVRALARRLYRRAAAAAAAGARTRVELKSRLF 6880
6879 ELLMNTMMSMICERTFYGA (2)
     DDDEVSEEARWFRSVV 6700
6699 KETMELSGASTVWDFLPAPARWLDAGRMTRRMRELSDSRTRFLQRLIDDQRKDMDADSDE 6520
6519 HAPAKRRTMIGVLLSLQSKDPDSCPDQLIRSLCI (0) 6418
6331 GSLQAGTDTSAATVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRC 6152
6151 VVMETLRLYPPVPLLAPHESSADCVVAGFHVPQGTMLLVNTFAIHRDPQVWDEPEAFIPDR (2) 5969
5398 FADGKNEGKMVIPFGMGRRRCPGENLGMQMVGLALGTLIQCFDWERVGEELVDMRECS 5225
5224 GLTMPKELPLEALYQPRASMVDLLTKI* 5141

>aaaa01004834.1b $FI (indica cultivar-group) ortholog of AP005285.1 gene 3
14689 MDALLIALFLLLLIALMETARVRRSGTQRRAGNVPPPPPEPAGLPLVGHLHLFRKPLHRT 14510
14509 LARLAARHGGAVFGLRLGSRRVAVVSSAPAAEECLGAHDVAFADRPRLPSGRILSYDWST 14330
14329 MGTASYGPYWRHVRRVAVTEILSARRVQHFADVHVREARAMARHLHRAAVRHGVGGAARV 14150
14149 RVELKSRLFELLMNTMMAMICDKTYYGD (2) 14066
13973 DDDGEVSKEARWFREMVEETMALSGASTVWNFLPAALRWVDVGGVGRRLWRLRESRTRFL 13794
13793 QGLINDERKEMEQEQGGDRAQPAARRRTMIGVLLSVQRQDPDACPDQLIRSLCI (0) 13632
12083 SSLEAGTDTSADTIEWAMSLLLNNPNVMRKARDEIDAFIGQPVRLLEASDLTKLQYLQCII 11901
11900 METLRLYPPAPLLVPHEASTDCSIAGFHITRGTMLLVNTFAIHRDPQVWNEPTSFIPER (2) 11721
      FENGRSEGKMAIPFGMGRRKCPAENLGMQMVGLAL 11541
11540 GTMIQCFEWERVGEELVDMTEGSGLTMPKEVPLQAFYQPRASLMHLLY 11397

>aaaa01004834.1c (indica cultivar-group) ortholog of BI806420.1
16396 SLEAGTGTSTDTIEWAMSLLLNNPDVMRKARDEIDAFIGQPVRLLEADDLPKLQYLRCI 16220
16219 IMETLRLYPPAPLLVPHESSSDCTVAGFHIPRGTMLLVNTFDIHRDPHIWDEPTSFIPER (2?) 16040
15947 FEDGRSEGKMAIPFGMGRRKCPAENLGMQMVGLGLGTMIQCFEWERVGEELVDMTEGSG 15771
15770 LTMPKKVPLEAFYQPRASVMHLLS* 15696

>aaaa01004950.1 $FI (indica cultivar-group) ortholog to AP004811.1 99%
15700 MEDWIFYSLTLLLCLACSLLLRARASAAAVEVAPLPPGPRTVPVLGPLLFLARRDFDVEP 15521
15520 TLRRIAAEHGPVFTFAPLGPSRPTIFVAARGPAHRALVQRGAAFASRPRGVSPASVLLTS 15341
15340 GGRNVSSAQHGPIWRALRRCISSGVLNPARLRAFSDARRWVLDALVSHIRGEGGAPLTVM 15161
15160 EPFQYAMFCLLVYMCFGDRPGDARVREIEALQRELLSNFLSFEVFAFLPPITRLVFRRRW 14981
14980 NKLVSLRRRQEELFAPLIRARREAGAGGDCYVDSLVKLTIPEDGGRGLTDVEIVSLCSEF 14801
14800 MSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGEVREEDLQAMPYLKAVVLEG 14621
14620 LRRHPPGHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGLDSEVWTSPEVFRPERFLAG 14441
14440 GEGEDVDLTGSKEIKMMPFGAGRRICPGMALALLHLEYFVANLVREFEWREVAGDEVDLT 14261
14260 QKLQFTVVMKRPLKATAVPLRGDRSAAAAVTGSA* 14156

>aaaa01005051.1 (indica cultivar-group) orth of AC083944.6 $F 99%
12952 YGPLFKTNMIMEDLIVSLDPEVTNFVFQQEERLFQMWYPDSFIRIIGTDSLIRTHGLLHR 13131
13132 HIKNLALRLFGPENLRREIIHDVQKTVEASLSSWLNQPSIELKEAVSS 13278
13733 MIFKVTAKKLISYDSSTSDGKMWKQYDAFTQGLFAFPLCIPGTAFYKCMQ
10748 GRKNVIKMLKEILDERKNTEEHHESVDFFDVIEEVKAENPDQMTENAALDLLFLLLF 10572
10571 ASFETTSSGITAMLIFLTDNPEALQEL 10491
9343 NIAVCLLMKYIGIIYTGFAIPKGSKIMICPYTVHLNPVVYKDPNTFNPWRWK 9188
8464 SGASKDFMAFGGGLRLCVGAHFAKLQMAVFLHCLVT 8357

>aaaa01005183.1 (indica cultivar-group) 71% to AC083944.6 $F
284 RYGPVFRTNIVGEDLIVSLDPEVNNFVFQQEGR 382
376 AFRMWYPDSIMRIIGADSIITTLGSSHKYIKNMVFRLFGPENLRRDMIKDLQKTAEAS 555
556 LLSWLHHPSIELKEAASS 612
2778 RSLQGRKNVMKMLKEMMDERKKATGRQESIDFFDVLLEELKEEKHAMSENVALDLIFLLL 2957
2958 FVSFETTASGITAILCFLSDNPKALQELT 3044
5276 FAIPKG*KIMISPSIVHLNPVVYKDPNIFNPWRWKVCK 5389
5911 ASKDFMALGGGRRLCVGADFAKLQMAIFLHCLVTKYR 6021

>aaaa01005294.1 (indica cultivar-group) orth of AC092778.2 $F chr 3 CYP85A like
8096 NTTSSSSSTKSERFCRYGSVFRTHILGCPTVVCMEAELNRRALASEGRGFVPGYPQSMLD 8275
8276 ILGRNNIAAVQGPLHRAMRGAMLSLVRPAMIRSSLLPKIDAFMRSHLAAWSSS 8434
8435 SSSSAVVDIQAK 8470
9375 SDALKAELYTLVLGTISLPINLPGTNYYQGFK
     ARKKLVAMLEQMIAERRSSGQVHDDMLDALLTGVEGTREKLTDEQIIDLIITLIYS 9731
9912 FDIRKGKAPEDAIDWNDFKSMTFT 9983
10063 TMQVIFETLRLATVVNGLLRKTTQDVEMNG
      YVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLVSK 10365
10481 HFMLFGGGSRMCPGKEVGTVEIATFLHYFVTQYR
      WEEEGNNTILKFPRVEAPNGLHIRV 10747

>aaaa01005413.1 $FI (indica cultivar-group) ortholog to AL713951.1
5862 MSLALLVLSAAYVLVALRRSRSSSLKPRRLPPSPPGWPVIGHLHLMSGMPHHALAELARTMRAPLFRMRL
     GSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCSDVTFAPAGPYHRMARR
     VVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSECFLNLANDVLCRVAFG
     RRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGLRRRLKKCLADLREACD
     VIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNLKALVL (0) 4972
4875 DMFVAGTDTTFATLEWVMTELVRHPRILKKAQEE
4773 VRRVVGDSGRVEESHLGELHYMRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPARTR 4594
4593 VFINTFAMGRDPEIWDNPLEYSPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGYTFA 4414
4413 LATVQVSLASLLYHFEWALPAGVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFKGEE 4234
4233 LSEV* 4219

>aaaa01005438.1a $PI ortholog of AC068924.9d 96% 
2648 MNNLAILAVAGVLLLPLLVFLRDVTSRRRRRLPPGPPAVPLFGNLLWLRHSAADVEPLLL 2827
2828 TLFKKYGPVVTLRIGSRLSIFVADRHLAHAALIAAGAKLADRPQAAISTLLGVSDNIITR 3007
3008 ANYGAMWRLLRRNLVSQTLQQSRVDQFAPARVWVRRVLMEKLR 3136 insertion
3124 GEAA*DVRRRRRRRAQAFQHAVFCLLVLMCFGERLDEPAVRAVEDAERAWLLYISKKTSV 3303
3304 FFFLPWITKHL 3336 small deletion
3350 EYKRLASQGLPPARETAFQHSYVDTLLDVKIPE 3448
3449 EGNRALTDDEIVTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEINATCGGDDE 3628
3629 LLERNVRDKDNKMPYLNAVVKEGLRKHPPGHFVLPHKAAEDMDVGGYLIPKGATVNFMVA 3808
3809 EIGRDEREWENPMQFMPERFLDGGHGAGVDMHGTKGIKMMPFGVGRRICAGLNIAMLHLE 3988
3989 YFVGSMVMEFEWKEVEGLEVEFAEKREFTTVMAKPLRPRLVPRRS 4123

>aaaa01005438.1b $FI ortholog of AC068924.9d 98% 6 diffs
8812 MDNLVILAGVLLLPLLFLLRNAASSRRRRLPPGPPAVPLFGNLLWLRHSAADVEPLLLTL 8633
8632 FKKYGPVVTLRIGSRLSIFVADRHLAHAALIAAGAKLADRPQAAISTLLGVSDNIITRAN 8453
8452 YGAMWRLLRRNLVSQTLQQSRVDQFAPARVWVRRVLMEKLRGSGEAAPNVMEAFQYTMFC 8273
8272 LLVLMCFGERLDEPAVRDIEVAERAWLLYISRRMSVFFFFPWITKHLFRGRLEAAHALRR 8093
8092 RQKELFVPLIEARREYKRLASQGLPPARETAFQHSYVDTLLDVKIPEEGNRALTDDEIVT 7913
7912 LCSEFLNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEINATCGGDDELLERNVRDKDNKM 7733
7732 PYLNAVVKEGLRKHPPGHFVLPHKAAEDMDVGGYLIPKGATVNFMVAEIGRDEREWENPM 7553
7552 QFMPERFLDGGHGAGVDMHGTKGIKMMPFGVGRRICAGLNIAMLHLEYFVGSMVMEFEWK 7373
7372 EVEGLEVEFAEKREFTTVMAKPLRPRLVPRRS 7277

>aaaa01005438.1c $FI ortholog of AC068924.9c 97% 11 diffs
9909  MDTWHVTVAAILVLIPFLRLILSRRGGRGGGKRGRLPPGPPAVPLLGSTVWLTNSLADAE 10088
10089 PLLRRLIARHGPVVSLRVASRLLVFVADRRLAHAALVEKGASLADRPAMASTRLLGESDN 10268
10269 LISRAGYGPVWRLLRRNLVAETLHPSRVRLFAPARAWVRRVLVEKLRDENGDAAAPRAVV 10448
10449 ETFQYAMFCLLVLMCFGERLDEDAVRAISVAQRDALLYLSSKMPVFAFFPAVTKHLFRGR 10628
10629 LQKAHALRRRQMELFVPLINARREYKKRQGGADGEPKKETTFEHSYVDTLLDIKLPDDGN 10808
10809 RPLTDDEMVNLCSEFLNAGTDTTSTALQWIMAELVKNPSIQAKLHDEIKSKTGGGGGGQ 10985
10986 REVSEEDIHDMPYLKAVVLEGLRKHPPGHMVLPHRAAEDMEIGGYLIPKGATVNFMVAEM 11165
11166 GRDEKEWEKPMEFMPERFLAGGDGEGVDVTGSREIRMMPFGVGRRICAGLGVAMLHVEYF 11345
11346 VANMVSEFEWKEVAGDEVDFAEKIEFTTVMAKPLRARLVPRRA 11474

>aaaa01005438.1d $PI ortholog of AC068924.9b [top half looks like 9b bottom half 
looks like 9c] might be a recombination product
15719 MDAWQLFA 15696 (fs)
15696 PAIVILLPLLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPVVQRLMSRH 15517
15516 GPVVSLRFGSQLLVFVADRRLAHAALVESGASLADRPSQAASARLVGEGDTMNSRASYGP 15337
15336 VWRLLRRNLVADTLHPSRVHLFAPVRARVRRLLVDRLREEHGEAEAAAPRSVVETFQYAM 15157
15156 SFLLVLMCFGEQLDEDAVRAIGAAERDTMLYMSSEMGIFNFFPAITRHLFRGRLQKAHAL 14977
14976 RRRKEELFVPLINSRREYKKNG 14911 (fs and 4 aa deletion)
14911 KETTFEHSYVDTLLDIKLPDDGNRPLTDDEMVNLCSEFLNAGTDTTSTALQWIM 14750
14749 AELVKNPSIQAKLHDEIKSKTGGGGGGQREVSEEDIHDMPYLKAVVLEGLRKHPPGHMVL 14570
14569 PHRAAEDMEIGGYLIPKGATVNFMVAEMGRDEKEWEKPMEFMPERFLAGGDGEGVDVTGS 14390
14389 REIRMMPFGVGRRICAGLGVAMLHVEYFVANMVSEFEWKEVAGDEVDFAEKIEFTTVMAK 14210
14209 PLRARLVPPEYLDQ* 14165

>aaaa01005521.1 (indica cultivar-group) orth AP003230.1 $P pseudogene fragment 100%
8618 PFWHTVFRDLLGDGIFNSDGETWVA*RNTAALEFTT 8487

>aaaa01005609.1 $FI (indica cultivar-group) orth AC021892.5 $F chr 10 98% CYP75B3
     MDVVPLPLLLGSLAVSAAVWYLVYFLRGGTGANAARK
7136 RRPLPPGPRGWPVLGNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQF 7315
7316 LRGHDANFSNRPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVR 7495
7496 EGEVALMVRNLARQQAASVALGQEANVCATNTLARATIGHRVFAVDGGEGAREFKEMV 7669
7670 VELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQ 7831
7832 PDGVAAGEHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLL
     NLFTAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVGRGR 8185
8186 LVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIA 8365
8366 RDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTA 8545
8546 TLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGV

>aaaa01005635.1 $PI (indica cultivar-group) one stop codon, one fs
62% to AAAA01000843.1
8796 MDELSAGSLYLVVLGTLALALAFKRVLRGKETGVKLPPGPWNLPIIGSLHHLVGAHLPHRALLRVSR 8596
8595 RQGPLMLLRLGEVPAVVVSSPEAAMEFLRTRDPVFASRPRGALRSTSSASAVK 8437
8436 GSSWRHTASTGGRCARSAWWSCSAQGRCSGWSLSGRRRGGVPPRRGHRHDIA 8281
8280 CYSQHRHDPDASGAQ*RHHREGGVRRQVPTAGLRYLRVLKVVATLAGSFN 8131
8130 MVDLFPSSRLVRWLSCVERRLREHHAQTVRIVDSIIQDRKENEASASPGASAEDDDNDDL 7951
7950 LDVLLRLQREDNLTFPITAEIIGALIS (0) 7852
7202 DIFGAATDTTGSTLEWAMAELMRNPRTMEKAKQEVQNALGQGRAMVTGADIGDLHYLQMV 7023
7022 IKETLR (fs) 7005
7000 LHPSIPLIVRASEESTLVMGYDIPQGTNIFINAFAVARDPRYWKDADEFMPERFEKN 6830
6829 GDDIKATTVHMGFIPFGAGR (deletion of 18 aa heme signature region in seq gap) 6770
6669 NLLYHFDWTLINGESPESLDMGEVWGISIHRRSDLRLHAALSVSSGFLRHSDRDS* 6496

>aaaa01005655.1 $FI (indica cultivar-group) 
12123 MEASTILWLLYVSLASCLLYKVFVSTKNGHPKIAARRPPGPTPVLLLGNVFDLRGELHL 11947
11946 ALARLAEEHGPVMSLKLGTATAVVASSAAAARDALQRYDHVLAARAVCDAARALGTH 11776
11775 ERSIVWLPGSSALWKRLRAVCTNHLFSARGLDATRAVREAKVRELVEHLRGHAAGAGEEE 11596
11595 AAAVDVGRVVFSAVINLVSNVLFSEDVADLSSDRAQELEMLVRDTVEEATKPNLSDLFP 11419
11418 VLAALDLQGRRRRTAVHIRKFHDFFDEIISRRQNAGGEGERKEDFLDVLLQLH 11260
11259 SADQLSLDTIKTFLG (0) 11215
10259 DLFTAGTDTNSITVEWAMAELLRHPAAMSRARAELRDALGAKPHPDESDIGRLPYLSAVV 10080
10079 METMRLHPPSPLLMPHEAVADGAAVGGYAVPRGTKVIVNVWSIMRDPASWPRPEEFEPER 9900
9899  FVAAGGSFRGGEMLEFMPFGAGRRACPGTPMATRVVTLVLASLLHAFEWRLPGGMRPCDV 9720
      DVRGRFGTSLNMVTPLKAVPVPVPARP* 9636

>aaaa01005681.1 (indica cultivar-group) orth AP003866.1a $F chr 7 >99%
2692 EQGTVDLKRELDLLILTIASRVLLGKEVRETMFADVVASFHELMDNSMHLISLC 2853
2854 FPNLPIPRHRRRDTASARLKELFSRAIQLRRGSGRAEDDVLQRFLESRYR 3003
3004 DGRAMSDNEITGMLIALVVAGQHMSSSASTWTGAFLLRDPKHLAAAVDEQRRLIG 3168
3169 DDRVDYDALTTGMSTLHRCIKEALRMHPPAPALVRTVRRGFAVRTREGKEYRMPAGHS 3342
3343 VVSYAAFNHRLGYVYRDPDEYDPERFGPERKEDRVAGKFSFTAFGGGRHACLGEHYAFLK 3522
3523 MKVIWSYLLRNFELELVSPFPEVEL 3597

>aaaa01005693.1 (indica cultivar-group) 53% to 74B2
911  RPIPGSYGPPLLGPLRDRLDYFWFQGPDDFFRRRAADHKSTVFRANIPPTFPFFLGVDPR 1090
1091 VVAVVDAAAFTALFDPALVDKRDVLIGPYVPSLAFTRGTRVGVYLDTQDPDHARTKAFSI 1270
1271 DLLRRAARNWAAELRAAVDDMLAAVEEDLNRAPDPAAASASYLIPLQKCIFRFLCKA 1441
1442 LVGADPAADGLVDRFGVYILDVWLALQLVPTQKVGVIPQPLEELLLHSFPLPSFVVKPG 1618
1619 YDLLYRFVEKHGAAAVSIAEKEHGISKEEAINNILFVLGFNAFGGFSVFLPFLVMEVGKP 1798
1799 GRDDLRRRLREEVRRVLGGGDGDGGEAGFAAVREMALVRSTVYEVLRMQPPVPLQFGRAR 1978
1979 RDFVLRSHGGAAYEVGKGELLCGYQPLAMRDPAVFDRPEEFVPERFLGDDGEALLQYVYW 2158
2159 SNGPETGEPSPGNKQCAAKEVVVATACMLVAELFRRYDDFECDGTS 2296

>aaaa01005737.1 $FI (indica cultivar-group) 
14185 MEDKTILLSLALSMLLAILLSKLVSISKKPRLNLPPGPWTLPVIGSIHHLASNPNTHRALRALSQK 13988
13987 HGPLMQLWLGEVPAVVASTPEAAREILRNQDLRFADRHVTSTVATVSFDASDIFFSPY 13814
13813 GERWRQLRKLCTQELLTATRVRSFSRVREDEVARLVRELAGGGGAAVDLTERLG 13652
13651 RLVNDVVMRCSVGGRCRYRDEFLGALHEAKNQLTWLTVADLFPSSRLARMLGAAPRRGLA 13472
13471 SRKRIERIIADIVREHEGYMGSGGGGGDEAAAAAAGKDCFLSVLLGLQKEGGTPIPITNEIIVVLLF (0) 13271
10674 DMFSGGSETSATVMIWIMAELIRWPRVMTKVQAEVRQALQGKVTVTEDDIV 10522
10521 RLNYLKMVIKETLRLHCPGPLLVPHRCRETCKVMGYDVLKGTCVFVNVWALGRDPKYWED 10342
10341 PEEFKPERFENSDMDYKGNTFEYLPFGSGRRICPGINLGIANIELPLASLLYHFDWKLPD 10162
10161 EMASKDLDMQEAPGMVAAKLTSLCVCPITRVAPLISA* 10048

>aaaa01005754.1 (indica cultivar-group) orth AC074054.1b $P chr 10 99%
3717 FFLPLAFSLFLAVISAYVLQLLADARRRLPPGPWPLPLIGNLHQLDHLPHRSLARLAARH 3538
3537 GPLMSLRLGTVRAVVASSPEMAREVLQRHNADIAARSFGDSMRAGGHCENSVVCLPPRLR 3358
3357 WRALRRLSTVGLFSPRRLKKNFYIRVLSDLKLKTAEK*TSIKNPKIISK 3211
3210 FKVEIQNLTDKYKHKRKDNTLVIMHD 3133
2979 GGETTSHTMECAMAELLQCPNSMRRVQEELKSVIGTKQQMDEHDITKLPYLQAVIKET 2806
2805 LRLHPPVPLPPYEAEATVEIQGYTIPKGAKVLINLWAINRCANAWTEPDKFMPERFYDS 2629
2628 DITFMGRDFQLIPFGAGRRICLGLPLAHRMVHLMLGSLLHRFTWTLPAEAGKNGVDMRER 2449
2448 FGLTLSFVVPLYVI 2407

>aaaa01005977.1 (indica cultivar-group) orth AP003258.2 $F chr 1, 1 diff
10301 RFKNGVSRAASYPNALLSFSQGPRGCIGQTFAMLESQIAIAMILQRFEFRLSPSYVH 10131
10130 APMEAITLRPRFGLPVVLR 10074

>aaaa01006047.1 (indica cultivar-group) 75% to Arab 97B3 ortholog of AU173808.1
missing Nterm exon
2172 PKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYHWFLE (?) 2327
3740 HGSVYKLAFGPKAFVVVSDPIVARHILRENAFCYDK (?) 3847
4088 GVLAEILKPIMGKGLIPADLDTWKQRRKG (?) 4174
4470 ITPGFHALFIEAMVGVFTKCSERTIFKLEELIERGEHGEKYTIVDLEAEFSNLALDII
     GLGVFNFDFDSVTKESPVIK (?) 4703
4921 AVYGTLFEAEHRSTFYIPYGNLPLTRWIVPRQRKFHSDLKVINDCLDSLIKNAKETRQ (?) 5094
5181 EADVEKLQQRDYSSLK (?) 5228
5330 DASLLRFLVDMRGADVDDRQ (0?) 5389
5486 LRDDLMTMLIAGHETTAAVLTWSVFLLAQ (?) 5560
5678 NPSKMRKAQAEVDSVLSNETINVDQLKKLEY (?) 5770
5884 IRLIIVEALRLYPQPPLLIRRALRPDKLPG (?) 5973
6783 GYNGAKEGYEIPAGTDIFLS (0?) 6842
6942 IYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGWAGFDPDRSPGAMYPNE (0?) 7091
7178 ILADFAFLPFGGGPRKCVGDQFALLES 7258
7259 TVALALLLQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRRT* 7393

>aaaa01006067.1 (indica cultivar-group) 78% to AC074282.1 $P 
90% to aaaa01000965.1d $PI
8194 LDLQDVLQRFGFHTICMVAFGHDLPCLADGGVMEDARSDFMHSFGEAQNLVVGRFFDLIE 8015
8014 VSWKIKKWLNVGTIRRLRKAIADVHTFAMDIVRARRQSASVQDRDDVLSRFVASDEHSD 7838
7837 EVLRDIVLSFLIVGRDTTASGLSWFFCLLSSRPDVVARIADEVRAVRKPTD 7685
7684 TRLGEPFRFDALWEMHYLHAALTESMRLYP 7595
7572 DDTLPDGTLVRAGWSVTYSAYAIGR 7498
7502 GEDCLEYRPERWLGEDG 7452

>aaaa01006093.1a $FI CYP73 (indica cultivar-group) 99% to AP004850.1b
6441 MAASAMRVAIATGASLAVHLFVKSFVQAQHPALTLLLP
6327 VAVFVGIAVGAKGGSGGDGKAPPGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLR 6148
6147 LGVRNLVVVSDPKLATEVLHTQGVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRV 5968
5967 MTLPFFTARVVQQYKAMWEAEMDAVVDDVRGDAVAQGAGFVVRRRLQLMLYNIMYRMMFD 5788
5787 ARFESVDDPMFIEATRFNSERSRLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAF 5608
5607 FNNNYVEKRR (2) 5578
5431 NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKV 5252
5251 RAEINDVLGDDEPITESNIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPK 5072
5071 GSKVVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCPG 4892
4891 IILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA* 4721

>aaaa01006093.1b $FI CYP73 (indica cultivar-group) 99% to AP004850.1a
98% to AAAA01006093.1a
11410 MAASVVRVAIATGASLAVHLFVKSFLQAQHPALTLLLP
11524 VAVFAGIAVGAKGGNGGDGKAPPGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLR 11703
11704 LGVRNLVVVSDPKLATEVLHTQGVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRV 11883
11884 MTLPFFTARVVQQYKAMWEAEMDAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFD 12063
12064 ARFKSVDDPMFIEATRFNSERSRLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAF 12243
12244 FNNNYVEKRR (2) 12273
12431 NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKV 12610
12611 RAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPK 12790
12791 GSKVVVNAWWLANNPALWENPEEFRPERFLEKESSVDATVAGKVDFRFLPFGVGRRSCPG 12970
12971 IILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA* 13141

>aaaa01006105.1a $FI (indica cultivar-group) similar to Lolium rigidum AF321859 
MDELLYRALLLSVLAVALLQIIEAFLIIIRAKPAAPPLPPGPWRLPVIGSMHHLAGKLPHRALRD 3196
LAAAHGPLMMLRLGETPLVVASSREMAREVLRTHDANFATRPRLLAGEVVLYGGADILF 3019
SPSGEYWRRLRQLCAAEVLGPKRVLSFRHIREQE (0) 2914
MESQVEEIRAAGPSTP
VDLTAMFSFLVISNVSRASFGSKHRNAKKFLSAVKTGVTLASGFKIPDLFPTWRKVLAAV 1750
TGMRRALEDIHRVVDSTLEEVIEERRSAREDKARCGMVGTEENLVDVLIGLHEQGGC 1579
LSRNSIKSVIFDMFTAGTGTLSSTLGWGMSELMRSPMVMSKLQGEIREVFYGKATVGEED 1399
IQASRLTYLGLFIKETLRLHPPVPLLVPRESIDTCEIKGYMIPARSRIIVNAWAIGRDPR 1219
YWDDAEEFKPERFEKNIVDFTGSCYEYLPFGAGRRMCPGVAYGIPILEMALVQLLYHFDW 1039
SLPKGVVDVDMEESSGLGARRKTPLLLCATPFVVPVL* 925

>aaaa01006105.1b $FI (indica cultivar-group) 
6903 MDGLLYQALLLSALAVAVLQIVKLAVVNRGKKQAAAAAPTPPGPWRLPVIGSMHHLAGKLAHRALRD 6703
6702 LAAVHGPLMMLQLGETPLVVVSSREVAREVLRTHDANFATRPRLLAGEVVLYGGADILF 6526
6525 SPSGEYWRKLRQLCAAEVLGPKRVLSFRHIREQE (0) 6421
     MASRVERIRAVGPSVP
5914 VDVSALFYDMAISIVSCASFGKKQRNADEYLSAIKTGISLASGFKIPDLFPTWRTVLAAV 5735
5734 TGMRRALENVHRIVDSTLEEVIEERRGAARECKGRLDMEDNEENLVDVLIKLHEQGG 5564
5563 HLSRNSIKSVIFDMFTAGTGTLASSLNWGMSELMRNPRVMTKLQGEIREAFHGKATV 5393
5392 GEGDIQVSNLSYLRLFIKETLRLHPPVPLLVPRESIDMCEVNGYTIPARSRIVVNAWAIG 5213
5212 RDPKYWDDPEEFKPERFEGNKVDFAGTSYEYLPFGAGRRICPGITYALPVLEIALVQLIY 5033
5032 HFNWSLPKGVTEVDMEEEPGLGARRMTPLLLCATPFVVPVL* 4907

>aaaa01006105.1c $PI (indica cultivar-group) very similar to AAAA01006105.1a
but no Nterm exon present in 2000bp to end of clone (join with a and b above)
12642 (0) IASRVDLICAVGPLTL
12594 VDVSALFYDITISIASCASFGKKHRNVDEYLSSIKTRVSLASRFKIPDLFPSWRTMLAMV 12415
12414 TGMRRALEEVHGIVDSTLEDVIEERQGEKEDKTRPDMVDTKENLVDVLIGLHENGA 12247
12246 HLSRDSIKAVIFDMFTAGTGTLASALNWGMSKLMRNPRVMTKLQGEIRKAFHGKVTVG 12073
12072 EDDIQAANLPYIRLFIEETLLLHPVVPLLVPRESIDVCEVNGYTILARSRIVVNAWAIGR 11893
11892 DPKYWDNPEEFKPEWFEGNIVDFPGSSYEYLPFGAG*RMCPGIAYGLPVLEMALVQLLYH 11713
11712 FD*SLPNGVMKVDMEEEPGLGARRKTPLLLNLFVIPVLQGQQ*  11578

>aaaa01006146.1a $PI (indica cultivar-group) Nterm fragment does not continue
4120 LLVIVLTAVVFFLATILRHGRRAYRLPLGPKPWPIIGNLNLIGALPHRSIHELCK 4284
4285 RYGPLIQLQFGSC

>aaaa01006146.1b $PI (indica cultivar-group) Nterm (plus strand)
13148 MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHELSK 13342
13343 RYGPLMQLRFGSFPVVVGSSAEMARFFL (?) KSHD 13522
13523 IVFTDRPRTAAGKHTTYNYTDILWSPYGAYWRQARKMCVTELFSARRLESFEH 13681

>aaaa01006146.1c $PI (indica cultivar-group) Nterm (minus strand)
14402 MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHELSK 14208
14207 RYGPLMQLRFGSFPVVVGSSAEMARFFL (?) KSHD 14028
14027 IVFTDRPRTAAGKHTTYNYTDILWSPYGAYWRQARKMCVTELFSARRLESFEHIRGEEV 13851
13850 RALLRDLH 13827
13826 GAAAPVLLRDYLSTATLGVISRMVLGKKYVGVEGASA 13716 
only 34 bp until seq b on opposite strand

>aaaa01006154.1 (indica cultivar-group) orth of AP003442.1 $F chr 1 86A like
8151 DLLSRFMKKRDSKGKAFPEDVLQWIALNFVLAGRDTSSVALSWFFWTLMQRRDVERKVVL 7972
7971 EIASVLRETRGDDTARWTEEPLNFDELERLVYLKAALTETLRLYPSVPQDSKYVVADDVL 7792
7791 PDGTVVPAGSAITYSIYSVGRMESIWGKDCAEFRPERWLSADGSRFEPVKDAYRFVAFNG 7612
7611 GPRTCLGKDLAYLQMKSIASAVLLRNSVELVPGHKVEQKMSLTLFMKNGLRVHVKPRD 7438

>aaaa01006229.1a (indica cultivar-group) orth AC021892.5 $F chr 10
these two sequences are exactly identical (probably an error in assembly)
2552 RRPLPPGPRGWPVLGNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQF 2373
2372 LRGHDANFSNRPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVR 2193
2192 EGEVALMVRNLARQQAASVALGQEANVCATNTLARATIGHRVFAVDGGEGAREFKEMV 2019
2018 VELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQ 1857
1856 PDGVAAGEHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLL
     NLFTAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVGRGR 1503
1502 LVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIA 1323
1322 RDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTA 1143
1142 TLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPV 1023

>aaaa01006229.1b(indica cultivar-group) orth AC021892.5 $F chr 10
these two sequences are exactly identical (probably an error in assembly)
11898 RRPLPPGPRGWPVLGNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQF 12077
12078 LRGHDANFSNRPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVR 12257
12258 EGEVALMVRNLARQQAASVALGQEANVCATNTLARATIGHRVFAVDGGEGAREFKEMV 12431
12432 VELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYDNMMNGFINERKAGAQ 12593
12594 PDGVAAGEHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLL
      NLFTAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVGRGR 12947
12948 LVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVWAIA 13127
13128 RDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTLMTA 13307
13308 TLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPV 13427

>aaaa01006291.1 (indica cultivar-group) 64% to AQ865256.1
6318 LVQLTMVIQETLRLYP 6271
6239 NDMKLGGIDIPKGTNIWIPIAMAHRDPSVWGPSADKFDPDRFANGIAGACKPPHMYM 6069
6068 PFGVGVRTCAGQNLAMVELKVVLSLLMSKF 5979

>aaaa01006345.1 (indica cultivar-group) 77% to AC096855.1 $F
10409 VLQLLKLLLVRHRRPRTPPGPWRLPVIGSMHHLVNVLPHRKLRELAAVHGPLMMLQLGET 10230
10229 PLVVATSKETARAVLKTHDTNFATRPRLLAGEIVGYEWADILFSPSGDYWRKLRQLCAAE 10050
10049 ILSPKRVLSFRHIREDE 9999
9730 VNLSVMFHSVTNSIVSRAAFGKKRKNAAEFLAAIKSGVGLASGFNIPDLFPT 9575
9574 WTGILATVTGMKRSLRAIYTTVDGILEEIIAERKGIRDEKISGGAENVDENLVDVLIGL 9398
9397 QGKGGFGFHLDNSKIKAIILQDMFA 9218
9217 GGTGTSASAMEWGMSELMRNPSVMKKLQAEIREVLRGKTTVTEADMQAGNLRYLKMVI 9044
9043 REALRLHPPAPLLVPRESIDVCELDGYTIPAKSRVIINAWAIGRDPKYWDNPEEFRPERF 8864
8863 EDGTLDFTGSNYEFIPFGSGRRMCPGFNYGLASMELMFTGLLYHFDWSLPEGVNEVDMAE 8684
8683 APGLGVRRRSPLMLCATPFVPVV 8615

>aaaa01006348.1 (indica cultivar-group) orth of AP003752.1 $F chr 7 100%
492 QFLLETLRLYSPVPAIRRRTAAAVEMGGVTVPGGTMLTFPIATMHRDEEVWGADAGVFDP 671
672 MRFDGGGGAMAKLLSFSTGPRACVGQSFAMVEAKAVVAAILRRFRLE 812

>aaaa01006365.1 (indica cultivar-group) orth AC090873 $F >99%
6689 EKRRRLPPGPATVPVLGNLLWATNSGMDIMRAVRRLHARHGPMLGLRMGSRLEVIVADRR 6510
6509 LAHAALVESGAAMADRPEFASRALLGLDTATISNSSYGPLWRLFRRNFVAEVAHPARLRQ 6330
6329 FAPARAAVLEELTDKLRRRQEDAGAGTILETFQYAMFFLLVAMCFGELLDERAVRDIAAA 6150
6149 QRDLLLHSSKKLRVFAFLPAITTRLFAGRMKAMIAMRQRLKGMFMPLIDARRARKNLVD 5973
5972 DHGDATAPPPPAASATTLPHSYVDTLLNLRINDNGGERALTDDEMVALCSEFLNG 5808
5807 GTDTTSTALEWIMAELVKNPIIQDKLHGEIKGAITSNSGKVSEEDVQKMPYLKAVVMEG 5631
5630 LRRHPPGHFVLPHAPAEDMELGGYTIPKGTLVNFTVADMGMDGAAWDRPREFLPERFMAG 5451
5450 GDGEGVDITGTREIRMMPFGAGRRICPGLGVATLHLEYFVANMVAAFKWRAAEGEAVDVD 5271
5270 GEKLEFTVVMEKPL 5229

>aaaa01006398.1a (indica cultivar-group) (partialI)
1854 MVVVVVVVAIAIVVPLLYLVLLPPARRGGGDSARRRLPPSPRGLPLLGHLHLLGALP 2024
2025 HRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLY 2198
2199 GGRDVAFAPYGEYWR 2243 sequence gap here

>aaaa01006398.1b $FI (indica cultivar-group) no ortholog
4560 MAVSLLPAVLVLLAIVAPLLYLVLLPAVKYTTSNGAARWEDDDGGDGRRRRRLPPSPRGLPLLGHLHLLGAL 4775
4776 PHRALRSLAAAHGPVLLLRLGRVPAVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLYG 4955
4956 GRDVAFAPYGEYWRHARRICVVHLLSARRVLSFRRVREEEAAALVARVRAAARAPGAR 5129
5130 GAVDLVEHLTAYSNTVVSRAVFGDESARGLYGDVDRGRALRKLFDDFVELLGQEPMGELL 5309
5310 PWLGWVDAVRGLDGKVQRTFEALDSIIEKVIDDHRRRRRRHEVGRQMDSDDDGG 5471
5472 GGGDHRDFVDVLLDVNETDKDAGIRLGTIEIKAIIL (0)
     DMFAAGTDTTTTAMEWAMAELITHRDAMHKVQDEIRAVVGVTG 5831
5832 CVTEDHIDRLPYLKAVLKETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIG 6011
6012 RDPVTWGEHAEKFIPERFLNNNVDYKGQDFGLVPFGAGRRGCPGMGFAVPTIEMALASLL 6191
6192 YNFSWETRPVDRRCKSGTSSLDMSEVNGISVHLKYGLPLMAKFYSS* 6332

>aaaa01006398.1c $FI (indica cultivar-group) ortholog of AP003434.1 95%
9740  MAVSLLVVLLVVLAIVVPLLYLVLLPAGNTTRNGAARWEDDGGDGRRRRRLPPSPRGLPL 9919
9920  LGHLHLLGALPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRSRDVEFASRP 10096
10097 RMAMAELLLYGGRDVAFAPYGEYWRQAPRICVVHLLSARRILSFRRVREEEAAALVGRV 10273
10274 RAAAADVVDLSDLLIAYSNTVLTRIAF GDESARGGGGGDRGRELRKVFDDFARL 10435
10436 LGTEPMGELLPWFWWVDALRGIDGKVQRTFEALDGILERVIDDHRRRREGGRLMDDDGGG 10615
10616 DHRDFVDVLLDVNETDKDAGIQLGTVEIKAIIM (0) 10711
11174 DMFVGGSDTTTTMIAWTMAELINHPRAMHKAQNEIRAVVGNTSHVTKDHVDKLPYLKAVF 11353
11354 KETLRLHPPLPLLIPREPLADAQILGYTIPAHTRVVINAWAIGRDPAAWGQQPDEFSPEK 11533
11534 FLNGAIDYKGQDFELLPFGAGRRGCPGIVFGVSAMEIALASLLYHFDWE 11680
11681 AAATDHRRRGSQAWALPVDMSEVNGIAVHLKYGLHVVAKPRMP* 11812

>aaaa01006398.1d $PI (indica cultivar-group) seq gap before 12414 
first exon has two frameshifts and part is missing (1205)
orth AP003434.1d
      GDESARG (fs) RALRKLFENFARLLGTEPMGELLPWLGWVDAV (fs)
      WLDGKVQRTFEALDSIIEKVIDDHRRRRRRREVGRQMDSDDDGGGGG
      DHRDFVDVLLDVNETDKDAGIRLGTIEIKAIIL (0)
12924 DMFAAGTDTTTTAMEWAMAELITHRDAMHKVQDEIRAVVGVTGCVTEDHIDRLPYLKAVL 13103
13104 KETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIGRDPATWGEHAEKFIPER 13283
13284 FLNNNVDYKGQDFGLVPFGAGRRGCPGMGFAVPTIEMALASLLYNFSWETRPVDRRCKSG 13463
13464 TSSLDMSEMNGISVRLKYGLPLIAKSHFP* 13553

>aaaa01006486.1 (indica cultivar-group) orth AP003752.1e $F chromosome 7 99%
13019 IELSQRFQELTADVISRTAFGSSYSEGKQVFLAQRKLQFLAFSMFLTIQIPG 13174
13175 FRYLPTKKNLKIWSLDKKVRSMLTNIIKIRLANKDTMGYGNDLLGLMLETCAPEHDE 13345
13346 SQQLSMDEIIAECKTFFFGGHDTTSHLLTWTMFLLSTHPEWMRKIRKEVTTMCGDEV 13516
13517 PTGDMLNKMNLLNMFLLETLRLYGPVSLISRRTGTNAKFGGIKVPEGTILRIPIATIHR 13693
13694 DKEVWGEDADEFKPARFENGVSKAAKHPNALLSFSNGPRSCIGQNFAMIEAKAVITMILQ 13873
13874 RFSFTLS 13894

>aaaa01006724.1 (indica cultivar-group) orth AP003434.1c $F chr 1 99% also AU163704.1
7723 RRRLPPSPPWGLPLLGHLHLLGALPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEE 7544
7543 VMRTRDLEFASRPRVAMAERLLYGGRDVAFAPYGEYWRQTRRICVVHLLSARRVLSFRRV 7364
7363 REEEAAALVARVRAAGGAVDLVEHLTAYSNTVVSRAVFGDESARGLYGDVDRGRVLR 7193
7192 KLFDDFVELLGQEPMGELLPWLGWVDALNGMEVKVQRTFEALDGILEKVIDDHRRRRR 7019
7018 EVGRQMDDGGGGDHRDFVDVLLDVNETDMDAGVQLGTIEIKAII 6887
5268 DMFAAGTDTTTTVIEWAMAELITHPDAMRNAQDEIKAVVGITSHITEDHLDRLPYLK 5095
5094 AVLKETLRLHPPLPLLVPHEPSSDTKILGYSIPARTRIVINAWTIGRDQATWGEHAEEFI 4915
4914 PERFLESGLDYIGQDFVLVPFGAGRRGCPGVGFAVQAMEMALASLLYNFDWETRVVDRRS 4735
4734 EFGTSSLDMSEMNGLSVHLKYGLPLIAI 4651

>aaaa01006859.1a (indica cultivar-group) Cterm runs off end (partialI)
exactly matches AAAA01006859.1b could be a duplication or missassembly
    MMPFGVGRRICPGLGLALLQLEYFVANMVREFEWGMVDGDCGG 236
237 GINLAERPEFTVIMEQPLRALVVPRRRE* 326

>aaaa01006859.1b $FI (indica cultivar-group) identical to two copies of
aaaa01047800.1a and aaaa01047800.1b (C-term)
11428 MEVILLPLVVIITSTMLLLLIISTAKNRHHGTANLPLPPAPPSVPVVGPLLWLVRAR 11598
11599 SNLEPAIRELHRRHGPILSLTFLSPRAAIFVSSREVTHRALVQRGHTFASRPPAIAPFAV 11778
11779 LTSGQCTVSSAPYGPLWRSLRRNLTSGVLGHGSRAPLYAPARRWALHLLTSDLAAASGNT 11958
11959 GGGVAVAVVDCLQFAMFSLLTYMCFGKRLDRRGVREIEAVQRELFSSYISFQVFAFCP 12132
12133 TVTKRLFFRRWQKVLSIRRRQEDIFLPLIEERRKRIKISSMDNDGSMVCCYVDTIISHK 12309
12310 LPKEAGDRRLTDGELVSLCTEFLTASVDTIVTALQWIMARVVEQPEIQAKLLDEINRV 12483
12484 VSSDKEHVDEEDIKSMAYLKALVLEGLRRHPPAHFLLSHAAVEETSLDGHRIPAGRSVNF 12663
12664 SVADVAHDENVWSRPEEFLPERFLDGGEGAGTDLTGSREIKMMPFGVGRRICPGLGLALL 12843
12844 QLEYFVANMVREFEWGMVDGDCGGGINLAERPEFTVIMEQPLRALVVPRRRE* 13002

>aaaa01007044.1 $PI (indica cultivar-group) seq gap at 5222 no Nterm exon
might be in this gap but also one frameshift so probably a pseudogene of an 
AP003523 like gene.
6146 DMFAGGSETTSTTLEWA 6196 (frameshift)
6196 PEVMQKAQAEIRHALQGKSRVTEDDLINLKYPKNIIKETMRLHPLASLLVPRKCQESCKI 6375
6376 LGYDIPKGTILIMNVWTIGRDHRYWDDAEVFIPERFEDTTIDFKGTHFEFIPFGAGRRMC 6555
6556 LGMTFAHATIELALTALLYHFDWHLPHGVTHDGMDMEEQFSVTVSRKRDLYLHPIQHVGVEEI* 6747

>aaaa01007181.1a (indica cultivar-group) orth AP003990.1h $F chr 2 99% 
N-term (orientation probably incorrect on either a or b)
1038 YLLLLPLLVVPLLYLAASSSRRSGRLRLPPGPWALPVIGHLHHLALAGAPTHRAMRDMAR 859
858  RHGPLMLLRFCELPVVVASSPDAAREIMRTHDVAFASRPIGPMLRLVFQGAEGVIFAPYG 679
678  DGWRQLRKICTVELLSHRRVHSFRPVRADELGRLLRAVADQAALSSSSPVNLTGMISAFV 499
498  ADSTVRAIIGSRSRHRDTFLRLVEDGLKIMPGMSLPDLFPSSRLAMLLSRVPAKI 334
333  ERRRRGMMGFIDTIIQEHQESRAAAEDEDLLDVLLRLQKDMDSQYPLTTMN 181
180  IKSILX 166
88    DMFGAGSETSATTLQWAMAELMRNPAV 2

>aaaa01007181.1b (indica cultivar-group) orth AP003990.1h $F chr 2 100% C-term
6892 VMRRAQDEVRRELAVAGNDRVTEDTLPSLHYLRLVIKETLRLHPPAPLLLPRECGGACKV 7071
7072 FGYDVPAGTMVLVNAWAIGRDAAAWGAAAEEFSPERFERCERDFRGADFELIPFGAGRRI 7251
7252 CPGMAFGLAHVELALAALLFHFDWRLPGGMAAGEMDMTEAAGITVRRRSDL 7404

>aaaa01007181.1c (indica cultivar-group) orth AP003990.1i $F chr 2 99%
8111 LPPGPWALPVIGHLHHLAGDLPHRALSALARRHGALMLLRLGEVQAVVASSPDAAREIMR 8290
8291 THDAAFASRPLSPMQQLAYARDAEGVIFAPYGDGWRHLRKICTGELLSARRVQSFRPVRE 8470
8471 AELVRLLRSVAEATSSSSSGSLVNLTELISAFVADSTVRAIIGSRFEHRDAYLRML 8638
8639 QDGLKIVPGMTLPDLFPSSRLALFLSRVPGR 8731
9019 DMFGAGSESSATVLQWTMAELMRNPRVMQKAQDEVRRALAGHDKVTEPNLTNLPYLRL 9192
9193 VIKETLRLHPPAPLLLPRKCGSTCKILGFDVPEGVMVIVNAWAIGRDPTYWDKPEEFVPE 9372
9373 RFEHNGRDFKGMDFEFIPFGAGRRICPGITFGMAHVELVL 9492 frameshift
9494 LYHFDWELPQGMAAKDLDMTEDFGVTTQRRSNLLVRPI 9607

>aaaa01007181.1d (indica cultivar-group) orth AP003990.1j $F chr 2 99%
10296 LLILLGSERRTAARTRLPPGPWALPVVGHLHHLAGGLPPNRAMRDLARWHGPLMLLRLGE 10475
10476 VEX 10481 frameshift
10486 VVASSPDAAREIMRTHDVAFASRPVGPMSRLWFQGADGLVFAPYGEAWRRLRRVCTQELL 10665
10666 SHRRVQSFRPVREDELGRLLRAVDAAAAAGTAVNLTAMMSTYVADSTVRAIIGSRRLKDR 10845
10846 DAFLRMLDELFTIMPGMSLPDLFPSSRLAMLVSRAPGRIMRYRRRMRRIMDSII 11007
11008 HEHQERRAAADAAGDDDDDDDEDLVDVLLRLQKEVGAQYPLTTENIKTVM 11157
11249 QDIFGAASETSSTTLEWVMAELMRSPSAMRKAQDEVRRALAAGAAGHDTVTEDILPNLNY 11428
11429 LKLVVKETLRLHPPAPLLAPRRCDSPREVLVLGHDVPAGATVLVNAWAIGRDTAAWGGAA 11608
11609 EEFSPERFERCERDFRGADFELIPFGAGRRMCPGMAFGLVHVE 11737

>aaaa01007189.1 $FI (indica cultivar-group) ortholog of AL662990.1
     MPSQLIAQNDHAYVLTFL
4128 MSIAMAILLLVALFYRIKKQAAAMAAKRKQQPKLPPGLATMPVVRNMHQMLMNKPVFRWIHR 3943
3942 LLDEMDTEILCLRFGRVHVIAVASPEMARELLRKKDAMLASRH 3814
3814 SSFASRTFSFGYKNTIMSPGGDQWRKMRRVLTSEILSPAMERRMLGRRVEEADHLVNYVY 3635
3634 GHCNDGTVDVRHVTRHFCGNIIRKLVFGRRHFNSGDGNIGPGRDEEAHIDALFTALDYHG 3455
3454 AFSVSDYFPTLVGLDLDGHEEVVNGLMNTFNRLHDPIIMERIEEWKSLRTKGDKRREVAD 3275
3274 FLDVLISLEDAQGKPFLSVDEIKAETL (0) 3194
2567 EIILATVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGRERLVEESDIHNLTYLKACI 2388
2387 REAFRLHPYHPFNPPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERH 2208
2207 LKNTGTVVLAEPELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIEL 2028
2027 QESATSLQLSKPLFMQAKPRLLLHLYEADVLN* 1929

>aaaa01007242.1 $PI (indica cultivar-group) ortholog of AP003575.1 99%
11280 MAAVQLDSGLLIGFLFLATCLVVAVRSYLRSGGADGGRGGAAITSPPALPVIGNLHQLGR 11459
11460 GRHHRALRELARRHGPLFQLRLGSVRALVVSSASMAEAVLRHQDHVFCGRPQQHTARGTL 11639
11640 YGCRDVAFSPYGERWRRLRRVAVVHLLSARRVDSFRALREEEVASFVNRIRAASGGGGGV 11819
11820 VNLTELIVGLTHAVVSRAAFGKKLGGVEPAKVRETVGELADLLGTIAVSDMFPRLRWVDW 11999
12000 ATGLDARTKRTAAKLDEVLEMVLRDHEQSRGDDDDDDGDGEARDLMDDLLSMANGGDDHG 12179
12180 YKLDRIDVKGLLILV (0)
      DMFAAGTDTVYKSIE frameshift
      MAEL 12359
12360 IKNPAEMAKVQAEVRHVVAAAHGGEGDEDAVVIVKEEQASS frameshift
12482 LGKMTLLRAAMKEAMRLHPPLPLLIPREAIQDTVLHGHRVAAGTRVMINAWAIGRDEAAW 12661
12662 EDAGEFRPGRFADGGDNAGVEYYGGGGDFRFMPFGAGRRGCPGMAFATRLAELVVANMAC 12841
12842 WFEWELPDGQDVQSFEPSRSSSREVCRLGSSSGKIGNHVYAVETT 12976

>aaaa01007286.1 (indica cultivar-group) orth AP003571.1e $F chr 6 100%
4839 YFYLGLALASLLVVLFARRRRSAAHGDGGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDL 4660
4659 ARRHGPVMMLRLGEVPTLVVSSRDAAREVMRAHDAAFASRPLSATVRVLTSGGRGIIFAP 4480
4479 YGGSWRQLRKIAVTELLTARRVASFRAIREEEVAAMLRAVAAAAAAGRAVELRAALSALV 4300
4299 AETTVRAVIGDRCKDRDVFLRKLQRTIELSAGFNPADLWPSSRLAGRLGG 4150
4149 AVREAEECHDTVYGILDGIIQEHMERTSSGSCGAGDGDGDGEDLLDVLL 4003

>aaaa01007309.1 (indica cultivar-group) 65% to CYP711
8043 QGTYVWLAPGVLARDAAQFPEPEEFRPERFAAEAAEERARHPYAHIPFGIGPRACVGHR 8219
8220 FALQQVKLAAVSLYRRYVFRHSPAMESPLQFDFDLVLAFRHGVKLRAIKRT 8372

>aaaa01007330.1a (indica cultivar-group) orth CYP72A18 $F AP002839 100%
5638 LLQVTMILYEVLRLYPPVVFLTRRTYKEMELGGIKYPAEVTLMLPILFIHHDPDIWGKD 5814
5815 AGEFNPGRFADGISNATKYQTSFFPFGWGPRICIGQNFALLEAKMAICTILQRFSFE 5985
5986 LSPSYIHAPFTVITLHPQHGAQIKLK 6063

>aaaa01007330.1b (indica cultivar-group) orth CYP72A17 $F AP002839 100%
8732 LMIDGADLWQVTMVLHEVLRLYPPVVMMNRRTYKEIELGGVRYPAGVMLSLPVLFIHR 8559
8558 DAAAWGHDAGEFDPGRFAEGVARACKDPGAGAFFPFSWGPRICIGQNFALLEAKVALGM 8382
8381 ILQRFAFELSPAYAHAPYTVLTLHPQHGVPVRLR 8280

>aaaa01007399.1 (indica cultivar-group) orth AC105746.1 $F chr 10 >99%
6641 SFLLVSIMLSLLLVLFSHLLQRIAAARRRLPPGPCPLPLIGNLLDIGDLPHRSFARLAER 6820
6821 YGPLMTVRLGAATCVVASSPATARAVLQTHNASLAGRGRQDAWHAGGHAENSVFVLPPGR 7000
7001 KWRLLRKLGAAHLFSRRKLAELAPLRDEIVGGLLRRVAERADHRGGAPVNVGRLALAANV 7180
7181 ELLWRSVFSTRLDAATLDVLCDVAREAAVLLGTPNVSDFFPAVAALDLQGLRRR 7342
7343 LAELMKNTYRLVDAQIDHRMGCRELRGGRGGEAMDLLDVLLDMSEQERED 7492
8017 DLFVGGSDSTATTVEWAMAELLQNPEIMKTLQQEIKMVLGTRSQVEESDIGQLPYLQ 8190
8191 AIVKETLRLHPIVPLRLYEAERTVEIEGHTIPKGSKVIVNAWAIHQSVKVWIQPEKFLP 8367
8368 ERFITKDIDFAGRHFEFIPFGSGRHICIGLPLANRMLHMILGSLMHQFKWTMPQMVNRNG 8547
8548 LDMAE 8562

>aaaa01007431.1a (indica cultivar-group) orth AP003990.1e $F chr 2 99%
lower case does not match japonica seq, but matches seq b
4252 NLPPSPSRLPFIGSFHLLRRSPLVHRALADVVRQLGAPPLMYMEIGEVPAIVVSCADAAR 4431
4432 EIMKTHDINFASRPWPPTVQKLRAQGKGIFFEPYGALWRQLRKICIVKLLSVRRVSSFHG 4611
4612 VREEEAGRLVAAVAATPPGQAVNLTERIKVAIADTTMRPMIGERFERREDFLEV 4773
4774 LPEIVKLASGFSLDDLFPSSwlagaiggsrrRGEAVNRASYELVDSAFRQRQQQKEAM 4947
4948 AAPPPDIAKEEEDDLMDELIRIHKEGSLEVPLTAGNLKAVI  5070
5313 ELFCAGSETSSNAIQWAMSELVRNPRVMEKAQNEVRSILKGKPTVTEADMVDLTY 5486
5487 VKMIVKETHRLHPVLPLLTPRVC*QTCQIMGYDVPQGSVIFINSWAIMRDPKHWDDAETF 5666
5667 KPERFEDSEIDLKGTNYEFIPYGAGRRICPGLALAQVSIEFILTTLLYHFNWELPKGAAP 5846
5847 KELDMTEDMGLTIRRKNDLYLLPTL 5921

>aaaa01007431.1b (indica cultivar-group)
10668 LPPGPWRLPVIGSLHHVVGDRLLHRSMARIARRLGDAPLVYLQLGEVPVVVASSPGAARE 10489
10488 VTRTHDLAFADRALNPTARRLRPGGAGVALAPYGALWRQLRKICVVELLSARRVRSFRRV 10309
10308 REEEAGRLVGALAAAAASPGEEAAVNFTERIAEAVSDAALRAMIGDRFERRDEFLQ 10141
10140 ELTEQMKLLGGFSLDDLFPSSWLASAIGGRARRAEANSRKLYELMDCAIRQHQQQRAE 9967
9966  AAVVDGGAGVEDDKNQDLIDVLLNIQKQGELETPLTMEQIKAVIL 9790
9595 DLFSGGSETSATTLQWAMSELIKNPMVMQKTQAELRDKLRRKPTVTEDDLSGLKYVKL 9422
9421 IIKETLRLHPVVPLLVARECRESCKVMGYDVPKGTTVFVNVWAIGRDPKYWDDAEEFRPE 9242
9241 RFEHSTVDFKGVDLEFIPFGAGRRICPGMAFAEAIMELLLAALLYHFDWELPNGMVASEL 9062
9061 DMTEEMGITVRRKNDLHLRPIL 8996

>aaaa01007506.1 (indica cultivar-group) orth AP003514.1 $F chromosome 6 99%
12081 MPHYRAWMSRYGKVFVSWSGATPALCVGDYAMVKQILSDRTGLYGKPEPGPSILALIGNG 11902
11901 LIFIGGDDWARHRRVVHPAFAMDKLKMMAKTMADCAREVIREWEARATADGERRVQVEVG 11722
11721 GQLQELTADVISHTAFGSSYREGKEVFVAQRELQSIAFSAINSTRFPGSQYIP 11563
11562 TKTNLRRRHLAKKVRGTLMAIIRERQAAAAKEDSGHGNDLLGLMLEANATDACGSGG 11392
11391 ENSMTMDEIVDECKTFFFAGHDTTSHLLTWAMFLLGTHPEWQHRLREEV 11245

>aaaa01007597.1 (indica cultivar-group) orth AL662934.1 $F chr 4 99%
8852 LVSLLTLPILLALLTRKSSSKKRKPPGPWNLPLIGGLLHLLRSHPQVALRELASKYGP 9025
9026 VMFLRMGQIDTVVVSSPAAAQEVLRDKDVMFASRPSLLVSEIFCYDNLDVGFAPYGAYWR 9205
9206 MLRKLCTVELLSTKVVRQLAPVRNDETLTLVRNIEAASSCHGGGGGKKPVTLARLLTTCT 9385
9386 NTITAKAAFGQACGVELQEQFLTALDVGLKFSGGFCFGDLFPSLRFIDAMTGLRSC 9553
9554 LWRARGQLDSVFDKIIAQCEEHQGDSLVNVLLRIRDRGDLEFPFGTTNIKAIIL
     DMFTGGTETTSSAAEWVMSELMRNPEVMAKVQAEVR 9913
9914 RVFDNKSPQDHEGLIDNLRYMKMVIKETMRLNPVLPLLMPHLCRETCDIGGYEVVEGTR 10090
10091VVINSWAMARSPEYWDDAEEFKPERFEDGMADYKGSRFEYLPFGTGRRRCPGDTFGMVLL 10270
10271ELIVARLLYYFDWSLPAGMQPDDVDMDFVVTATTRRKNHLQLV 10399

>aaaa01007665.1 (indica cultivar-group) ortholog of AC104708.1a BI305681.1
runs off end
11936 AWIPEITSITSSMLDKWELQDEVRTEFEIDVNKEFHTLIADVISCVAFGSSYEE 11775
11774 GKRVFQLQEEQLKLVILAMRTVYIPGFR (2?)
      FVPTKK 11595
11594 NRRRKIVNQEIRNSLRKLIEINGRKCEDSNNLLGMMLSASKIDSEFKMGIEEIIDECKTF 11415
11414 YFAGKETTATLLTWATLLLALHQEWQNKARDEVLQVCGKYEHPKAENLSELKI (0)
      VSSSILY 11235
      VNMVLKETLRLYPPAVFLNRIANRDVKLGKLDIPAGTQ 11055
11054 LQLPILDIHHDVSIWGADADEFDPSRFAEGKSYHLGAYFPFGIGPTICVGQNLAMVEAKV 10875
10874 ALAMILQRFALVVSPSYVHAPMLVVTLQPQYGAQVLVHKI* 10752

>aaaa01007725.1 (indica cultivar-group) 74% to AL607001.1 chr 4, gene 2
5485 LVIYGVTLVIGWFLLHGVYRWMNPQCNGRLPPGSMGFPLVGETFQFFKQSPSIDMPGYYK 5306
5305 QRMK
2968 RYGPVFKTSLVGQPIVVSLDPEVNRFIFEQEGKLFRSWYPNTTNTIFGKKSVTVYTDT 2789
2788 VHKFIRSFASKLFGPNNMKELLLPELESSMRESFMTWAKEPSIDVKESISN 2633
2247 MIFDLIAKKMISLDRTKSRQLRKNFDEFFQGMVSFPIYFPGTQFYRCMQ 2101
1923 GRRNVQKTLTDILKERLSAPENRHNDLVDQIVQELQNDNPVIDVNFAVDAIAALLFASFA 1744
1743 TLSSTLAVGFKFLTDNPKVIEEL 1675
1336 EEHKKILKKRDDMNSGFTWEEYKSLVFTPQ
     VMNEITRISNVAPGIFRKTLVDVQ 1076
730 YTIPAGWLVMISPMAVHLNPKLFEDPLEFNPWRW 629

>aaaa01007897.1 $FI (indica cultivar-group) 
9748 MPAMAASLAWLLLALLLASLYTATHRIAAARRRLPPGPTPLPLVGNLLSVSRTSP 9584
9583 HRSLARLAARYGPLMRVRLGVVDYVVVSSPAVADDIYHSRHNAHLSSRPPYDAWWGEKHR 9404
9403 LNSVIALPPHAVWRAQRRLAMEEVMSPGRLDALAPLRREKVRELLVRVRRVAAA 9242
9241 RGDGDGELVPVEVGQAAFEGFLSILSSTMVSVDLADSDLRDVVREAAILAATPNVSDIF 9065
9064 PAIAAADLQGYRRRMGELVARGYGIFEELLARRKGGREAGERRKDDLLDVVL 8909
8908 DREDELKKESNPVLDRNAIKGLIT (0)
7478 DLMVAGTDTSSSTIEWAMAELLQNSESMQKVKDELRRVIGTRTQIEESDISHLPYLQAII 7299
7298 KETLRLHSNVPMSYYMAEATVEVQGYTIPKGTNIIVNIWAIHHQPNVWVDPDKFMPERF 7122
7121 IGKDTNFFGKHPELIPFGGGRRICLGLPLAYRMVHVVLASLLFHFDWKLPEGAKKDGIDM 6942
6941 SEKFGLVLSMATPLKALATRSCNDM* 6864

>aaaa01008113.1 $FI (indica cultivar-group) 
6975 MELTTISPVFLISLLGVPLLYLLWSKASKSPSGAPAAPPPPPGPTPFPVIGNIPDLLRGGEL 7160
7161 HRALTGLAASYGPVMSLRFGMASTVVLSSPDVAHEALHKKDGAISSRWVPDNANVLGHQD 7340
7341 VSMAWLPSSSPLWKHMRTLASTLLFTSRRLGASRGIRERKARELVDYLGARSGRPVRVGL 7520
7521 AVFGSVLNFMSNVFFSEDVVELGSETGQEFQQLIADSVAETAKPNISDFFPFLSA 7685
7686 LDLSRRRRAAAKNLKKFYDFFDDVIDRRLSSGEKPGDLLDSLLELHAKSQL 7838
7839 ERPLIRALMT (0) 7868
8303 DLFIAGSHTTTTTVEWALAELLRNPSKMAKARAELGEAFGRGAIEEGELARLPYLNAVI 8479
8480 KETLRLHPPAPLLLPHRVSSDSEPAGGVTLGGYSVPSGARVLINAWAIGRDPAAWSPEPD 8659
8660 AFSPERFLGREADYWGRTLEFIPFGSGRRACPGIPLAVAVVPMVVAAMVHSLEWRLPEGM 8839
8840 APGDVDVGDRFGAVLELATPLWAVPVKV* 8926

>aaaa01008150.1 (indica cultivar-group) orth of AP004139.1 $F chr 2, 86B like
9567 DDLLSRFMRKGSYSDESLQHVALNFILAGRDTSSVALSWFFWLVSTHPAVERKIVREL 9394
9393 CTVLAASRGADDPALWLAAPLNFEELDQLVYLKAALSETLRLYPSVPEDSKHVVADDYLP 9214
9213 DGTFVPAGSSVTYSIYSAGRMKTVWGEDCLEFRPERWLSADGSKFEPHDSYKFVAFNAGP 9034
9033 RICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSL 8914

>aaaa01008155.1 (indica cultivar-group) orth AP003727.3 $P chromosome 1 100%
1298 KTTTTDLLWLLLAGNEASAAAERKLTTALALSWTLLMLATHPEWRAAVREEVEEVTGWSG 1477
1478 PMDAAAMGKLTKMGCMLNEVLRLYPPSP 1561

>aaaa01008222.1a (indica cultivar-group) 82% to AP003612.1 $F 43% to 72A8
2985 MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGPPYRFLVGCVREMVALM 2806
2805 AEATAKPMPPAAPH 2752
2761 ALPRVLAFYHYWRKIYG 2702
2421 FLIWFGPTPRLTVAEPELIREIFLTRADAFDRYEAHPVVRQLEGDGLVSLHG 2242
2241 DKWALHRRVLTDAFYPDNLNRLIP 2062
2061 HVGKSVAALAAKWGAMAEAGGSGEVEVDVAEWFQAVTEEAITRATFGRSYDDGRVVFAMQ 1882
1881 GQLMAFASEAFRKVLVPGYR
1738 FLPTKKNRLSWRLDREIRRSLMRLIGRRSDEAEQGEKADDGSFRDLLGLMI 1583
1582 NAGAAAATRGNAGGEKNSPAAAIPVEDMLEECKTFFFAGKQTTTNLLTWATVLLAMHPDW 1403
1402 QERARREVFDVCGAGELPSKEHLPKLKT 1313
1190 LGMIMNETLRLYPPAVATIRRAKVDVQLSDGCMIPRDMELLVPIMAIHHDTRY 1032
1031 WGPDASQFNPARFANGASKAAKHPLAFIPFGLGSRMCVGQNLARLEAKLTMAILLQRFEI 852
851  RTSPNYVHAPTVLMLLYPQYGAPLIFRPLSSIV 753

>aaaa01008222.1b (indica cultivar-group) 86% AP003612.1 $F
6126 AVAAAAAVWVAMHVAARMADALWWRPRRLEAHFAAQGVRGPPYRFLLGSVREMVALMAEA 5947
5946 SSKPMPPAAPHNALPRVLAFYHYWRKIYG 5860
5717 LAFLIWFGPTQRLTVAEPELVREILLTRTEAFDRYEAHPVVRQLESDGLVSLHGD 5538
5537 KWARRRR 5517

>aaaa01008232.1 (indica cultivar-group) 87% AC074282.1 $P
213 DDTLPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRPERWLGDDG 74

>aaaa01008333.1a $FI (indica cultivar-group) very similar to AP003990.1
6914 MAMVQDATGYLSLFLALLSITLVLHKVARKASGDGAGKPRLPPGPWRLPVIGNLHQIAMGG 6732
6731 PLVHRTMADLARRHDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTVRVL 6552
6551 MSDGVGLVFAPYGALWRQLRKIAMVELLSARRVQSFRGIREDEVGRLVAAVAAASAAQ 6378
6377 PGEAVNVSERIAVLIA DSVVRALMGDRFDRRDEFLDQLAERVKITSGFSLGDLFPSSRL 6201
6200 ASFIGGTTRRAEANHRKNFELIECALRQHEERRAARAGAAAAGAVDDDEDLVDVLLRIQK 6021
6020 EGKLEVPLTMGNINAVIY (0) 5967
5378 DLFGAGSETSANTLQWVMSELILNPRVMLKLQAELRGILQGKQRVTEDDLVELKYLKLVI 5199
5198 KETLRLHPVVPLLLARECQDTCKIMGYDIPVGTIVFVNVWVICRESKYWKDAETFRPERF 5019
5018 ENVCVDFKGTHFEYIPFGAGRRMCP 4944
4945 PGVAFAEASMELVLASLLYHFDWKLPNDILPTKLDMTEEMGLSIRRKNDLYLIPTICVPPLAA* 4754

>aaaa01008333.1b (indica cultivar-group) runs off end of clone (partialI)
like AP004000 exon 2
11117 EMFGAGSETSANTLQWLMSELILNPRVMSKAQVELSDTLRGKQTVTEDDLAGLKYLKLII 10938
10937 KENLRLHPVVPLLLPRECQKTCKVMMYDVPVGTTVLVNVWSINRDPKYWEDPETFKPERF 10758
10757 EDGHIDFKGTDFEFIPFGAGRRMCPGITFAEAIMELALASLLYHFDWKLLGNGISSTKLD 10578
10577 MTEELGATVRRKNDLYLVPTIRVPLPADS* 10488

>aaaa01008340.1 (indica cultivar-group) 8184% to aaaa01007189 (partialI)
11247 MFFPSTANMREQNN
11205 TIIVSIAMTILLLVAFFCRIKKQAAMAAKNKRKKQPKLPPGPATMPVLGNMHQMLMNKPVFRWI 11014
11013 HRLLDEMDIEILCLRLGRVHVITVASPEMAREVLRKNDALMTSRPASFAWRAFSFGYKN 10837
10836 TIGSTGDQWKKMRRALASEILSPAME 10759
sequence gap here
10649 IIMERMHEGRALRRNGDERREVADFLDVLVSLEEAQGNPLLSLDEVKAETL (0?) 10497
7815 EIFIATVDNPSNAVEWALAEMVNNPNVMKKAVDELDVVVGKERLVEESDIQNLTYLKAC 7639
7638 IREAFRIHPYHPFNPPHVAISDTIIAGYLIPKDSHVMLSRIGLGRNPRVWVNPLEFRPER 7459
7458 HLNNATSTMVLAEPELRFVSFGASRRGCPAVSLGTSITMMLFARLLQGFTWSIPPGADKI 7279
7278 ELQESASSLQLSKPLLMQAKPRLLLHLYELDRL* 7177

10836 TIGSTGDQWKKMRRALASEILSPAME 10759

missing region resembles this

RRMLGQRVEEADHLVNYIYRNCNSGTVDIRHVT 4091
4090 RHFCGNIIRKLVFGRRHFAFGAGNIGPGRDEEAHIDALFTALDYLGAFSISDYFPSL 3920
3919 VLNGLMSTFRRLHDP

10649 IIMERMHEGRALRRNGDERREVADFLDVLVSLEEAQGNPLLSLDEVKAETL (0?) 10497

>aaaa01008385.1 (indica cultivar-group) missing the Nterminal
ortholog of C72003 contig
8309 TLKLGLATNVIISSREAAAEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSSDPQW 8136
8135 KALRGIHASHVFTPRVLAAVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTGILNMVSFS 7956
7955 YFSIDIVGMGSRMARELREVVDDIIVVVGKPNVSDFYPFLRPLDLQGLRRWTTKRFNRVF 7776
7775 SIMGDIIDRRLAHIRDNKPRHDDFLDSILELMAAGKIDRVNVLNMLFEAFVAGADTMALT 7596
7595 LEWVMAELLKNPGVMAKARAELRDVLGDKEIVEEADAARLPYLQAVLKEAMRLHPVGALL 7416
7415 LPHFAMEDGVEVGGYAVPKGSTVLFNAWAIMRDPAAWERPDEFVPERFVERTPQLDFRGK 7236
7235 DVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWELPGGMTAEELDVSEKFKTANVL 7056
7055 AVPLKAVPVLIK 7020

>aaaa01008405.1 (indica cultivar-group) top part of ortholog to BI813130.1
AAAA01075650.1 (indica cultivar-group) ortholog of BI813130.1 (4 diffs)
580 MEKLKSELWMTAVATCMSLLLYLTILRRRHASGGRSLSLPPGPTPLPLIGNLFCLGGIFH 401
400 QTLAKLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARPVPDAFRANGFSER 221
220 SIVFSPSSDPQWKNLRGIHATHIFSPRALAALRGIRARKVRDIVGYIRTVAGEEMCVREV 41
40  VHNGVLNLIST 8
ELLRNPRVMAKVRAEVMDALGGKESFDEGDAASLTYLQCVFKEAMRLHPVGSILVPHLAQ
QDGVEIGGYAVPKGTTVIFNAWAIMRDPAAWESPDQFLPERFLHKESSSPPLELRGKDYEYIPF 368
367 GSGRRLCPGLPLAERAVPFILASLLHAFEWRLPDGMSPDDMDMTEKFATANVLATPLKAV 188 (fs)
186 QSSHTSYIYSLRPKI* 139

>aaaa01008451.1a (indica cultivar-group) orth AC068924.9j 96%
248 PKEIRAEDVEVGGYLIPKGATVNFMVAEMGRDEKEWEKPTEFIPERFMAGDGDGEGVDVT 427
428 GSREIRMMPFGAGRRICAALSVAMLHLEYFVANMVKEFEWKEVAGDEVDFAERLEFTTI 604
605 MAKPLRV 625

>aaaa01008451.b  $PI ortholog of AC068924.9i $F 9 DIFFS IN FIRST 357 AA
1357, CTERM LOOKS LIKE AC068924.9j (96%, 5 diffs) probably a recombination 
product
8452 MATDTTWLLLLVALVLPLVVLLARRRRSGGSRRIPPGPLAVPVLGSLLWLRHSSANLEP 8628
8629 LLQRLIARYGPVVSLRVGSRLSIFVADRRVAHAALVERGAALADRPDVTRSLLGETGNTI 8808
8809 TRSSYGPVWRVLRRNLVAETLHPSRVRLFAPARSWVRRVLVDKLADGARPESEPPRPRVV 8988
8989 VETFRYAMFCLLVLMCFGERLDEATVRAIGAAQRDWLLYVARKTSVFAFYPAVTKHIFRR 9168
9169 RLQMGLALRRQQKELFVPLIDARRARKNHIQQSGSPPVPEKETTFEHSYVDTLLDISLPD 9348
9349 TDGDRALTDDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDTTT 9531 (FS)
9531 DEITEDDARNNLPYLKAVILEGLRKHPPMHLLLPHKAAEDVEVG 9662
9663 GYLIPKGATVNFMVAEMGRDEKEWEKPTEFIPERFMAGDGDGEGVDVTGSREIRMMPFGA 9842
9843 GRRICAALSVAMLHLEYFVANMVKEFEWKEVAGDEVDFAERLEFTTIMAKPLRS 10004

>aaaa01008685.1 (indica cultivar-group) orth of AC108875.1a $F chr 5 100%
7539 DGRATTEAEVAGLITGVLFAAKHTSTHTSVWTGARLLTHEKFLAAAVDEQDQIVRKHGII 7360
7359 NGRIVTDHYGFLMEMHMLHICIKETLRLHPPAPMIVRTALRQFTVRTREGHEYCVPAGHT 7180
7179 MASPIVISNRVPYIYKDAHLYDPDRFGPRREEDKVGGKFSYTSFGGGRNSCVGENYA 7009
7008 YMQIKAIWSHLLRNF 6964

>aaaa01008816.1 (indica cultivar-group) orth of AP003289 $F 100% 94C like
6374 GSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVATAIRDEVARVTGDGN 6204
6203 RTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDTLPDGTVVAKGTRVTYHAY 6024
6023 AMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQAGVRVCIGKELALMEMKAVIV 5844
5843 AVVRSFDIEAIARSSRRPKFAPGLTATFAGGLPVRVRRRR 5724

>aaaa01008885.1 $FI (indica cultivar-group) almost same as AAAA01011410.1
ortholog to AC118346.1 gene 1
6884 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSMRRRDGGSVRLPPSPWALPVIGHLHHLMGA 6705
6704 LPPHHAMRDIALRHGPLVRLRLGGLQVILASSVDAAREVMRTHDLAFATRPSTRVMQLVF 6525
6524 PEGSQ (0)
     GIVFTPYGDSWRNLR 6345
6344 KICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNLSELISAYSADSTMRALI 6165
6164 GSRFKDRDRFLMLLERGVKLFATPSLPDLYPSSRLAELISRRPRQMRRHRDEVYAFLDII 5985
5984 IKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG 5853
5758 DLFNGGSETTATTLKWIMAELVRNPRVMQKAQDEVRRALGKHHKVTEEALKNLSYLHL 5585
5584 VIKEGLRLHPPGLPLLLRESRTTSQVLGFDVPQGTMILVNMWAISRDPMYWDQAEEFIPE 5405
5404 RFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFDWELPDGTELGNL 5225
5224 DMKEEMGAIARRLHDLSLVPVIRHPLPVDM 5135

>aaaa01008944.1 (indica cultivar-group) orth AP003523.1c $F chr 6 98%
1338 DMFIGGSEPPAITLQWIMAELIRNPEVMQKVQDEVRQLLVGQHRVTEESLSKLGYMNL 1511
1512 VIKETLRLHPPGPRLLLRVCRTTCQVLGFDVPKGTMVLVNMWAINRDPKYWSQAEEFIPE 1691
1692 RFENAGINFKGTNFEYMPFGAGRRMCPGMAFSLVMLELALASLLYHFDWKLPDGVEIDM 1868
1869 KEQSGVTTRRVHDLMLVPII 1928

>aaaa01008990.1 (indica cultivar-group) orth AC099399.1 $F chr 3 100%
5202 PGPKGLPVVGSLGLMSGLAHCSLAAEAARRPGAKRLMALSLGPVRAVVTSHPDVAKEIL 5378
5379 DNPAFADRPLNHAAYGLMFHRSIGFAEHGPYWRALRRVAAGHLFGPRQVDAFAPYRAR 5552
5553 VAGGVVAALRGAGGEAAVQVRGVLRRASLYYIMRFVFGKEYDVSRGAPESGEEVE 5717
5718 ELLEMVHEGYDLLGKENWCDYFP 5786
6294 QEMIFRGTDAMAVLMEWTLARVVLHPDVQANVHRELDAVVGRSNTVAESAVPSLPYLQ 6467
6468 ALLKEALRMHPPGPLLSWRHRAISDTYVDGHLVPAGTTAMVNQWAMSRDADVWDAPLEFQ 6647
6648 PERFLPGGKAHGVSVLGADGRLVPFGSGRRSCPGKSLAMTTVTAWMATLLHEFEWTPA 6821
6822 SGAVDLSEVLRLSCEMAVPLEV 6887

>aaaa01009050.1a (indica cultivar-group) orth AC082644 $F 100%
3617 MTMVLLETLRLYPPVIFMFRKPITDMQLGRLHLPRGTAIVIPIPILHRDKEVWGDD 3793
3794 ADEFNPLRFANGVTRAAKIPHAHLGFSIGPRSCIGQNFAMLEAKLVMAMILQKFSFA 3964
3965 LSPKYVHAPADLITLQPKFGLPILLK 4042

>aaaa01009050.1b (indica cultivar-group) orth AC082644.10 $F chr 3 100%
9113 MSMVFLETLRLYGPALFLQRKPLTDITVGETKIPKDHAIIIPSAIMHRDKEIWG 9286
9287 DDTDEFNPLRFQNGVTRAAKVPHALLAFSIGPRSCIGQNFAMLEAKSVMAMILKKFS 9457
9458 FTLSPNYVHAPVDLLTLQPKFGLPVVLR 9541

>aaaa01009177.1a(indica cultivar-group) AP002968 $F 97%
309 LYLLLLALLVAVPFLCLTRSSRRHGCGGGSRLPPSPWALPVIGHLHHVAGALPHRAMRDL 488
489 ARRHGPLMLLRLCELRVVVASTAEAAREVTKTHDLAFATRPITPTGKVLMADSVGVVFAP 668
669 YGDGWRTLRRICTLELLSARRVRSFRAVREEEVGRLLRAVAAAAAAAAAALTTPGATAAV 848
849 NLSERISAYVADSAVRAVIGSR 914

>aaaa01009177.1b (indica cultivar-group) orth AP002968 $F 98%
1277 LYLLLLALLVAVPFLCLTRWSLRHGGGGGGRLPPSPWALPVIGHLHHVAGALPHRAMRDL 1456
1457 ARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAFATRPITPTGKVLMADSVGVVFAP 1636
1637 YGDGWRTLRRICTLELLSARRVRSFRAVREEEVGRLLRAVAAAAAVAALTTPGATAAVNL 1816
1817 SERISAYVADSAVRAVIGSRFKNRAAFLRMLERRMKLLPAQCLPDLFPSSRAAML 1981
1982 VSRMPRRMKRERQEMMDFIDDIFQEHHESRAAAGAEEDLLDVLLRIQSQDKTNP 2143
2144 ALTNDNIKTVIX 2176
2244 DMFVASSETAATSLQWTMSELMRNPRVMRKAQDEVRRALAVAGQDGVTEESLPDLPYL 2423
2424 HLLIKESLRLHPPVTMLLPRECREPCRVMGFDVPEGVMVLVNAWAIGRDPAHWDSPEEFA 2603
2604 PERFEGGGAADFKGTDFEYIPFGAGRRMCPGMAFGLANMELALAALLYHFDWELPGGMLP 2783
2784 GELDMTEALGLTTRRCSDLLLVPAL 2858

>aaaa01009208.1 (indica cultivar-group) orth of AP002093 $F 100% 710A like
10068 LIGRFVVFIRDSELSHRVFANVRPDAFHLIGHPFGKKLFGDHNLIYMFGEDH 10223
10224 KDLRRRIAPNFTPRALSTYAAIQQRVILSHLRRWLDRSAANGGKAEPIRVPCRDMNLETS 10403
10404 QTVFAGPYLTKEAREKFERDYNFFNVGLMALPVDLPGFAFRSARLGVARLVRTLGECARA 10583
10584 SKARMRAGGEPECLVDFWMQETVREIDEAKAAGKPPPAHTDDEELGGFLFDFLFAAQDAS 10763
10764 TSSLCWAVSALDSHPDVLAGVRAE 10835

>aaaa01009323.1 (indica cultivar-group) 55% to AP005448.1b $F
6368 DTEVTGLLVALLFAGHHTSSTVAVWTALRLLTHPEHLRAVRAEQERLVAAAEQQRSHHGG 6547
6548 GGGGGIDYGVLLQMDVLHRCIKEALRLHPVTPMILRRARRGFTVRDKEGGEYSVPAGRLL 6727
6771 YKDPHVFDPDRFAAGRAEDKAVAGARDLAYLSFGAGKHACMGEGYAYQQIKVILSHLVSN 6950
6951 FELK 6962

>aaaa01009404.1 (indica cultivar-group) orth of AP002484 $F 99% 
1365 AVDLQDVFMRLTFDLTAMFVFGVDPGCLADDFPTVPFGAAMDDAEEVLFYRHVAPVPWLR 1544
1545 LQSYLKIGHYKKMAKAREVLDASIAELIALRRERKAADANATGDADLLTAYLACQDEIGM 1724
1725 DGAAFDAFLRDTTLNLMVAGRDTTSSALTWFFWLLSNHPGVEARILAELRAHPPS 1889
1890 PTGAELKRLVYLHAALSESLRLYPPVPFEHKAAARPDTLPSGAAVGPTR 2036
2037 RVIVSLYSMGRMEAVWGKGCEEFRPERWLTPAGRFRHERSCKFAAFNVGPRTCLGRDLAF 2216
2217 AQMKAVVAAVVPRFRVAAAAAPPRPKLSIILHMRDGLKVKVHRRQE 2354

>aaaa01009485.1 (indica cultivar-group) ortholog of AC119289.1 AQ916317.1
101end
1444 GKLSFIWFGPVPRVMIPDPELVREVFNKFDQFGKPKMIRVGKLLATGVVSYEGEKWAKHR 1623
1624 RILNHAFHHEKIK 1662 (0?)
1906 RMLPVFANCCTEMVTRWENSISLEAASEIDVWPEFRNLTGDVISRTAFGSSYQEGRRIF 2082
2083 QLQEELAQYLTEALQKLFIPGYW 2151 (2?)
2765 YRYLPTKNNRRMREIDREVHKILLEIIGNKERAITNGENSNDNMLGLLVESNTKQPELGM 2944
2945 STDDIIEECKLFYFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLHHFGRTTTPDYDSL 3124
3125 SRLKI 3139 (0?)
3654 VTMILYEVLRLYPPVVLLNRRTFKETNLGGIKFPADMNLILPILFIHHDPEIWGKDASEF 3833
3834 NPGRFADGISNASKYHDASFFPFGWGLRICIGQSFALLEAKMALSMILQRFSLELSPSYI 4013
4014 HAPYIVLTLRPQHGAQIKLKRI* 4082

>aaaa01009673.1 (indica cultivar-group) orth AP003278 $P chromosome 1 96%
4799 LYEVLRLYPPFIEIGRKTYKEMEIGGVTYPAGVSIKIPVLFIHHDPDTWGSDVHEFKPE 4975
4976 RFSEGISKASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELAPSYTH 5146
5147 APHTMVTLHPMHGAQI 5194

>aaaa01009691.1 $PI (indica cultivar-group) ortholog of AQ856705.1
missing exon 1 50% to 714A1
6272 GPIFTYSMGNVVFLHVSRPDVVRDINLCVSLDLGKSSYLKATHEPLFGGGILKSNGEAWA 6093
6092 HQRKIIAREFFLDKVK 6045 (0)
     GMVDLMVDSAQTLLKSWEEGIDKNGGTIDIKIDDDIR 5260
5259 AYSADVISRTCFGSSYIKG 5203
     Deletion of 248 aa segment
5203 AELKTLISLIISKFVLKLSPNYEHSPTLKLIVEPEFGVDLSLTRVQGAYRH* 5048

>aaaa01009744.1 ortholog to AP005302.1d 100%
9058 QAMIEKFSSISTKKLPKALSVISRKNMVSISDYGDFYKMAKRNIMLAILGFNAQ
     FCDTRERMVSNVLSSLHKLVAVDPHSPLNF 8699
8698 REVYTTELFGLSLIQ 8654
8451 QNLGEDVCSVYVEEFGREISKEEIFHVLVHEILSCVVEPDWRDYFPYLSWLPNKSFETIV 8272
8271 SSTEFRRDAVMNALIKRQKERIARGE
     ARISYIDFLLEAKNSTQLTDHQLMLLLAESIAAAVDTVLVTTEWAMYELAK 7912
7911 NPDKQ
     EWLYREIREVCGGK 7732
7731 AVTEEDLPRLPYLDAVLHETLRLHSPVPVLPTRFVHDDTTLAGYDVPAGTQVMINVFGCH 7552
7551 MDEEAWESPGEWSPERFLGEGFKLADRYKTLAFGAGRRTCAGSQQAVSIACVAIARFVQE 7372
7371 LQWTLREGDGDKEDTMQYTALKLHPLHVHLKPRG 7270

>aaaa01009828.1 (indica cultivar-group) 58% to CYP711
470 GTWVWLAPGVLSRDEAQFRDAGEFRPERFDAGGEEERRRHAYAHVPFGLGPRACPGRR 646
647 FALQEVKLAMAHLYRRFVFRRSPRMESPPELQFGMVLSFRRGVKLTAVER 796

>aaaa01009869.1 (indica cultivar-group) orth AP004684.1b $F chr6 98%
2834 LPLVHYLITLFLHGSRDSDLRLPPGPWRLPLIGSLHHLFFGALPHRALRDLARRHGPLML 3013
3014 LAFGDAPVVVVASTAAAAREILRTHDDNFSSRPLSAVVKACTRRGAGITFAPYGEHWRQV 3193
3194 RKICRLELLSPRRILAFRAIREEEAARLVRAIGVASPPLVTNLSQLLGNYVTDTTVHIV 3370
3371 MGERFRERDALLRYVDEAVRLAGSLTMADLFPSSRLAHAMSSTTLRRAEAFVES 3532
3533 LMEFMDRVIREHLEKKRSCQGGEREEDLIDVLLRLQAEGSLHFELTMGIIRAVIF
     DLFSGGSETATTT 3886
3887 LQWAMAELMRNPGVMSRAQAEVREAYKDKMEVTEEGLTNLTYLQCIIKETLRLHTPGP 4060
4061 LALPRECQEQCRILGYDIPKGATVLVNVWAICTDTEFWDESEKFMPERFEGSTIEHKGNN 4240
4241 FEFIPFGAGRRICPGMQFGIANIELALANLLFHFDWTLPEGTIHSDLDMTETMGITARRK 4420
4421 EDL 4429

>aaaa01010028.1 (indica cultivar-group) orth? AC074105.1  $F chr 10 95%
3898 DARRPLPPGPRPLPVIGNLLDVAGELPHRSLSRVAQRYGPLVTLRLGTTLAVVASSPATA 4077
4078 REVLHRHGASITDRGTPDAWRTDGHETNSIFALPTRHHRWRALRRLGAEQLFSPRRVEKQ 4257
4258 RPLRRDAVRGLLRHVSELAAASGGGTGTAVVDVGRAAFAAMASLLFGSLFSVGIDAATSC 4437
4438 RFRDAAREFALLTLTPNVSEFFPVVAMADLQGLRRRTARHITWMYQLIDG 4587
4588 HVERRMRGRETAGAHGEKEKDLLDVMLDISEKQEQNDDSLTINRGVIR 4731
6586 DLLTAGSETSSAVIEWAMAELLQNPQTMRKLQEELKKVIGSKTYIDEEDIDQLPYLQ 6759
6760 AVIKETHRLHPAIPLLMYKAAVPVEIQGYKIPKETTVVVNTWAIHQNSEVWIEPDKFIP 6936
6937 ERFLQKEISLSSGSTNMELVPFSAGRRFCLGYPVANRMLHLMLGSLVHQFQWTLPEVVKK 7116
7117 NGGVDMAEKFGLTLSMATPLHAI 7185

>aaaa01010030.1a (indica cultivar-group) 
3362 LILSLAFVKLRPRNNGENPPPGPWQLPVIGSLHHLAGALPHRALRDLAARHGELMLLRLG 3541
3542 ELPVVVASSPAAAREVMRTHDAAFATRPQTATLRALTRDGLGVAFAPQGEHWRCLRKLCV 3721
3722 TELLGARRVRCLRRAREAEAAALVASLSTTTPEPVNVSSLVARYVTDAVVRAVVGDRI 3895
3896 SDRDAFLERLEEGVKVAAGFTLADVFPSSRLARALSGTARRAEAHSREMTRLMD 4057
4058 GVIEEHRQRRAATGWRDEEDEDLLDVLLRIQKDGGLQIPLDMGTIRAIIIVSSPT 4222
4308 DLFSAGSETTGTTLQWAMAELMRNPAALRKAQAEVRGVLAGHSHVTEDALPDLHYLHL 4481
4482 VIKETLRLHVAVPLLLPRECQEPRLRVLGYDVPERAMVLVNAWAICRDTAVWGPDAEEFR 4661
4662 PERFDGGAVDFKGTDFEFVPFGAGRRMCPGVAFAVAIMELGLASLLFHFDWELAGGAAAG 4841
4842 ELDMAEGLGITARRKSDLWL 4901

>aaaa01010030.1b (indica cultivar-group) orth AP003523.1b $F chr 6  99%
6579 QDMFAGGSESTSTTLEWALSELVRNPHVMQKAQAEIRHALQGRTRVTEDDLINLKYPK 6406
6405 NVIKETLRLHPVAPLLVPKECQESCKILGYDVPKGTIMFVNAWAIGRDPRYWNDAEVFMP 6226
6225 ERFEKVAVDFRGTNFEFIPFGAGRRMCPGITFANATIEMALTALLYHFDWHLPPGVTPDG 6046
6045 LDMEEEFGMSVSRKRDLYLRPTLH 5974

>aaaa01010030.1c (indica cultivar-group) AP003523.1a $F chr 6 100% 1 diff with 1a may be an accidental duplication in assembly
9521 LILSLAFVKLRPRNNGENPPPGPWQLPVIGSLHHLAGALPHRALRDLATRHGELMLLRLG 9700
9701 ELPVVVASSPAAAREVMRTHDAAFATRPQTATLRALTRDGLGVAFAPQGEHWRCLRKLCV 9880
9881 TELLGARRVRCLRRAREAEAAALVASLSTTTPEPVNVSSLVARYVTDAVVRAVVGDRI 10054
10055SDRDAFLERLEE 10090

>aaaa01010047.1a (indica cultivar-group) 
5663 HPEAMTKVRPEIDANVGAARLVEEPDMASLPYLQCVVKETLRLRPVGPVIPAHEAMEDCK 5484
5483 VGGYHVRRGTMILVNAWAIHRDGDVWGSPEEFRPERFMDDGAGAGAVTAVTAPMLPFGLG 5304
5303 RRRCPGEGLAVRLVGLTVAALVQCFDWEIGEGGAVDMAEGGGLTMPMATPLAAVCRPREF 5124
5123 VKTVVSDCF* 5094

>aaaa01010047.1d (indica cultivar-group) 
 (plus strand)
9533 DASLVVVVGVLFLMVAVVVMTRLGDGGAAPSPPAMPVLGHLHLIKKPLHRSLAEVAARVG 9712
9713 AAPVVSLRLGARRALLVSTHAAAEECFTACDAAVAGRPRLLAGDVLGYGHTTVVWASHGD 9892
9893 HWRALRRLLGVELFSN
     ARLAALAADRRAEVASLVDAVLRDAAAGGGGGGTVTLRPRLFELV 10075

>aaaa01010047.1c (indica cultivar-group) ortholog of BE039828
 (minus strand)
7897 ARLSALAADRRAEVASLVDAVLRDAAAGGGGGGTVTLRPRLFELVLNVMLRAVTARRHAG 7718
7717 DETRRFQEIVEETFAASGAPTVGDFFPALRWVDRLRGVVATLQSLQKRRDAFVAGLVDDH 7538
7537 RRTRRAAAAAADKDQKKNGIIDALLTLQETDPDHYTDNVVKGIVLVLLTAGTDTSALTTE 7358
7357 WAMAQLVAHPEAMTKVR 7307

these fragments are all pointing in opposite directions and they may be out of order.  One way to assemble an intact gene is to add 1d to 1c to 1a

This gives: 
>aaaa01010047.1dca hybrid (indica cultivar-group) ortholog of BE039828
46% to 81D3
9491 MVGLEVATTAVTGGDASLVVVVGVLFLMVAVVVMTRLG
     DGGAAPSPPAMPVLGHLHLIKKPLHRSLAEVAARVG 9712
9713 AAPVVSLRLGARRALLVSTHAAAEECFTACDAAVAGRPRLLAGDVLGYGHTTVVWASHGD 9892
9893 HWRALRRLLGVELFSN
7897 ARLSALAADRRAEVASLVDAVLRDAAAGGGGGGTVTLRPRLFELVLNVMLRAVTARRHAG 7718
7717 DETRRFQEIVEETFAASGAPTVGDFFPALRWVDRLRGVVATLQSLQKRRDAFVAGLVDDH 7538
7537 RRTRRAAAAAADKDQKKNGIIDALLTLQETDPDHYTDNVVKGIVLVLLTAGTDTSALTTE 7358
7357 WAMAQLVA 
5663 HPEAMTKVRPEIDANVGAARLVEEPDMASLPYLQCVVKETLRLRPVGPVIPAHEAMEDCK 5484
5483 VGGYHVRRGTMILVNAWAIHRDGDVWGSPEEFRPERFMDDGAGAGAVTAVTAPMLPFGLG 5304
5303 RRRCPGEGLAVRLVGLTVAALVQCFDWEIGEGGAVDMAEGGGLTMPMATPLAAVCRPREF 5124
5123 VKTVVSDCF* 5094

>aaaa01010107.1 (indica cultivar-group) 84% to AP003612.1 $F 
4738 LNETLRLYPPAVATVRRAKADVELGGYLRIPRDTELLIPIMAVHHDARLWGPDAAQFNPA 4917
4918 RFAGGVARAARHPAAFIPFGLGARMCIGQNLAILEAKLTVAVILHRF 5058

>aaaa01010113.1 $FI (indica cultivar-group) ortholog of C73729
AAAA01001707.1a PLUS STRAND CTERM 439507 MIGHT BELONG TO END OF AAAA01010113.1 34% to 88A3
6784 MSGATADWAWWLGLVAGAVPLLALAVWHCTDAFHSAAFAFRRRGTRAR
     LPPGHMGLPFVGETLALIWYFNLARRPDAFIEAKRRRYCYGDGDDDGGIYRTHLFGSPAV 1481
     LVCSPASNGFVFRSAPPGSFGVGWPVPELVGASSLVNVHGGRHARLRRFVLGAINRPG 1307
     SLRTIARVAQPRVAAALRSWAAKGTITAATEMKN (0) 6185
5443 VTFENICKIFVSMEPSPLTEKIHGWFTGLVAGFRSLPLDMPGTALHHARK (0) 5294
5218 CRRKLNSVFREELERRKVKMVTGEGGDDDDDGDLMSGLMHVEDEQGR
     RLD DDEVVDNIVSLVIAGYESTASAIMWATYHLAKSPSALAKLR 4946 (0)
2321 EENLAIAKEKNGDGFITLEDVSKMKYTAK 2235 (0)
2148 VVEETIRLANIAPMAHRVALRDVEYR 2071 (1)
1745 GYTIPKGWKVIVWIRSLHVDPAHYDNPLSFNPDRWD (0) 1638
9851 KSAELGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK (2) 9970
10088 WELLNPDAGIVYLPHPRPTDGAVMSFSEL* 10177

>aaaa01010169.1 (indica cultivar-group) 64% to AQ865256.1 56% to 714A1
8620 LVQLTMVIQETLRLYPPASFVAREALNDMKLGGIDIPKGTNIWIPIAMAHRDPSVWGPS 8444
8443 ADKFDPDRFANGIAGACKPPHMYMPFGVGVRTCAGQNLAMVELKVVLSLLLSKF 8282

>aaaa01010199.1 (indica cultivar-group) orth AP004013.1 $P chr 8, 95% 2 aa diffs
2821 RTSGLRLPPSPFGLPILGHLHLLTPLPHQALHRLAALHGPLLYLRLGSI 2967

>aaaa01010206.1 (indica cultivar-group) orth AC074232.2c $F chromosome 10 99%
5708 PVVGTVFHQLYNVRRIHDYHTALSREHTTFRMLVPAGGDQIYTCDPAVVEHI 5863
5864 LKTNFANYGK 5893
8202 GPFNHGNAKDLFGDGIFAIDGEKWKQQRKIASYDFSTRALR 8327
8918 DILSRFLQATTSDSGVDYKYLRDIILNIVIAGKDTTAGALAWFLYMVCKHPEVQEKICH 9094
9095 EAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTETLRLYPSVPM
     ENKQCFSDDVLPNGFNVSKGDIVFFIPYAMG 9445
9446 RMESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQ
     AGPRICLGKEFAYRQMKIFAAVLLRFFVLKLRDEKEIVGYRTTLTLAI 9793
9794 DQGLHL 9811

>aaaa01010273.1 $FI (indica cultivar-group) ortholog of AC113337.1
6315 MANLIYYSLLIILPFLFLIKFYKAMFSSRKQARRLPPCPWQLPIMGSIHHLIGDLPHRAL 6494
6495 RDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFATRPQSEIMKIITKRGQGLV 6674
6675 FAPYDDQWRQLRKICIRELLCAKRVQSFCAIREEEAARLVKSISSDQAHLVNLSKKLADY 6854
6855 ATDAAIRIITGTRFENQE VRDKFQYYQDEGVHLAASFCPANLCPSLQLGNTLSRTAHKA 7031
7032 EIYREGMFAFIGGIIDEHQERRAQDMSHKEDLIDVLLRIQQEGSLESPVSMETIKFLIF (0) 7208
7297 DILAGGSETVTTVLQWAMAELMRNPTVMSKVQDEVREVFKWKEMVSNDDINKLTYLQFVI 7476
7477 KETLRLHTPGPLFMRECQEQCQVMGYDMPKGTKFLLNLWSISRDPKYWDDPETFKPERF 7653
7654 EDDARDFKGNDF EFISFGAGRRMCPGMLFGLANIELALANLLFYFDWSLPDGVLPSELDM 7833
7834 TENFGVTVRKKEDLLLHASLYAQLSC* 7914

>aaaa01010283.1 (indica cultivar-group) orth AC074054.1a $F chr 10 97% 2 aa diffs
9319 SLLLVFIISYIFQPLLDARRRFPPGPHRLPVISNLHNIGKNPHHAFARLADRYG 9480
9481 PLMSIRLGGVRAVVATPADAAREILQL 9561

>aaaa01010398.1 (indica cultivar-group) not an exact match 71 like pseudogene fragment
2295 LMYLVLLPDVNRSNRPERWEDSDGWQRLPP*PRRLPLLRYLHLLSVPLHQAFHPLPR 2465
2466 HMAWCCYSSSNACRWWLSSFAATSRPKSAMAEQLLYGCDVAFAPYGEY* 2612
2613 S*ECRICVLFFRCIREEEVAVLVKHVRHPCR 2705

>aaaa01010435.1 (indica cultivar-group) orth of AC108875.1b $F 99% chr 5 similar to 51A2
1984 WGQHGTVDLRRELEQLLLLISGRCLLGKEVMGTMFDEVCNLFRDIEGGVNLMSVFFPYTP 2163
2164 LIPSNRRRDMARKRLHAIFSDIVRSRKQREGDNVDKDVLQSLIDSRYKADGRATTEA 2334
2335 *VAALMICLLFAAKHTSAYTSVWTGARLLSHERFLTAAVDEQDKIAREHSNINGGGRITD 2514
2515 DRYGSLMEMRTLHSCIKETLRLHPPVPMLVRTAHKQFTVRTREGHEYAVPAGHTIASP 2688
2689 IVISNQVPYIYMDGHLYDPDRFGPAGREEDKVGGKFSYASFGGGRTGCVGEGYAYMQIK 2865
2866 AIWSHLLRNF 2895

>aaaa01010464.1 (indica cultivar-group) orth of AL606640.1 $F chr 4, 1 diff
2581 AMESPLSHPAMVALSLLLLVALYLARRAVLGKKRRYPPVAGTMFHQLLNFGRLLEYHTEL 2402
2401 SRKYRTFRMLTPTCNYVYTVEPANVEHILKTNFANYGKGPMTHDVLEDLLG 2249
2248 DGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTAAELAGILERGPAAKGRERVD 2072
2071 MQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGLVFARAFDDASEQVLFRFFDLLWKVK 1898
1897 RFLNISSEATMKQSIRTINDFVYSIIDRKIEQMS
     EDILSRFLLEREKDPGCFDNKYIRDIILNFVIAGRDT 1538
1537 TAGTLSWFLYAVCKNQRVQDKIAREVRDATTGDRDVGVQDFSSFLTEDAINKMQYL 1370
1369 HAALTETLRLYP 1334
1184 DVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMKFLWGDDAEEFKPERWLDDSGMFVA 1011
1010 ESPFKFTAF 984
865 AGPRICLGKEFAYRQMKIVSAVLLYFFR 782

>aaaa01010763.1 (indica cultivar-group) orth AL607097.1 $F chr X 99% 39% to 93D
5238 VLVALLVTVVLAVMRSAGSRSSKRGRLPPSPMALPIIGHLHLIRPPPHRAFDRILARHGP 5417
5418 LVYLRLGPSTHCVVIGSADVARDFLKFEASIPERPPTAVTRQLAYGKAGFAFAPYGAYW 5594
5595 RFVKRLCMSELLGPRTVELLRPVRAAELAGVLRAAQSAAERGEGVDMSHELVRMANNSIM 5774
5775 RMVASALPGEMAEAARDCAKQVAELVGAFNAEDFVAVCRGWDLQGIGRRTNEVHARF 5945
5946 DALLETIIAAKEEARRRSLGLGRRESSSKDLLDMLMDAAEDDTAEVKLTRDNIKA 6110
6111 FV 6116
6241 DIFTAGSDTTATTVEWMLAELVNHPECMAKLRGELDAVVGRSRLVGEQDVARLPY 6414
6415 LQAVLKETLRLRPPAVFAQRVTVEPVQVRGYTIPTDTQVFFNIFSIGRDATYWDQPLHF 6591
6592 RPDRFLPGGAGATVDPKGQHPQLMPFGSGRRACPGMGLAMQAVPAFLAALVQCFDWAPPP 6771
6772 SQPLPLDMEEAAGLVSARKHPLLLLP 6849

>aaaa01010866.1 (indica cultivar-group) orth? AP004264.1 $F chromosome 7 96%
1355 VLSDRTGIYPKNLTNSHFVRLLGKGLVLTDGDEWKRHRKVVFPAFNMDKLKMMTMTMSDC 1176
1175 SRSMMSEWESELGAKGGLAEIELSRRFEELTADVISHTAFGSSYKEGKQVFLAQRELQFL 996
995  AFSTFLTVQILGY 951
865 SYLLTMKNFKTWSLDKKVRGMLMDIIKTRHANKDVVGYGNDLLGLLLEACAPEHGESHPQ 686
685 LSMDEIIDECKTFFFAGHDTTSHLLTWTMFLLSTHPDWQEKLREDIAMECGDEVPTGDML 506
505 NKLKMVNMFLLETLRLYSPVLLIRRKVGTDIELGGIKMPEGALLTIPIATIHRDKEVWGE 326
325 DADEFRLERFENGVTRAAKHPDALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRFSFTLS 146
145 PKYVHAPTDVITLRPKYGLPMILKSLKL 62

>aaaa01010885.1 $FI (indica cultivar-group) ortholog of AT003629.1
similar to 92A
 759 MAMSSWVATIVTLLIGVAVASLRGRQRRTKARLNLPPGPRGWPVFGSLGALAGALPP 929
 930 HRALAALAARHGPLMHLRLGSFDAVVASSAGAARLVLKTHDAAFADRARTAAGELVAYNY 1109
1110 KGIVHTPYGAYWRMARKLCATELFSPRRVDSYERIRAEEIGALARDLFGRAGRAVAVRER 1289
1290 LASATLRNILRMSVGDKWSGVYGSADGEAFRRTLDEAFEVSGAVSNVGEWVSLLGWL 1460
1461 DVQGFRRRMKRLSKMYDRFLEQILHEHEASMAAAGDGGQPAAAACDLVDVLLQLSGEEEE 1640
1641 GSAGAGADSEARLTRDGVKAFILDIIAGGTESSAVAMEWAMAELLRRPDAMAAATDELDR 1820
1821 VVGTARWVTERDIPDLPYVDAVVKEALRLHPVGPLLVPHHAMEDTVVAGGYVV 1979
1980 PAGARVLVNAWAIARDPASWPDRPDAFLPERFLPGGGAAAAGLDVRGQHYELLPFGSGRR 2159
2160 VCPATNLAMKMVALGVASLVQGFAWRLPDGVAAEDVSMEE 2279
     LVGLSTRRKVPLVAVAEPRLPAHLYAGTAA* 2372

>aaaa01010988.1 (indica cultivar-group) orth AC119149.2 $F chr 10 99%
8341 MQNLFVAGTDTTSTIVEWTMAELIRHPDILKQAQEELDVVVGRDRLLLESDLSHLTFF 8168
8167 HAIIKETFRLHPSTPLSLPRMASEECEIAGYRIPKGAELLVNVWGIARDPAIWPDPLEYK 7988
7987 PSRFLPGGTHTDVDVKGNDFGLIPFGAGRRICAGLSWGLRMVTMTAATLVHAFDWQLPAD 7808
7807 QTPDKLNMDEAFTLLLQRAEPLVVHPV 7727

>aaaa01011090.1 (indica cultivar-group) orth AP004704.1 $F chr 8 99%
9012 AMLLYAALFAAALLYLAVAVRRGRGAGLPPGPTGLPLVGSLLSLDPELHTYFAGLAARYG 8833
8832 PIFSIRLGSKLGVVVTSPALAREVLRDHDLVFSNRDTPDAACSISYGGGQNIVWNPVGPT 8653
8652 WRLLRRICVHEMIGPAGLDSLHGLRRREFMATLRHLRARSGEPVDVGAQMFLTVMNVV 8479
8478 TGALWGGNVGSESERTTVGKEFRELVADITELLGAPNVSDFFPA 8347
8044 DMVIGGTETTSNTVEWGMAEMLQNRGTLRKVREELDAVVGRDGVVEESHLPKLHYL 7871
7870 NLVVKETLRLHPALPLMVPHCPGEDATVGGHRVPAGARVFVNVWAIQRDPAVWKDPEHFI 7691
7690 PERFLPADGGGGRRLDFTGSEQEYMPFGSGRRICAGVAMAERMVAYSLAMLVQAFDWELP 7511
7510 AGERLDLAERFGIVMKKATPLVAVP 7436

>aaaa01011187.1 (indica cultivar-group) orth AC074282.1 $P chr 10 96%
5339 SWFFWLLLSQPDVMARIADVVRVVRKATGACPSELFGFDTLREMHYLHAVLMESMRLY 5166
5140 DDTLPDGTLVHAGWSVTYNAYAMGRLAAIWGEDCLEYKPEQ*LGEDG 5000

>aaaa01011192.1 $FI (indica cultivar-group) 38% to 86B2 
6837 MGGALLSFLLSYPEFILAAACFLAFAAIRRARDARRRAAPVPVSWPVVGMLPFVVAHLGRLLAA 7028
7029 AAAALPELGCTFMFRGPWLVGADFLVTCDPAVFRHCLVANFAGYDKGRDFAEMFDVVGDG 7208
7209 LLVADAASWAAKRHLAASVFTSAAFRGFVLSTVERQTRRLLVPFLDHAGGVVELEDV 7379
7380 FMRYSLDVSYTVAFAADLDSLSVASAAEPFPPFGEATRVTGEAVLLRHIAPAGWWKLMRW 7559
7560 LNVGVERRLADAKAVLDEFVYREIANRRSRPAPAVAGGDDLLCMYMASPIDPAM 7721
7722 SDQTLRDAAVGFMFAAKDLIAAALTWLFYMICTHPHVEAKILDELRSLHTTTTAGAVVFD 7901
7902 ADELRAATYLHAAVLETLRLYPSAPFEEKEAVGDDVLPGGTAVRKGTRVVFCLYAMGRVE 8081
8082 GIWGSDCREFRPERWLSTGDGDGGAGKVLQEPSYKFAAFNAGPRSCLGKDLGLSNIKIAA 8261
8262 AAIVYNFTVELVAGHVVEPKDSVVLHTKNGLMVRVKRRETA* 8387

>aaaa01011369.1 (indica cultivar-group) orth AL606625.1 $F chr 4 99%
8999 LWFGEVGTVFASSPEAAREVLRSHDLAFADRHLTAAAAAFSFGGRDVVLSPYGERWRQLR 8820
8819 KLLTQELLTASRVRSFRRVREEEVARLMRDLSAAATAGAAVNLSEMVTRMVNDTVLRCSV 8640
8639 GSRCEHSGEYLAALHAVVRLTSGLSVADLFPS 8544
5576 KSLFQDMFAGGTDTSSTTLIWAMAELIRSPRVMAKVQSEMRQIFDGKNTITEDDLVQL 5403
5402 SYLKMVIKETLRLHCPLPLLAPRKCRETCKIMGYDVPKGTSAFVNVWAICRDSKYWEDAE 5223
5222 EFKPERFENNDIEFKGSNFEFLPFGSGRRVCPGINLGLANMEFALANLLYHFDWKLPNRM 5043
5042 LHKDLDMREAPGLLVYKHTSLNVCPVTH 4959

>aaaa01011405.1 (indica cultivar-group) orth AC087544.2 $F chr 10 99%
2160 SPRVMAKVHDEVRQAFQGKNTITDDDVAKLSYLKMVTKESLRMHCPVPLLGPRRCRET 2333
2334 CKVMGYDVPKGTIVFVNAWAICRDSKYWKSAEEFKPERFENISIDYNGNNFEFLPFGSGR 2513
2514 KICPGITLG 2540

>aaaa01011410.1 $FI (indica cultivar-group) Ortholog to AC118346.1 gene 2
4935 MADQLVHLPQQLLVL 
     LLFIAPFFFFFLIRSIRRRDGGSVRLPPSPWALPVIGHLHHLMGALPPQHAMRNIALRH 5156
5157 GPLVRLRLGGLQVILASSVDAAREVMRRHDLAFATRPSTRVMQLVFPEGSQ (0) 5309
5428 GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNLSE 5607
5608 LISAYSADSTMRALIGSRFKDRDKFLMLLERGVKLFATPSLPDLYPSSRLAELISRRPR 5784
5785 QMRRHRDEVYEFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG (0) 5964
6058 DLFNGGSETTATTLKWIMAELIRNPRVMQKAQDEVRQVLGKHHKVTEEALR 6210
6211 NLSYLHLVIKEGLRLHPPGLPLLLRESRTTSQVLGFHVPQGTMILVNMWAISRDPMYWD 6387
6388 QAEEFIPERFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFNWELP 6567
6568 DETELGNLDMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 6684

>aaaa01011417.1 (indica cultivar-group) orth to AP002093 $F 100%
918  EAREKFERDYNFFNVGLMALPVDLPGFAFRSARLGVARLVRTLGECARASKARMRAGGEP 1097
1098 ECLVDFWMQETVREIDEAKAAGKPPPAHTDDEELGGFLFDFLFAAQDASTSSLCWAVSAL 1277
1278 DSHPDVLAGVRAEVASLWSPESGEPITAEKIAEMKYTQAVAREVVRHRPPATLVPHIA 1451
1452 GEEFQLTEWYTIPKGTIVFPSVYESSFQGFPEPDTFDPERFFSEARREDVVYKRNF 1619
1620 LAFGAGPHQCVGQRYALNHLVLFMALFVS 1706

>aaaa01011521.1a $PI (indica cultivar-group) 
1377 MADASDGYVYVG
1413 LAVVSLFVVLLAWRSRSPAAHGVGDGGLRLPPGPWTLPVIGSLHHLAGQLPHRAMRDLAR 1592
1593 RHGPLMLLRIGEVPTLVVSSRDAAREVMKTHDMAFATRPLSATLRVITCDGRDLVFAPY 1769
1770 GDYWRQVRKIAVTELLTVRRVSSFRSIREEEVAAVLRAVAAAAAVEEATPAMATVEMRAA 1949
1950 LSALVTDITARTAFGNRCKDREEYLVLLERIVEIAGGFNPADLWPSSRLAGRLKRCRAPR 2129
2130 RGVPQLGVILDGIIQEERTGAGSEDLVDVLLRIQKEGELQFPLAMDD 2270
2271 IKSIDIFNAGIETSGTTLQWAMAELIRNPTVM 2450
2451 HKATAEVRHAFAAAGDVSEDALGELRYLQL 2540 (deletion of about 104 aa)
2539 FDWEVPGMADLTKLDMTEAFGITARRKENLHLRPLLRVSVPAASS 2673
2674 RLRWTTTAFSICCHDTHLV*

>aaaa01011521.1b $FI (indica cultivar-group) 
6071 MADTSHGYVYIGLALVSLFVVLLDRRRRSPPPPAAH
6179 GDGGLRLPPGPWTLPIIGSLHHLVGKLPHHAMRDLARRHGPVMLLRIGQVPTLVVSSRDA 6358
6359 AREMMKTHDMAFATRPLSATLHVITCDGRDLVFAPYGDYWRQLRKIAVTELLTARRVNS 6535
6536 YRAIREEEVAAMLRAVAAAAEGSGAAAGTVEMRAALTALSTDITARAVFGNRCKDREEYL 6715
6716 AQVDHTIELTAGFNPADLWPSSRLAGRLSGIVRRAEECRDTAFKILDRIIQERLE 6880
6881 MARSDGAAGEYLIDVLLRIQKEGGLQFPLAMDDIKANIF (0) 6994
7066 DIFGAGSETSGTALAWAMAELIRNPTVMRKATAEVRRAFAAAGAVSEDGLGELPYLHLVI 7245
7246 RETFRLHPPLPLLLPRECREPCRLLGYDVPRGTQVLVNAWALGRDERYWPGGSPEEFRPE 7425
7426 RFEDGEATAAVNFRGADFEFLPFGGGRRMCPGIAFALATVELPLASLLFHFDWEVPGMAD 7605
7606 PTKLDMTEAFGITARRKADLHLRPLLRVSVPGV* 7707

>aaaa01011555.1 (indica cultivar-group) orth AC109595.1 $F chr 5 >99%
8324 NARRRLAPAPRGLPVIGNLHQVGALPHRALRALAAATGAPHLLRLRLGHVTALVASSPAA 8145
8144 AAAVMREHDHVFATRPYFRTAEILTYGFKDLVFAPYGEHWRHARRLCSEHVLSAARSH 7971
7970 RY 7965
7950 QEVALLVNAIRTEAAAAAVDVSKALYAFTNAVICRAVSGRLSREDEGRSELFRELIEE 7777
7776 NATLLGGFCVGDYFPALAWADAFLSGFAARACRNLRRWDELLEEVIAEHEARLRGGDDG 7600
7599 GGEEHREEDFVDVLLALQEESQRHDGSFKLTRDIIKSLLQDMFAAGTDTSFITLEWAMSE 7420
7419 LVKNPAAMRKLQDEVRRGGGATTAATPYLKAVVKETLRLHPPVPLLVPREC 7267
7266 ARDTDDDATVLGYHVAGGTRVFVNAWAIHRDAGAWSSPEEFRPERFLPGGGEAEAVDLRG 7087
7086 GHFQLVPFGAGRRVCPGMQFALATVELALASLVRLFDWEIPPPGELDMSDDPGFTVRRR 6910
6909 IPLRLV 6892

>aaaa01011592.1a (indica cultivar-group) 85% to AL607001.1 chr 4, gene 3
6830 VWAVAMAMVVASVMWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNTTCDISPFV 7000
7001 KERLN 7018
7111 RYGSIFKTSVVGRPVVVTADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMY 7290
7291 KYLKSLVLRLYGQENLRAVLLDETDRACRASLASWAAQPSVELKDSISAV 7440
7554 ILTEGIALDLMFVLLFASFETTSLALTLGVRLLAENPTVLDALT 7685

>aaaa01011592.1b (indica cultivar-group) 82% to AL607001.1 chr 4, gene 3
8837 YGSIFKTSVVGRPVVVTADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMYK 8658
8657 YLKSLVLRLYGQENLRAVLLDETDRACRASLASWAAQPSVELKDSISA 8511
8400 MIFDLTAKKLISYEPSKSSENLRKNFVAFIRGLISFPVDIPGTAYHECMK 8251
7781 EEHEAIVRGRKEGCDAAGLTWAEYKSMTFTSQ 7876

>aaaa01011593.1 (indica cultivar-group) orth AP003522.1 $F chr 6 100%
2115 IDQDLYGAGASTTAALIEWGMVDLIQNPEVMTKVREELTNVLGDKLVMDESDIARLPY 2288
2289 LQAVVKETLRLRTVVPLVPRKAEVDIEVNGYRIPKGTNVILNAWAINRSADAWSEPDKF 2465
2466 IPERFLGGETRGYLGQDFEMIPFGLGRRICPGMPLAQKLIPLIIGTLLHRFEWELPADAK 2645
2646 EGGIDMTEKCGVVLSLVNPLKAIP 2717

>aaaa01011645.1 $FI (indica cultivar-group) one frameshift no introns (partialI)
runs off end 66% to AP005254.1a continues on AAAA01039014.1
1329 MEARELWVLAAALAVSLLYYLTVLMRYAGGGSSRSSRPRLPPGPTPLPLIGNLLSLR 1159
1158 GVLHHRLASLARVHGPVMALRLGLTTAVVVSSRDAAAEAFTKHDRRLAARVVPDSNRA 985
984  HGFSDRSVIWLPSSDPRWKTLRGIQATHLFSPRGLAAVRAVRESKVRDIVAYFRSRAGEE 805
804  VVFGEAIYSGVLNLVSSSFFSVNMAGVGSEEAHGLRELVEDLVEAVAKPNVSDLFPFLR 628
627  QLDLQGLRRRTEERMARAFGILDGIIDRRLANRTHGDRHGDFLDALLDLVSEG 469
468  KMARDHVTIMLFEVFGAGSDTMSISLEWAMAELLRNPRAMRKARAELEDAAAV 310
309  VEESDAARLPYLQAVVKEAMRLHPVGPILLPHRAVEDGVEIGGYAVPRGAMVI 151 (fs)
149  FNAWAIMRDPAAWERPDEFVPERFMETTTAIDFRGKEYEYLPFGSGR 3
RLCPGLPLAERVVPFVLASLLRAFEWRLPDGVSAEDLDVSERFNTANVLAVPLKVVPVIVN*

>aaaa01011852.1 $FI (indica cultivar-group) 58% to AC092559.2 46% to 71B23
8074 MAISLITSLLFSLPQQWQP
8017 VVLTGLLPVIVSLVLLARKGRLKMPPGPEQVPLLGNLHQLAGPQPHRALRDLARVHGPV 7841
7840 MRLRLGKASAVVLTSAEAAWEALRGHDLDCCTRPVSAGTRRVTYGMKNVAFAPYGAYWR 7664
7663 EVRKLLMVELLSARRVKAAWYARHEQ (0) 7586
     VEKLLSTLRRAEGKPVALDEHILSLSDGIIGRVAFGNIYGSDKFSQNK
     NFQHALDDVMEMLSGEGSSAEDLQLPAAVGRLVDRLTGFAARRERIFRQLDSF
     FEMVIEQHLDPNRAPPENGGDLVDVLIDHWKKNEPRGTFSFTKDNVKAIIF (0)
6324 STFVAGIDTNAATILWAMSELARKPRVLKKVQAEIRAAVGVNGRVQPDDITKLSYLRK 6151
6150 VVKETLRLHPPTPLLLPRETMRHIQISGYDVPAKTRIYVNAWAIGRDPASWPDEPEEFNP 5971
5970 ERFEANEIDFKGEHPELMPFGTGRRICPGMAMAMANVEFTLANLLFAFQWSLPEGTTPDN 5791
5790 VCMEEEGRLVCHRKTPLVLVPTVYRHGLE* 5701

>aaaa01011899.1 (indica cultivar-group) orth AP003711.1 $F chr 6 >99%
5137 LLLFVAGLIVLYALRRRRRHRRSSDLRLPPSPFGLPILGHLHLLAPLPHQALHRLAARHG 4958
4957 PLLFLRLGSVPCVAACSPDAAREVLKTHEAAFLDRPKPAAVHRLTYGGQDFSFSAYGPYW 4778
4777 RFMKRACVHELLAGRTLDRLRHVRREEVARLVGSLRASADGGERVDVDAALMGLTGDIVS 4598
4597 RMVMGRRWTGDDNDAEEMRSVVAETAELTGTFNLQDYIGVFKYWDVQGLGKRIDAVH 4427
4426 RKFDAMMERILTAREAKRKLRRQAAADGEDDEKDLLDMLFDMHEDEAAEMRLTRDNIKAF 4247
4246 MLDIFAAGTDTTTITLEWALSELINNPPVLRKLQA 4067
4066 ELDAVVGGARLADESDIPSLPYLQAVAKETLRLHPTGPLVVRRSLERATVAGYDVPA 3896
3895 GATVFVNVWAIGRDAAWWPEPTAFRPERFVSGGGGGGTAADVRGQHFHLLPFGSGRRICP 3716
3715 GASLAMLVVQAALAAMVQCFEWSPVGGAPVDMEEGPGLTLPRKRPLVCTVSPRIH 3551

>aaaa01011965.1 (indica cultivar-group) 94CLIKE ORTHOLOG OF AU056498
RUNS OFF END
526 MEMELPWGARCAGLAFFAFSVCLAALGVVLLVARRWPWCSCHVCRAYLTGSWAREFTNLG 347
346 DWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRTRFDNFPKGRPFAALLGDLLGDGI 167
166 FNVDGHAWRHQRK 128
127 MASLELGSVAVRSYAYKIIAQEVEARLMPVLADAADRGAVLD

>aaaa01011971.1 (indica cultivar-group) orth AL606614.1a $F chr 4 96%
987  DMFIAGSDTSAVTVQWAMTELVRNPDVLAR 1085
     AQHEVRRVVAAAGGGDKDGAMVREADLPELHYLRLVIKETLRLHPASPLVQR 1240
1241 ETTEPFRTAHGVEIPARTRVVINAMAIHTDPGVWGPDAERFVPERHRAHDADGGQQHDGF 1420
1421 ALVPFGIGRRSC 1456
1450 ELLLANLLFCFDWSAPPGREVDVEEENGLAVRKKNPLVLI 1569

>aaaa01012078.1 (indica cultivar-group) 91% AP004139.1 $F
4312 PFWHAVFRDLLGDNIFNSDGETWVAQWKMAALEFTTTATAAAAAGVDRTL 4163

>aaaa01012191.1 (indica cultivar-group) orth AP004000.1a $F chr 2 98%
762 KPRLPPGPWRLPVIGNLHQIMVGGPLVHRTMADLARRLDAPLMSLRLGELRVVVLYYRFI 583
582 *IPALSPFYLATRPWSSTIRVLMSDGVGLVFAPYGALWRQLRKIAVVELLSARRVQSF 409
408 RRIREDEVGRLVAAVAAAAAASAAQPVNVSERIAALISDSAVRTIIGDRFERRDEF 241
240 LEGLAEGIKITSGFSLGDLFPS 175
411 TARRKADLHLRPCL 370

>aaaa01012243.1 $FI Indica rice genome CYP51 New April 24, 2002
5108 MTLADPNHRLIAGAALLVATLAFIKLLLSSAGGGKKRLPPTIPAAPLVGGLLRFMRGPIPM 4926
4925 IREEYARLGSVFTVPILSRKITFLIGPEVSAHFFKGNEAEMSQQEVYKFNVPTFGPGVVF 4746
4745 DVDYSVRQEQFRFFTEALRANKLRSYVDQMVVEAE 4641
2774 EYFSKWGESGTVDLKYELEHLIILTASRCLLGREVREKLFDDVSALFHDLDNGMQPVSV 2598
2597 IFPYLPIPAHRRRDRARQRLKEIFATIIKSRKASGQAEEDMLQCFIDSKYKSGRSTTEGE 2418
2417 ITGLLIAALFAGQHTSSITSTWTGAYMLRFKQYFAAAEEEQKEVMKRHGDKIDHDILAEMDVLYR 2223
2222 CIKEALRLHPPLIMLLRQSHNDFSVTTKDGKEFDIPKGHIVATSPAFANRLPHIFKNPDS 2043
2042 YDPDRYAPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPF 1863
1862 PETNWKAMVVGIKDEVMVNFKRRKLVVDN* 1773

>aaaa01012291.1 (indica cultivar-group) orth AP003571.1d $F chr 6 99%
6215 DAGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLARRHGPVMMLRLGEVPTLVVSSRDAA 6394
6395 REVMRTHDAAFASRPLSASVRAATKGGRDIAFAPYGDYWRQLRKIAVTELLSARRVLSFR 6574
6575 PIREEEVGRSPATLQPGQHAASGRTVELRAALCALVADSTVRAVVGERCAGLDVF 6739
6740 LRQLDRAIELAAGLNVADLWPSSRLAGRPSQRRRAPGREVRDTMFGVLDGII 6895
6896 QAHLEKTGGAGEDILDVLLRIHKEGGLEFPLDMDAVKCV
     DVISGGCETSATTLGWAFAELIRNPAAMK 7249
7250 KATAEVRRDFEAAGAVSESALSVGELPYLRLVVRETLRLHPPLPLLLPRECREPCRVLGY 7429
7430 DVPRGAQVLVNAWAIGRDERYWPGGSPEEFRPERFGDGEAAAAVDFKGADFELLPFGGGR 7609
7610 RMCPGMAFGLANVELPLASLLFHFDWEASGVADPTEFDMTEAFGITARRKANLLLRPIL 7786

>aaaa01012342.1 (indica cultivar-group) orth AP003232.1b $F chromosome 1 100%
6096 ESLRDVVTNFILAGRDTTSSALTWFFWLLSGRPDVEDKIVREIRAVRQSSAGSEGTR 6266
6267 GATFSLDELRDMQYLHAAITESMRLYPPVPFDTHSCKEEEFLPDGTFAGKGWLVTYCAYA 6446
6447 MGRVEDIWGADCEEFRPERWLDEAGAFRPESTFKYPVFHAGPRMCLGKEMAYIQMKSIVA 6626
6627 CVLEQFSLRYAGDAK 6671

>aaaa01012419.1 $FI (indica cultivar-group) one frameshift
2885 MLATVVFVFLLQAVLLRRRGAYKLPPGPKPWPIIGNLNLIGALPHRSIHEISK 3043
3044 RHGPIVQLWFGSCPVVVGSSVEMAKLFLKTNDAVFADRPRTAAGKYTAYDCADIVWSPY 3220
3221 CAYWRQARKMCIAELFSARRLESLEHIRHEEVRALLRDLNSAGVAGNAVQLGDHLS 3388
3389 MVTLGVISRMVLGKKYVEKQPAGAETASSPPTTPEEFKWMMDELFLMSGVLNIGDFIP 3562
3563 WLDWLDLQGYVRRMKKVNRLMHRFLDRVLDEHDERRRLQGDGFVARDMVDVLL 3721
3722 QLADDPNLDVQLTRNGVKGITQ (0) 3775
     NLVTGGADTS (fs)
5132 VTVEWAMSEVLKNPAILAKATKELDNVVGSGRLVTESDIPHLPYVDAIMKETMRMHPVAPLL 5317
5318 IP 5323
5323 RMSREDATVAGYDVPAGTRVLVNTWTINRDPSLWDSPEEFRPERFVGSGIDVKGRDFELL 5502
5503 PFGTGRRMCPGYSLGLKVIQLTLANLLHAFSWNLPDGIAAGELSMEEIFGLTMPRKIPLL 5682
5683 AVVKPRLRDHLYAEP* 5730

>aaaa01012480.1 (indica cultivar-group) orth CYP72A20 $F AP002839 98% chr 1
4577 DTNNLLQVTMILHEVLRLYPPAVTLSRRTFKEIQIGGITYPAGVGLELPIILIHH 4413
4412 NTDVWGKDAHEFKPERFADGISKATKTNQRAFFPFGWGPRICIGQNFAMLEAKMVLCV 4239
4238 ILQNFEFQLSPSYTHAPYASVTLHPQHGAQIIL 4140

>aaaa01012486.1 (indica cultivar-group) 75% to D48181
2772 RLPPGSRGLPLLGESLEFFARSPSLELLPFLKQRLE 2882
5045 RYGPIFRTNIIAQDMIVSLDPELNNLVFQQEERLFQCWYPNSFMRVFGADSIITTFGSSH 5224
5225 RHVRNLVLRLFGPENLRRAMLQEMQKTAQASLLSWLDRPSIEVKEEVSS
     MIIFSIIAKKLISYDSSASNG 5584
5585 KLWKQFDAFLQGLLA 5629
5737 MQGRKNVMRMLRELLDERKKKTAHQLESIDFFDALIDELKQEKPAVSENVALDLLFLLLF 5916
5917 ASFETTSSGITAILRFLTDNPMALEELT 6000
6226 EEHDRILKRKADPNSQITWEEYKSMKFT 6315
7158 YTIPKGSKIMLSPSNIHLNPTVYKDPNEFNPWRWK 7262

>aaaa01012488.1 $FI (indica cultivar-group) 47% to CYP78A5
5682 MRNEVLSTIFLLLIFFTTTINPSSSQLPWLFSLLYLSLAMAVVALPPLLAKRHGHARRVN 5503
5502 GGGAAIPGPRGWPLLGSLPAVSGPLMHRRLAALAYAHGGGARR LMSLTLGATPVVVSSHP 5323
5322 DTAREILAGAAFRDRPARAAARE LMFLRAVGFAPAAGDDGGAYWRRLRRAAGAGMLS PRR 5143
5142 AAALAALRARVARRTSEAVSRGMAVPPGRVAMRALLHAASLDNMVGSVLGLEHHDHHGGV 4963
4962 ISDMGDMVREGYELVGKFNLGDYYSTTQYQCLWGLLDFHGVGPRCQRLAARVREQFGRVM 4783
4782 EERRKVSDLHKRDDLLSYMLSMPQEERIEDSDVIAVLW (0) 4669
3107 EMIFRGTDVVAILLEWAMARMVLHPDIQSKVQEELDRAVGHRPMTDSDIPSLRFLHCVIK 2928
2927 ETLRMHPPGPLLSWARLAVHDTYVGKHLVPAGTTAMVNMWAISHDETIWGDPWVFRPERF 2748
2747 MEEDINVLGSDLRLAPFGSGRRVCPGRMMGLSTSYLWFGRMLQEYKWSPAQPVKLTECLR 2568
2567 LSMEMKKPLVCHAVPRSKTG* 2505

>aaaa01012542.1 (indica cultivar-group) orth AP004183.1 $P chr 8 99%
5820 WLLGSLLSVYLLDLLAHSRRRLPPGPRPLPFIGSLHLLGDQPHRSLAALAMAYGPLMSLR 5641
5640 LGAVTTVVASSPAVARELLHRHDAAFASRSSPDSTGDHARSSVAWLPSSAPRWRALRR 5467
5466 IMATELFAPHRLDAAAPRRLRREKVRELVAHVARLAAGEGGKPAVVDVGRVAFATSLNLL 5287
5286 SRTIFSRDLTSLDDHGGSKGFQEAVARIMEAGGRPIVSDFFPVLAAADLQGWRRRLA 5116
5115 RLFARLHRVFDAEVDARLREHDAGEASKGDFLDVLLGIAARRDDAAELDRDTLRSLF 4945
4944 TVIQL 4930
991 DVTEKLEVEKN*TQQLSQVIGLGPNIKESEIGQLPYLQAVVKETFRLHPPAPLLLPRQ 818
817 AEMTMKIAGYTIPKGTRIFINVWAMGRDKDIWPEPEKFIPERFLGSKIDFKGVHFELIPF 638
637 GAGRRICPGMPLANRMVHLILGSLLNQFKWNLPVEVERNGIDMSEKFGLTLAKATPL 467

>aaaa01012551.1 $PI (indica cultivar-group) 87% to AAAA01012419
sequence gap at 4311 no P450 related seq seen in 5815 bp ustream
5816 FMGSGIDVKGWDFELLPFGSGRQMCPGYSLGLKVIQLTLANLLHAFSWSLPDGVAAGELS 5995
5996 MEEIFGLTTPRKIPLLPIVKTRLPDNLYAEP 6088
     YDAPCVACMHGCAFVGV* 6142

>aaaa01012578.1 (indica cultivar-group) orth AP003571.1a $F chr 6 99%
5308 LVALLGVLLTKRSRTATAQRRLPPGPWQLPVIGSLHHLIGKLPHHAMRDLTRRHGPVMML 5487
5488 RLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAGTMGGRDIAFAPYGDYWRQLRK 5667
5668 IAATELLSAPRVASFRAIREEEVAATLRTVAAAAADGRAVELRAALCALVTDSTSRAVVG 5847
5848 DRCKESDALIRAFDRSMELASGFNPADLWPSSRLAGLLSGGVREIEANLHTVFGIL 6015
6016 DRLIEKRLQQKKTAPSSAAGEDILDALLRIHKEGGGLQFPLDMDSIKLII 6165

>aaaa01012657.1 (indica cultivar-group) orth AP003990.1g $P chr 2 99%
7170 FTPLFLLAVLPLKLTNGGDGV*LPPGPWRLPVIGSMHHLMGESLVHRAMADLARRLDAPL 7349
7350 MYLKLGEVPVVLASSPCAAREIMRVHDVAFASRP 7451
7490 RQLRKICVVELLSARRVRTFRRVREEE 7570
6081 DLFSGGSETSATVIQWAMSELMKNPRVMRKVQAELRDKLAGKPRVTEDDLSDLKYLKL 5908
5907 VIKETLRLHPAAPLLVPRQCREPCKIMGYDIPKGTTVFVNAW 5782
5782 AIGRDPNYWDDAEVFRLERFANSTIDFKGMDMEFIPFGAGRRMCPGLAFAEAIMDLLFST 5603
5602 LLFHFDWELPCGMTASELDMIEEMALTVRRKNDLHLRPIL 5483

>aaaa01012662.1 (indica cultivar-group) orth 96% to AP003850.1 $F chr 7, gene 6
8019 FALLLALLVPTLLHFVIRCKYSSYNLPPGSLGFPLIGQSISLLRALRSNTDYQWYQ 7852
7851 DRIKKYGPVFKMSLFGSPTVLMAGPAANHFVFSNQDLIFTQTKAINTILGRSILTLS 7681
7680 GEELKQVRSALQGYLRLEMVTKYMCKMDEEVRRHIDLNWVGHKTVK
     AAPLAKRLTFDIICSVVFGQGIGPIREALATDFETLVQA 7321
7320 LLSLPVNMPFTKFNKGLRASRRIRKVLRQIAREREAALQQGHSSSADDFFTYMLVLRSE 7144
7143 GTHSLTVEDIVDNAIVILTAGYGTTAVLITFLLRYLANDPDILGKITE 6982
6907 EQEEIARREGPNEPLTWNDVSRMKYTWKVALETLRTVPPIFGSFRTAVKDIEYHGYH 6731
6730 IPKGWQVSIF
6550 SITHLDGNFFNDPVKFDPTRFDNQTSLPPYCFVPFGGGPRMCPGNEFARTETLVTMH 6374
6373 YLVRQFRWK 6347

>aaaa01012807.1 (indica cultivar-group) orth AP003232.1a $F chr 1 98%
5684 RADGLKAYPIVGILPHFVRNQHRLLEWSAGVVAGCPTHTMSFNFKGFGLIAGA 5526
5525 ITGNPANVEHIVKTNFQNYSKGEYVVSVMEDFLGHGIFNSDGDQWLWQRKAASYEFNKRS 5346
5345 LRNFVVDTVRSEVVDRLLPLLTRAERDGRTLDVQDVLERFAFDNVCCVAFDEDPACLTEE 5166
5165 GMGTNARTEFLRAFNDAQNILMARFMSPVEWAWRAKRLLDLEPERRMREALATIHGYADR 4986
4985 IVRERRERGAAGLARKDDFLSRF 4917
4866 ALTWFFWLVSGQPD 4822
4786 VEDRIAREIRAVRASSGSTDAAAFSFDELREMHYLHAAITEAMRLYPPVAMDSH 4622
4621 CCQNDDVLPDGTFVGKGWQVTYSAYAMARLEELWGADCEEFRPERWLDEDGVFRPESP 4448
4447 FKYPVFHGGPRMCLGKEMAYIQMKSIAACVFERFSFRFVGGEGRPGLVFSVTLRMEGGLP 4268
4267 MRVKKR 4250

>aaaa01012955.1 $FI (indica cultivar-group) orth of AP005099.1 $F chr 7, 99%
4863 MVVVVTAAMAAASLCCGVAAYLYYVLWLAPERLRAHLRRQGIGGPTPSFPYGNLADMRSH 4684
4683 AAAAAGGKATGEGRQEGDIVHDYRQAVFPFYENWRKQY 4570 (1)
2232 GPVFTYSVGNMVFLHVSRPDIVRELSLCVSLDLGKSSYMKATHQPLFGEGILKSNGNAWA 2053
2052 HQRKLIAPEFFPDKVK 2005 (0)
1852 GMVDLMVDSAQVLVSSWEDRIDRSGGNALDLMI 1754
     DDDIRAYSADVISRTCFGSSYVKGKQIFDMIRELQKTVSTKKQNLLAEMTGL 1474
1473 SFLFPKAIGRTAWRLNGRVRALILDLVGENGEEDGANLLSAMLRSTRGGGGGG 1315
1300 AAAEDFVVDNCKNIYFAGYESTAVTAAWCLMLLALHPEWQDRVRDEVQAACCGGGGRSPD 1121
1120 FPALQKMKN 1094 (0)
1016 LTMVIQETLRLYPAGAVVSRQALRELSLGGVRVPRGVNIYVPVSTLHLDAELWGGGAGAA 837
836  EFDPARFADARPPLHAYLPFGAGARTCLGQTFAMAELKVLLSLVLCRFEVALSPEYVHSP 657
656  AHKLIVEAEHGVRLVLKKVRSKCDWAGFD* 567

>aaaa01012971.1a (indica cultivar-group) orth AP003523.1d $F chr 6 99%
4777 GSETTATTLQWIMAKLMRNPRVMQKAQDEVQRVFIGQHKVTEENLSNLSYMYLVIKE 4607
4606 ALRLHPPGPPLLPRECRTTCQVLGFDVPKGTIVLVNMWAINRDPKYWDQSEEFILERFEH 4427
4426 VDINFKGMNFEYMPFGAGRRMCPGMAFGLVNLELVLASLLYHFDWKLSDKIKVGDLDMTE 4247
4246 ERGATTRRLHDLLLVPVI 4193

>aaaa01012971.1b (indica cultivar-group) orth AP003523.1c $F chr 6 99%
7052 LLRYLFSVPMLFFIVPLLFLVCSPGRRRGRGSCRLPPSPWALPVVGHLHHLAGALQHRAM 7231
7232 RDIARRHGPLVLLRLGRLPVVVASSADAAREVMRTSDVAFAARPVNRMIRVVFPEGSEGV 7411
7412 IFAPYGETWRQLRKICTAELLSARRVHSFRSVREEEAGRMLRAVASAAAQTTVNLSELM 7588
7589 SAYAADSSARAMIGRRLKDRDTFLAMVERGIKLFGEQSLPNLYPSSRLAVLLSTMP 7756
7757 RRMKRHRERMTAYLDAIIEEHQESRASREDDEDLLDVLL 7873

>aaaa01012992.1 (indica cultivar-group) 80% to AAAA01002645.1b
runs off end of clone (partialI)
175 DIFGAGSDTSSNIIQWAMSELMRNPKVMQKAQVELRNTLQGKHPVKEDDLVNIKYLKL 348
349 IIKETLRLHPMVPLLLPRECLHACKVMGYDVPKGTTVFVNIWAINRDPKHWDDPEVFKPE 528
529 RFDDGKIDFKGANFEYIPFGAGRRSCPGVTFGHATVELMLATLLYHFKWELLEGVAPNEL 708
709 DMT 717 (fs)
717 EEIGINVGRKNPLWLCPIVRVPLQ* 791

>aaaa01013115.1 (indica cultivar-group) 57% to AP002093 $F
6281 SRGRVSRRSPPNMLVCMLDECTRASKAHTEDEELGGFLFVTQDMSISSLC 6132
6131 WPMSALYSYPDMLTRV 6084

>aaaa01013363.1 $FI (indica cultivar-group) ortholog of AC084282a 100%
3727 MDKAYIAVFSIVILFLLVDYLRRLRGGGTSNGKNKGMRLPPGLPAVPIIGHLHLVKKPMH 3906
3907 ATLSRLAARHGPVFSLRLGSRRAVVVSSPGCARECFTEHDVAFANRPRFESQLLMSFDGT 4086
4087 ALAMASYGPHWRNLRRVAAVQLLSARRVGLMSGLIAGEVRAMVRSLCRRPAAAAPVQLKR 4266
4267 RLFELSLSVLMETIAQSKATRPETTDTDTDMSMEAQEYKQVVEEILERIGTGNLCDYLPA 4446
4447 LRWFDVFGVRNRILAAVSRRDAFLRRLIYAARWRMDDGEKKSMIAVLLTLQKTQPEVYTD 4626
4627 NMITALCS (0) 4650
6103 NLLGAGTETTSTTIEWAMSLLLNHPETLKKAQAEIDASVGNSRLITADDVPRITYLQCIV 6282
6283 RETLRLYPAAPMLIPHESSADCEVGGYSVPRGTMLLVNAYAIHRDPAAWEEPERFVPERF 6462
6463 EGGGCDGNLSMPFGMGRRRCPGETLALHTVGLVLGTLIQCFDWERVDGVEVDMAEGGGLT 6642
6643 MPKVVPLEAVCRPRDAMGGVLREL* 6717

>aaaa01013573.1a $FI (indica cultivar-group) 99% to AU166330.1 42% to 714A1
3100 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 
     RQELKFSQKQGTNNFISTLFPHFLLCRETYGMHML 3384 (?)
4290 GPVFLYSTGALEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTEN 
     GDEWAYQRKIIAPEFFMDKIK (0?) 4517
4616 MIQLIEDATVTVLEAWEDMIDDVGGCREIVVDDYLRNLSADVIARACFGSSFTEGEEIFC 
     KLRQLQ 4813 (?)
5159 YLPTKSNQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLLNAIIDGAQDGRSAAEA 
     EDFIVGNCKTIYFGGHE STVVTAIWCLMLLATHSEWQERARSEAMEVCRGRSTLDVDA 
     LRRLKI 5515 (0?)
5611 VTMVIQETLRLYPPASVMMQEALTDVKLGNIEVPRGTIVQVPRLMLHLDKEAWGAH 
     ADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMAELKVVLARLLTKFAFSPSP 
     RYRHSPAFRLTIEPGFGLPLMVTKLP* 6033

>aaaa01013573.1b (indica cultivar-group) Second Nterm, ortholog of AQ575202.1 AG023995.1
7217  MELLFSSQQWLALLPPIILCILLFSYVYIILWLRPERLRQKLRSQGVRGPKPSFLFGNI
      QEMRRIQQLAKSAHEQE 7444
7445  AGSTDMFSSNYVATLFPYFLHWSRVY 7522

>aaaa01013599.1 (indica cultivar-group) orth of AP004162.1 $F chr 8
789 RYGEIFKTNLLGCPCVMLASPEAARFVLVSQARLFKPTYPPSKERMIGPSALFFHQGEYH 968
969 LRLRRLVQAALAPDSLRALVPDVDAAVAATLAAWS 1073
1374 EELRTNYSVVERGYNCFPNRFPGTLYHKAIQ 1481
1546 ARKRLRAILSEIVAERRARGGGGDDLLGGLMRSRDDGTAGAVALLTDDQIADNVVG 1719
1720 VLFAAQDTTASVLTWILKYLHDSPKLLE 1803
1914 RAQAEQMAIYVANEGGKRPLTWTQTRSMTLTHQ 2018

>aaaa01013633.1 (indica cultivar-group) orth AP004264.1 $F chromosome 7 99%
5077 DLLGLMLEACAPEHGESCPQLSMDEIIDECKTFFFAGHDTTSHLLTWTMFLLSTHPDWQE 5256
5257 KLREEIAMECGDKVPAGDMLNKLKMVNMFLLETLRLYSPVSLIRRKVGTDIELGG 5421
5422 IKMPEGALLTIPIATIHRDKEVWGEDADEFRPERFENGVTRAAKHPNALLSFSSGPRSCI 5601
5602 GQNFAMIEAKAVIAMILQRFSFTLS 5676

>aaaa01013736.1 $FI (indica cultivar-group) ortholog of BI811079.1 AP005114.1b
6446 MEDNKLILALGLSVLFVLLSKLVSSAMKPRLNLPPGPWTLPLIGSLHHLVMKSPQIHRSLRALSE 6252
6251 KHGPIMQLWMGEVPAVVVSSPAVAEEVLKHQDLRFADRHLTATIEEVSFGGRDVTFAPYS 6072
6071 ERWRHLRKICMQELLTAARVRSFQGVREREVARLVRELAADAGAGGDAGVNLNERISKLA 5892
5891 NDIVMVSSVGGRCSHRDEFLDALEVAKKQITWLSVADLFPSSKLARMVAVAPRKGLASRK 5712
5711 RMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVPVTDEIIVVL 5532
5531 LF (0) 5526
4289 DMFTGASETSPTVLIWILAELMRCPRVMAKAQAEVRQAAVGKTRITENDIVGLSYLKMVI 4110
4109 KEALRLHSPAPLLNPRKCRETTQVIGYDIPKGTSVFVNMWAICRDPNYWEDPEEFKPERF 3930
3929 ENNCVDFKGNNFEFLPFGSGRRICPGINLGLANLELALASLLYHFDWKLPNEMLPKDLDM 3750
3749 QETPGIVAAKLTTLNMCPVTQIAPSSAEDAS* 3654

>aaaa01013880.1 $FI (indica cultivar-group) ortholog of AC120537.1b AQ869247.1
 801 MEVSLPLLIGVVLAFLLLFVLVNVKNSCRSWWPPPEKEKKKLRLPPGPWRLPLVGSLHHVLLS (fs) 989
 991 RHADLPHRALRELAGKYGPLMMLRFGAVPTLVVSSAEAAREVLKTYDAAFASRYLTPTLA 1170
1171 VLSRGGRDILFSPYCDLWRQLRRICVHELLSARRVQSLRHVREDEAARLVRSVAAECAG 1347
1348 RGGAAVVSVGELISRAVNDSVVRSAVGARSARRDEFVRELDESVRLSGGFNLADLYPSSW 1527
1528 LARRLSCAMRETERCNRSLMAIMDDIIREHGDGEEDLLGVLLRLQRNGDVQCPL 1689
1690 TTDLITNVVL (0)
2513 DMFAAGSETSSTTLEWALTELVRNPHIMEKAQSEVREIFRGENKLTEEVMDKL 2671
2672 SYLRLVIRETLRLHLPVPFLLPRQCREPCSVMGYDIPVGTKVLVNAWAIARDNQYWDDPE 2851
2852 VFKPERFENNRVDFKGIDFEFIPFGAGRRICPGIALGLANIELMLASLLYHFDWEFLDRD 3031
3032 RNDEIDLSETFGITAKRKSKLMVYATQRIPCLG* 3133

>aaaa01013893.1 $PI (indica cultivar-group) pseudogene (gap in sequence)
3 diffs with Nterm of AU172561.1 93% to Cterm of AU172561.1
ortholog of AP005254.1b (5 diffs)
3604 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALERL 3783
3784 AGEHGPVMALKLGLVTAVVVSSAGAAREAFTKHDRRLAARAVPDTTRARGFASRSMIWL 3960
3961 PSSDPRWKTLRGVAATHVFSPRSLAAARGVRERKVRDIVGHLAGHAGEVVDVGKVVYGGV 4140
4141 LNL 44 amino acid gap
     RRLDLQGWRRWAE 4188
4189 KRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGTIARDDVTSIMYDLF 4368
4369 GAGTDTIAITVEWAMAELLRNPSVMAKARAEMNHVLAGKVKATEMEENDVEKLPYLQAVV 4548
4549 KEGMRLHPAAPILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPEEFMPER 4728
4729 FLDMAEEVDFRGKDHKFMPFGTGRRLCPGLSMAKRVVPFILASLLHAFEWRLPAGVTAEA 4908
4909 LDLSEKFTTVNVLVTPIKAIPILASDQI* 4995

>aaaa01013993.1 (indica cultivar-group) orth AP003278a $F chr 1 100%
6953 LYEVLRLYPPFIELKRRTYKEMKIGGVTYPAGVIINLPVLFIHHDLKIWGSDVHEFKPE 6777
6776 RFSEGISKASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELAPTYTH 6606
6605 APHTMITLHPMHGAQIKIR 6549

>aaaa01014014.1 $FI (indica cultivar-group) 74% to AAAA01014333.1 45% to 96A10
no introns
3501 MAFSSILQLTLCFLCFSVFYYYHIKSKRKNPAIPVCWPLVGMLPDLLVNRHQLHDWITSF 3322
3321 LTASQLNFRFIGPTMSSNMRFFFTCDPANVRHIFTSNFANYPKGPDFAEIFDDTLGDGIF 3142
3141 NVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSDKVENALLPLLSHFAGTGERCNLQDVFM 2962
2961 RLTFDMSTMLASGEDPGCLAISLPMPKVPFVRAVDYTTRV 2842
2841 LLVRHIIPLSLWKLARRLGVGFERKMAEALRTINQFIYETIVKRRAKKATE 2689
2688 GIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDTIGSALSWFFYLLTKNP 2527
2526 HVASKILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVA 2347
2346 ADVMPSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISDHGKLRYVPSYKFTPF 2167
2166 ITGPRTCLGKDMALVQLKVVAATVVKNFEAEAVPGHIVEPKLSMVLHMKNGLMVRVKRR* 1987

>aaaa01014066.1 (indica cultivar-group) orth AP004326.2a $P chr 1 100%
5245 YMQLVIKETLRLHLPFPLLFPRLCTETCKIMGFDVPKGTIVIVNNWAISRDERCWEDAED 5424
5425 F*PERFEHDDTDYNGTYFQFLSGGFGRRMFPDFIFAQFNIEIALANLLYHFDWELPCSEN 5604
5605 RMELDMTESAGLT 5643

>aaaa01014110.1 (indica cultivar-group) orth of AP002092a $F 100%
6543 KGSLPGPPLVVPFIGSATHMIRDPTGFWEMQAARARKSGVGFTADFLAGKFTIFIRDS 6370
6369 ELSNRVFANVRPDAFFVIGHPFGKKLFGDHNLIYLFGDDHKDLRRRMATNFTP 6211
6210 RALSTYAAIQQRGIVSHLRRWLDRSAANGGKAEPIRVPCRDMNLETSQTVFAGPYLTEEA 6031
6030 RERFKSDYNLFNVGLLAFPVDLPGLAFRRARQAVARLVR
     MLRDCARESKARMRAGGEPECLVDYWMQETVREIDEAK 5671
5670 AAGLPPPAHISDDEEIGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVLARVRAEVASLW 5491
5490 SPDSGEPITADKIAEMKYTKAVAREVVRHRPPATLMPHIALQNFQLTESYTIPKG 5326
5325 TLVLPSMYESSFQGFHDPDAFDPERFFSEARREDVVYKRNFLAFGAGPHQCVGQRYAL 5152
5151 NHLVIFMALFVSLVDFRRERTEGCDV 5074

>aaaa01014217.1 $FI (indica cultivar-group) no introns
4554 MEITTATTSALTAASASTLLYAALAAAAFLYITIVRHRRGGDLPPGPAGLPLIGCLPFLEPNL 4366
4365 HAYFARLAEKHGPVFSIRIGSKLEVVVTSPEVAREVLRDQDHVFANRVIPEAGRAIAFGE 4186
4185 EDNIVGNPAGPKLRLLRRICVSEMLGPSGLSKMYGLRRREFRSTLRHLYTQSLCGTPVCV 4006
4005 GAQMFLTAMNTITNSLWGGKIGSESERTAVGQEFRALIAEITELLGRPNVSDFFPVLAP 3829
3828 LDLQGVQKRMRGIRTQFEHMFARIIQTRAKAEQDGGEASSDFLEYMLKLEKEGGD 3664
3663 GKTPFTMINVKALDMVVGGT 3484
3483 ETISNTVEWAMAEMILNPRILEKVQQELDQVVGRDSLVEESHIGQLHYLRLVFKETIRL 3307
3306 HTPLPLMVPHCPSSTSTIGGYRVPKGTRVFVNVWAIHRNPRVWKAPQEFIPERFSGDDGQ 3127
3126 KWDFSGKEFDYFPFGSGRRMCAGIAMAERMTIYSLALLLQAFDWKLPEGTQLDMDEK 2956
2955 FGVVMKKAKPLVVIPTPRLTKPELYS* 2875

>aaaa01014240.1a (indica cultivar-group) orth AP003232.1d $F chr 1 100%
907  ESLHDVITNLVLAGRETTASALTWFFWLVSGRPDVEDNIVREIRAVRRASSSNGVTSGAA 1086
1087 FSPHELRDMHYLHAAITESMRLYPPVSLDTYVCKEEDFLPDGTFVGKGWQVTYCAYAMAR 1266
1267 VEDIWGTDCEEFRPERWLDEAGVFRPESSFKYPVFHGGPRMCLG 1398

>aaaa01014240.1b (indica cultivar-group) orth AP003232.1d $F chr 1 100%
identical to 1a probable duplication error in assembly
4477 ESLHDVITNLVLAGRETTASALTWFFWLVSGRPDVEDNIVREIRAVRRASSSNGVTSGAA 4298
4297 FSPHELRDMHYLHAAITESMRLYPPVSLDTYVCKEEDFLPDGTFVGKGWQVTYCAYAMAR 4118
4117 VEDIWGTDCEEFRPERWLDEAGVFRPESSFKYPVFHGGPRMCLG 3986

>aaaa01014272.1 $PI (indica cultivar-group) 84% to AC068924.9a
no upstream sequence, AG at Ihelix mutated, stop codon in Cterm and Cterm truncated
6187 EIIKLCSEFLNTDTDTTSTTLWWIMAKLVKNPSIQSNIHDKITAKTGDEKVEVSEENVHG 6008
6007 MPYLRAVVLEGLRKHPPGHFVLPQKAMEDMEVGGYLIPKGATVNFMVAEISRDEQEWAKP 5828
5827 MEFIPKRFLPDGNSEGVDVTGSKGIRMMPFGVKRRICVGLNFAMHHLEYFVANMVREFK* 5648
5647 KEVAGDEVEFVEKQE 5603

>aaaa01014333.1 $FI (indica cultivar-group) 74% to AAAA01014014.1 47% to 96A10
(seq gap after VEK but seq ALLPLLAH overlaps outside the gap)
4957 MAVSSFSFLELLLSFLCFGFFYYYHVKSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSVLTVT 4760
4759 PLNFRFIGPPSSDMRLFITSDPANIRHVFNTNFSNYPKGREFQEIFDILGDGIFSADG 4586
4585 ESWRRQRTKAQMLMSSPRFRAFVARYSRDKVEK 
4358 ALLPLLAHVAGTGDACNLQDVFLRLTFDTTTTLVFGVDPGSVAIDLPEVPFARAMDDA 4185
4184 MTVLLLRHIVPLSWWRLARRLGIGYERKMPVAWRTMDRFVADTIAKRRAEKARTGIDDSA 4005
4004 DLLSSYINDDEEDAGTVDAFLRDTTINLMLAGRDTTGSALSWFFYLLTKNPRVLHKLLQE 3825
3824 LDSVKSTTTADGMVIFDPDETGRLVYLHAALCESLRLYPPVPMEHKGPAAADVLPSGHE 3648
3647 VRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISDDGKLRYVPSYKFMSFNSGPRTCLG 3468
3467 KDMAFVQLKTAAAAVMKNFEIEAVAGHVVEPKLSIILHMKNGFMVTVKRRLAVC* 3303

>aaaa01014342.1 (indica cultivar-group) not an exact match 85% to aaaa01012419.1 $FI
1703 FFAVVLATVVFLLRAVLLRRRRAYKLPPGPKPWPIIGNLNLISSLPHRSIHEISKRHGPI 1882
1883 VQLWFGSCPVVVGSSVEMAKLFLQTNDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWRQ 2062
2063 ARKMCAAELFSARRLESLEHIHHEEVRALLRELHGSGAAGNAVQLRDHLSMAALGVISRM 2242
2243 VLGKKYVEKQPAGGGAAMTTPEEFKWMLEELFLMNGVLNIGDFIPWLDWLDL 2398
2399 QGYIRRMKNVNRLIHRFLDRVLDEHDERRRLQGDGFVARDMVDILLQLADDPNLDV 2566
2567 KLTRNGIKGITQVI 2608
3677 DLVTGGADTSTVTVEWAMSEVLKNPAILAKATEELDTIVGVGRLVTEGDI 3835
3836 HAIMKETMRMHPVVPLLVPRMSREDASV 3919
3915 PSVWDSPEEFRPERFVGSGIDVKGRDFELLPFGSGRRMCPGYNLGLKVIQLTLANLLHAF 4094
4095 SWCLPDGVTAGELSMEEIFGLTMPRKIPL 4181

>aaaa01014445.1 (indica cultivar-group) orth AP003232.1h $F chr 1 100%
447 ESLRDVVTNFLLAGRDTTSSALTWFFWVLSGRPDVEDKIVREIHAVRRASGSTSDATFSF 626
627 DELRDMQYLHAAITESMRLYPPVAMDTHSCKEDDFLPDGTFVGKGWLVTY*AYAMARVED 806
807 IWGADCEEFRPERWLDEVGAFRPESPFKYPVFHAGPRMCLG 929

>aaaa01014453.1 (indica cultivar-group) orth AC025783.5a $F chromosome 10 99%
5489 GDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPRDLVVVSDPAVARHV 5310
5309 LRGYGSRYEKGLVAEVSEFLFGSGFAIAEGALW 5211
4244 RRRSVVPSLHKRFLSVMVDRVFCKCAERLVEKLETSALSGKPVNMEARFSQMTLDVIGLS 4065
4064 LFNYNFDSLTSDSPVIDAVYTALKEAELRSTDLLPYWK
     IDLLCKIVPRQIKAEKAVNIIRNTVEDLITKCKKIVDA 3705
3704 ENEQIEGEEYVNEADPSILRFLLASREE
3285 VTSVQLRDDLLSMLVAGHETTGSVLTWTIYLLS 3187
3082 LLKDPAVLRRAQAEVDRVLQGRLPRYEDLKELKYLMRCINESMRLYPHPPV 2930
2862 VLIRRAIVDDVLPGNYKIKAGQDIMISVYNIHRS 2761
2207 FRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELVPDQKINMTTGATIHTT 2043

>aaaa01014464.1 $FI (indica cultivar-group) 
4147 MAASLAWLLVAIVLASLYLAMQHRSVAAARRRRLPLGPTPLPLVGNLLSVSR 3992
3991 SSPHRSLARLAERYGQLMRVRLGAVDYVVASSPAAAGDIHHHSHNAHLASRPLFDAWRGA 3812
3811 QHHRNSVIALPPHGEWRAQRRLATEEVMSPGRLDALAPLRREKVRELVRRVAGRAARGG 3635
3634 EPVEVGREAFEAFLGILSRTAFSADLVDPDLRDAVQEATKLAATPNVSDFFPAV 3473
3472 AAADLQGLRRRMGKLVARAYGIIDELLARRKGGREAGE
     PRKDDLLDVVLDNQDEWKKENNPVIDRNNIKGLIA (0) 3254
3048 DLFVAGTDSGSTAVEWAIAELLQSPQSMQKVKNEFRRVMCTRTEIEESDISQLPYLQAVL 2869
2868 KETLRLHPSVPMTYYKAEATVEVQGYTIPKDTNIILNIWAIHRKPDVWADPDRFMPERF 2692
2691 METDTNFFGKHPEFIPFGGGRRICLGLPLAYRMVHMVLASLLFHFDWKLPEGAEKDGVDM 2512
2511 REKYGMVLHKETPLKALAIETYNRM* 2432

>aaaa01014488.1 (indica cultivar-group) orth AC074105.1 $F chr 10 99%
14 WAMAELLQNPQTMTKLQEELKKVIGSKTCIDEEDIDQLPYLQAVIKETHRLHPAIPLL 187
188 MYKAAVPVEIQGYKIPKETTVIVNTWAIHQNSEVWIEPDKFIPERFLQKEISLSSGSTN 364
365 IELIPFSAGRRFCLGYPVANRMLHVMLASLVHQFQWTLPEVVKKNGGVDMAEKFGITLSM 544
545 ATPLHAI 565

>aaaa01014577.1 (indica cultivar-group) orth AC083943.6 $F CYP78A11 100%
2273 QEMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMPYLQ 2100
2099 AVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADPEAF 1920
1919 APERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWFLPD 1740
1739 GSPPVSLDEVLKLSLEMKTPL 1677

>78A11 AC083943.6 orth of aaaa01014577.1
40753 MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLAFATAAVLAWAASPGGPAWAHGRGRLGA 40965
40966 TPIEGPRGLPVFGSIFALSRGLPHRALDAMSRDAAAPRARELMAFSVGETPAVVSSCPAT 41145
41146 AREVLAHPSFADRPLKRSARELLFARAIGFAPSGEYWRLLRRIASTHLFSPRRVAAHEPG 41325
41326 RQADATAMLSAMAAEQSATGAVVLRPHLQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQ 41505
41506 LKSMVREGFELLGAFNWSDHLPWLAHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRD 41685
41686 SSSTAADNADFVDVLLSLEAHENLAEDDMVAVLW 41787 (phase 0 intron)
41874 EMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMP 42035
42036 YLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 42215
42216 EAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWF 42395
42396 LPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA* 42506

>aaaa01014709.1 (indica cultivar-group) 49% to 51A2
560 LFIIATILSKIATRERTRTTSTKISRPPPPPMARGAPLVGVLPSLLAKGPVAFIRHHYEK 381
380 MGSVFTVSLLQQKVTFLVGSEAASHFYKGLDSEISQDEVSQFTIPTFGPGVAFDVDYATR 201
200 HEQFRFFGDIMKPAKLRTYVDLMVAEVE 117

>aaaa01014797.1 (indica cultivar-group) orth AC074105.1 $F chr 10 99%
1978 DARRRLPPGPRPLPVIGNLLDVAGELPHRSLACVAERYGPLVTLRLGTMLAVVASSPATA 1799
1798 RDVLHRHGASITDRGTPDAWSTDGHDSNSIFAFPTRHHRWRALRRLGAEQLFSPRRVEEQ 1619
1618 RPLRRDAVRGLLRHVAELAAASGGGGAAVVDVGRAAFAAMASLLFGALFSAGIDAATSCR 1439
1438 FRDAAREFALLTMTPNVSEFFPVVAMADLQGLRRRTARHITWMYQLIDGH 1289
1288 VERRMRGRETPGGCGAAHGEKEKDLLDVMLDMSEKEEQNDDSSLTMNRGVIRAFMAVS 1115
1114 ICILYISVFYQIIQFTFN 1061

>aaaa01014830.1 $FI ortholog of AL662990.1? a CYP79
4669 MFPSSVNMREQNNII
4624 IISIAMTILLLVVFFCRMLGNMAGKNKRKKQPKLPPGPATMPVLGNIHQILMNKPVFRW 4448
4447 IHRLLDEMDTEILCLRLGSVHVIAIASPEMAREALRRNDAVLTSRPVSFAWRAFSFGYKN 4268
4267 TVGSTGDQWKKMRRMLASEILSSAMERRMLGQRVEEADHLVNYIYRNCNSGTVDIRHVT 4091
4090 RHFCGNIIRKLVFGRRHFAFGAGNIGPGRDEEAHIDALFTALDYLGAFSISDYFPSL 3920
3919 VLNGLMSTFRRLHDPIIMERMEEWRAPRRNGDERREVADFLDVLISLDDAQGK 3761
3760 PLLSLDEVKAETL 3722 (0?)
3092 EIILNSVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGKERLVEESDIHSLTYLKACI 2913
2912 REAFRIHPYHPFNPSHVAIANITIAGFMIPKGSHIILSRIGLGRNPRAWDNPLEFRPERH 2733
2732 LKNTDNVVLAEPELRFLSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSISPGANRIEL 2553
2552 QESVTSLQLSKPLLMQAKPRLLLHLYEMDIAKQG* 2448

>aaaa01014899.1 $FI (indica cultivar-group) 
223 MVTTHLAYVLLFLVTAVLLFHLRRGG
    RSAPAKLTTAHRPHPNPVLGNTVEFIRNRRRFFDWYTDLLRASPS
    GAIEAWGPFGAGHAVTTACPAAVEHLLRGNFGNYVRGASFRAAMSELIGDG
589 LFAADGRLWSVQRKVASYAFSSRALRRFSDDVLAVHLRGGLLPFLDAAAASGEAVD 756
757 LQDALRRFAFDSICHVAFGVESSTLIETAREDSGRHEALFAAFDAAVEISFRRALAPFTL 936
937 VRKLTGLVNVGSSRRLREAIGVIDDYAMSVVESKEAACRDRDSEDVDPDLLSRFMAA 1107
1108 MDEEDGGELGAMFPTPEGKRRLLRDVVVSFVLAGKDTTSSALTWLFWLLAANPRCERRVR 1287
1288 DEVSRSPDGDGGGDAKGMHTHYLHAAITEAMRLYPPVPFNGRVAVGDDVLPG 1443
1444 GAAVRAGWFANYSAYAMGRMERLWGEGCLQFSPERWLRDGGEFVAVDAARYPVFHAGPRA 1623
1624 CLGKEMAYVQMKTVAAAVLRRFSVEVAAPAPAMESPPAYEMTATMKMKGGLWVRLRKRE* 1803

>aaaa01014982.1 $FI (indica cultivar-group) 
4398 MQPMAPANVLYAALLVPMVLYLAVTRRRSRRLPPGPAGLPLVGSLPFIDPNLHTYFAGLAA 4216
4215 KHGPILSIRLGSKVDIVVTSPELAREVLRDQDSVFANRVMPDAGNAVSFGGVQNIVGNPV 4036
4035 GPMWRLLRRLCVHEMLSPSGLANVHDLRRREFRSTLRYLHTKSGEPVDLGAQMFLNTMNV 3856
3855 ITSAMWGGTIGSESERAAVGSEFRGLVAEVTELLGTPNVSDFFPALAPFDLQ 3700
3699 GIRGKMERFRSRFDLMFAKIIQQRMKAQQDGGETATDFLECMLKMEKEGGDGKAPF 3532
3531 TMDNVKALLL (0) 3502
3404 DMVVGGTETTSNTVEWAMAEMLQNPQVLKKAQQELDSVVGRDEVVEEWHLPQLHYLRMV 3228
3227 IKETLRLHPALPLMVPHSPSAASTVSGYHVPEGSRVFVNVWAIQRNPLVWNEPLEFNPER 3048
3047 FAGDEGHKWDFTGSQFDYFPFGSGRRICAGIAMAEKMTAYSVAMLLQAFDWKLPQGVQP 2871
2870 DLSEKFGIVMKKAAPLVAIPTPGYLSLSCTISEASFYLAKKRKKHVQPAQPNS* 2709

>aaaa01015179.1 (indica cultivar-group) 58% to 90A1
4640 RALMPPGSTGLPLIGETLRLISAYKTPNPEPFIDERVARHGGVFTTHVFGERTVFSADPA 4819
4820 FNRLLLAAEGRAVHSSYPSSIATLLGARSLLLTRGAAHKRLHSLTLTRLGRPASPPLLAH 4999
5000 IDRLVLATMRQWEPAATVRLMDEAKKITFNLTVKQLVSIEPGPWTESLRREYVKLIDGFF 5179
5180 SIPFPLANLLPFTTYGQALK 5239
5376 ARKKVADALREVIKKRMEEKAENGGSIGDDEGKKEKKDMVEELLEAEGGSFSEEEMVD 5555
5556 FCLSLLVAGYETTSVLMTLAVKFLTETPAALAEL 5657

>aaaa01015196.1 (indica cultivar-group) orth to AP004181.1 $F chromosome 2 96%
6580 EALRMNPPVEFQYGRARRDMVVESHDAAYEVRKGEMLFGYQPLATRDEKVFDRAGEFVPD 6401
6400 RFVSGAGGAARPLLEHVVWSNGPETGTPSEGNKQCPGKDMVVAVGRLMVAEMFRRYDTFA 6221
6220 ADVEELPLEPVVSFTSLTRAA 6158

>aaaa01015239.1 $FI (indica cultivar-group) 55% to AC090873
MALLLLLVSSSCLVV
ATSIAVLCYVNNDADERLPPGPRVRLPLIGNLFLHAPTMAFLPSALRRLRRSHGPVVTLW
AGNRPAVFVIGRDFAHRTLVRAGAALAHRPPSPFASSRALSFNRHGVNAAEYG frameshift
RRSLRRLRSNICSCLAATEALQRRSVDRLVATLELEARAGAGATGVVAPTDAFRHGVFSFFAVLCFGE
WVRDGEHDAVLRDLRRAHAD
5420 ILALTVELGAFHLVPAVLMVPYLHRWWKLSGLQRSHRDIVAALISVRRLRREK 5262
5261 ADGDVADSATFCYVDTLLELELGEDEMVSLCWEFMNAAAKTTSTALEWTM 5112
5111 ARLVHHSDIQRKLRHDIAKTTNSGGVGVSPSPYLKAVVQESLRLHPPAHYLLAHTV 4944
4943 DRDVPLGAGGYVIPKGAIVNYAVAEIGRDATAWTDPDEFLPERFMEGGEGAMVDAASCGG 4764
4763 TDIRMMPFGAGRRACPCASFAVSVLHLFVGRLVEQFEWWPMAEDDKAPVDFSEK 4602
     TGLVTVMKTPLRALFVPTTSS*

>aaaa01015254.1 (indica cultivar-group) not an exact match 53% to AC092559.2
3134 LAVSVVLIFWSRHRRNPSSRLKLPPGPTRLPIIGNLHQIGRLPHRSLGALAGWHGPVMAL 3313
3314 WLGTVPVVVLSSPKAEREALQVHDPECCNRSPT 3412

>aaaa01015479.1 $FI (indica cultivar-group) ortholog of AQ160861
4482 MEYYSQDAYFVTASLISIAFFLWYASRLRRTAILLPPGPPGLPVLGNLLSVHQFTHRGLA 4661
4662 KLSKIHGGFFHLRVGQVNVFVVSSPETVREIIHENDSVFSHRPVTAAMVYVSYDLADMAF 4841
4842 AHYGPFWRQMRKLCVLKLFSPRRDVSWRVVRGEVDALVRSVAELRRVAGSVGDLVFKFAT 5021
5022 NVTFRAAFGAQSREDEKVFVDIILELSEIFMAFNMGDYIPCLGWLDLNGIGKRMAAARHA 5201
5202 LDVFIDRIIDEHLAKLRNGDVSASDMVDDMIAYLVDAPGGRHKRADGVELGDLHLTRDNI 5381
5382 KGLIMARN (0)
     DIMFGGTKTVASTVEWALSELLRNPDEL 5561
5562 RRAQDELAGVVGLRRRVNQDDLDNLPHLRCVTKEVLRLHPPLPLLLRESLHDCAIG (1?) 5738
5731 GYTVPRGSRIWINNWAMCRDEVLWGTDAAAFRPSRFADESARVEFKGGDFQYLPFGSGRR 5910
5911 SCPGMQLGMFAVELGLAELLHCFDWSLPAGTEPLELDMDDVFGLTAPKAERLCAVPSPRL 6090
6091 SCPLL* 6108

>aaaa01015559.1 $FI (indica cultivar-group) orth AP004026 $F chr 2 >99%
3876 MELVVQALAAAAALLAVFFLSTLYLSPAATARRLRNAGFRGPTPSFPLGNLREIASSLSS 3697
3696 NNDTDESNTKGGDIHAAVFPYFARWRRAFGKVFVYWLGTEPFLYVADPEFLKAATAGALG 3517
3516 KLWGKPDVFRRDRMPMFGRGLVMAEGDEWARHRHIIAPAFSATNLNDMIGVMEETTAKML 3337
3336 GEWGDMVASGRSCVDVEKGVVRNAAEIIARASFGISADDDDATGARVFHKLQAMQAMLFR 3157
3156 STRLVGVPLAGLLHIRATYEAWKLGREIDALLLDIIESRRRREGGGGGKKKKKTTSNDLL 2977
2976 SLLLAGSEASAGAERKLTTRELVDECKTFFFGGHETTALALSWTLLMLAAHPEWQAAVRE 2797
2796 EVVEVAGRSGPLDAAALGKLTKMGCVLSEVLRLYPPSPNVQRQALQDVVVVAGDGEKKVV 2617
2616 IPKGTNMWIDVVAMHRDGELWGEEASEFRPERFMREGVQGGCRHRMGYVPFGFGGRICVG 2437
2436 RNLTAMELRVVLAMVLRRFAVEVAPEYRHAPRIMLSLRPSHGIQLRLTPLC 2284

>aaaa01015583.1a (indica cultivar-group) Nterm (plus strand) (partialI)
ortholog of AC068924.9h, 9diffs in 202 aa 7 in one region
610  MTIDASPWLLLLVAFLFPFFVLRSLRSDGKGGG
709  RGGGCRVPPGPLAVPVLGNLLWLWHSPADLEPLLRRLIARHGPVVSLRVGSRLSIFVA 882
     PPRRARRPVVERGAALADRPEVTRAL 962
963  LGENGNTITRASYGPTWRLLRRGLVSGTLHPSTTRARVFAPASSWARRVLVGKLAAASGQ 1142
1143 APHGVMDTLQYAMFCLLVVMCFGER 1217 seq gap here

>aaaa01015583.1b $PI (indica cultivar-group) Cterm (minus strand)
ortholog of AC068924.9g 100%
3915 KRPATVPENDTTFEHSYVDTLLDLRLPEDGDRALTDKAMVCLCSEL 3778 
fs, then this looks like a recombination between 9g and 9a
ortholog of AC068924.9a 100% from GAD to RAQLV
3776 LYSGADTMSTTLQWIMAELVKNPSIQAKLYDEIKVTVGDDHEGVSEEDTQKMPYLKAVILEGL 3588
3587 RKHPPGHFALPHKAAEDMDVGGYLIPKGATVNLMVAEMGRDEREWENPMQFIPERFFAGG 3408
3407 DGEGVDITGSKRIRMMPFGVGRRMCAGINTAMLHLEYFVANMVREFEWKAVAGDEVDFAE 3228
3227 KFEFTTVMAKPLRAQLVRRSID* 3159

>aaaa01015583.1c (indica cultivar-group) 93% to AC068924.9h runs off end
6384 GTDTMSTALQWIMAELVKNPSIQSKLYEEIKATVSDDHDEITEEDTKKMPYLKAVILEGL 6205
6204 RKHPLGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAEMGRDEREWENPMQFMPERFLPGG 6025
6024 DGEGVDMTGSKRIRMMPFGVGRRMCAGLNTAMLHLEYFVANMVRAFEWKEVAGDEVDFAE 5845
5844 KAELTTVMAKPLRAQLVLR 5788

>aaaa01015628.1 (indica cultivar-group) orth to AP002092b $F 100%
5788 LFGRLMVFIRDSELSRRVFANVRADAFHLVGHPFGKKLFGDHNLIYMVGKEHKDLRRRIA 5609
5608 PNFTPRALSTYAVIQQRVILSHLRRWIDRSVANGGKAEPIRVPCRDMNLETSQTVFVGPY 5429
5428 LTVETRERFDRDYNLFNHGFITLPIDLPGSAFRRARLAVPRLKHILEDCARQSKQRMRGG 5249
5248 GEPECLVDYLMQETVREIDEAAAAGLPPPPHTSDMETGNLLFDFLFAAQDASTSSLC 5078
5077 WAVSALDSHPDVLARVRAEVAALWSPESGEPITAEMMTEMKYTQAVAREVVRYWPPGP 4904
4903 VVPHIAGEAFQLTEQYTIPKGTIVFPSVYESSFQGFPDAGTFDPERFFSEARREDV 4736
4735 VYKRNFLAFGAGPHQCVGQRYALNHLVIFMALLASLIDFRRERTEGCDV 4589

>aaaa01015659.1 (indica cultivar-group) orth AP003232.1f $F chr 1 100%
5113 ESLRDVVTNFLIAGRDSTSSALTWFFWLVSSRPDVEDKIVHEIRAVRSASSSGGTSSATF 5292
5293 SFDELRDMHYLHAAITESMRLYPPVHLDTHSCKEDDFLPDGTFVGKGWLVTYCAYAMGRV 5472
5473 EDIWGADCEEFRPERWLDEAGAFRPDSPFKYPIFHAGPRMCLGKEMAYIQMKSIVACVLE 5652
5653 QFSLRYAGGD 5682

>aaaa01015785.1 $FI (indica cultivar-group) one frameshift  no introns
ortholog of AC068924.9j 98% 3 diffs aa 1265
266 to end has 16 diffs but 9 are in one 18 aa region
1921 MAIDATQWLLLLVVFLVAFLFTLLAKHGAVKRKHGVRVPPGPLAVPVLGSLVWLTHSSSA 1742
1741 NLEPLLRRLIARHGPVVSLRVGSRLSIFVADRRVAHAALVGCGAALADRPPDVTHSLLGE 1562
1561 SRNTITRSGYGPVWRLLRRNLVVETTHPSRVRLFAPARSWVRRVLVDKLADAGAHPASPP 1382
1381 RVLEVFRYAMFSLLVLMCFGERLDEAAVRAIGAAQHDFLLYLGRKTSVFMFYPAITKHLF 1202
1201 RGRVHLGLAVRRRQKELFMPLINSR 1127 (fs)
1125 RERKKQIQQSGDPAASSEKKDDNTTFNHSYVDTLLTIRLQDVDGDGDRALTDDEMVSLCS 946
945  EFLSAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDGDDHDEITEDDARNNLPYL 766
765  KAVILEGLRKHPPMHLLLPHKAAEDVEVGGYLIPKGATVNFMVAEMGRDEKEWEKPTEFI 586
585  PERFMAGDGDGEGVDVTGSREIRMMPFGAGRRICAALSVAMLHLEYFVANMVKEFEWKEV 406
405  AGDEVDFAERLEFTTIMAKPLRVRLIKRA 319

>aaaa01015940.1 (indica cultivar-group) orth AP005302.1d chr 6 100%
3349 PGLPVIGNMHQLKEKKPHHTFTKWSKTYGPIYTIKTGASSVVVLNSTEVAKEV 3507

>aaaa01016095.1 (indica cultivar-group) orth AC074232.2c $F chr 10 99%
5913 VQGLMLRATMDSIFTIAFGTDLNTLDGSGEGSRFAAAFDDASEFTMLRYISPLWKLAR 5740
5739 LLNVGVEAMLKERIKVVDEFVYRLIRARSDELSN
     DILSRFLQATTSDSGVDYKYLRDIILNIVIAGKDTTAGALA 5383
5382 WFLYMVCKHPEVQEKICHEAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTET 5212
5211 LRLYPSVPMENKQCFSDDVLPN 5032
5031 GFNVSKGDIVFFIPYAMGRMESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQ
     AGPRICLGKEFAYRQMKIFAAVLLRFFVLK 4684
4683 LRDEKEIVGYRTTLTLAIDQGLHL 4612

>aaaa01016100.1 (indica cultivar-group) orth? AC105377.3 $P like 98A3 chr 10 94%
5606 LPPGPRAWPVVGNLFDITPVRCRCFMEWADKYGPIMTVWLGTSPTIVVSTSELAREVFKN 5785
5786 NDQQLADRPRNHSAERLSRGGTDLIWADYGPHYVKVRKLCNLELFAPRRMEALRPIREDE 5965
5966 VTAMVESI 5989

>aaaa01016223.1 (indica cultivar-group) orth AL606614.1b $F chr 4 96%
1585 PRPRGLPLIGNLHQVGALPHRSLAALAARHATPLMLLHLGSVPTLVVSTADAARALFRDN 1764
1765 DRALSGRPALYAATRLSYGQKNISFAPDGAYWRAARRACMSALLGAPRVRELRDAREREA 1944
1945 AALIAAVAAAGASPVNLSDMVAATSSRIVRRVALGDGDGDESMDVKAVLDETQA 2106
2107 LLGGLWVADYVPWLRWVDTLSGMRRRLELRFHQLDALYERVIDDHLNNRKHASDEE 2274
2275 DDLVDVLLRLHGDPAHRSTFGSRSHIKGIL 2364
2699 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVVAAGDKVREADLPELHY 2872
2873 LRLVIKETLRLHPAAPLLVPREMTEPFRTAHGVEIPARTRVVVNAMAIHTDPGVWGPDAE 3052
3053 RFVPERHRDDADGCAQQHDGFALVPFGIGRRRCPGVHFAAAAVELLLANLLFCFDWR 3223
3224 APPGREVDVEEENGLVVHKKNPLVLI 3301

>aaaa01016295.1 (indica cultivar-group) 81% to AL607001.1 chr 4, gene 3
8   YLCCVQGRRNAMKVLKKMMRER 73
78  EEPGRQCEDFFDVLIEELGREKPVLTEGIALDLMFVLLFASFETTSLALTLGVRLLAENP 257
258 TVLDALT 278
374 EEHEAIVRGRKEGCDAAGLTWAEYKSMTFTSQ 469
1110 RLANIVPGIFRKALQDIEFKG1187
1285 YTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWQ 1389
2420 EITGGSKHFMAFGGGLRFCVGTDLSKVLIATFIHHLVTKY
     RWKTVKGGNIVRTPGLSFPDGFHVQFFPK 2740

>aaaa01016347.1 (indica cultivar-group) orth of AP003244 $F 59% to 90D1
3400 EENIQLKRRKTDMGETLQWTDYMSLSFTQH
     VITETLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCVFVYFRSVHLDDTLYDEP 3759
3760 YKFNPWRWKVRK 3795
4321 FTPFGGGQRLCPGLDLARLEASIFLHHLVTSFRY 4422

>aaaa01016355.1 $FI (indica cultivar-group) ortholog of AA754418
90% to AAAA01004950.1
5728 MEDWLFYSLTSLLCLACSLLLRARASAASPKAAEAEAAPLPPGPRTVPVLGPLLFLARRDFDVEPTLRR 5522
5521 IAAEHGPVFTFAPLGPSRPTIFVAARGAAHRALVQRGAAFASRPRGGGGPASALLSSGGR 5342
5341 NVSSAPYGPTWRALRRCISSGVLNPARLRAFSDARRWVLDVLISHVRGEGGAPVTVMEPF 5162
5161 QYAMFCLLVYMCFGDRPGDARVREIEALQRDLLGNFLSFQVFAFLPPITKLVFRERWNKL 4982
4981 VSLRRRQEELFVPLIRARREAGAGGDCYVDSLVNLTIPEDGGRGLTDGEIVSLCSEFMSA 4802
4801 GTDTTATALQWILANLVKNPAMQDRLREEIAAAVGSDGEVREEDLQAMPYLKAVVLEGLR 4622
4621 RHPPGHYVLPHAVEDETTLDGYRVPANTPVNFAVGEIGLDSEVWASPEVFRPERFLPGGE 4442
4441 GEDVDLTGGKEIKMMPFGAGRRVCPGMALALLHLEYFVANLVREFDWREVAGDEVDLTEK 4262
4261 LEFTVVMKRPLKAIAVPLRGDRSAAVE* 4178

>aaaa01016663.1 (indica cultivar-group) orth AC091302.3 $F chr 3 99%
DIMIATVDNPSNAVEWALAEMMNKPEVMRKAMNELDTVVGRDRLVQE 2600
2599 SDVRDLNYLKACIREAFRLHPYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPR 2420
2419 VWDDPLEFRPERHLSPYPAGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTL 2240
2239 FARLLQGFEWSKPAGVKRVELREEAASLVLAQPLVLQATP 2120

>79A7 AC084319.5 one diff with indica seq aaaa01016663.1
MSEAMAVTMPPMRAPALVAMLVVVLVALVRRRRHRSKGAGGRLESLPP
GPVGLPVIGNMHQMLVNKPVFRWVHRLLADAGGEIVCVRLGPVHVVAVTSPEMAREVL
RKNDAVFADRPTTFAAESFSVGYRSASISPHGDQWRKMRRVLTAEILSPATEHRLRGA
RGEEADHLVRYVLVRCGRDGAAVDVRHVARHFCGNVIRRLTLGRRHFREPRADDEDAA
APGRDEAEHVDALFATLNYLDAFCVSDYFPALVGLDLDGQEKVIKKVMRTLNRLHDPV
VEERVEEWRLLRKAGERRDVADFLDVLASLDDAAGRPLLTVEEIKAQTIDIMIATVDN
PSNAVEWALAEMMNKPEVMRKAMDELDTVVGRDRLVQESDVRDLNYLKACIREAFRLH
PYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYP
AGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGV
ERVELREEAASLVLAQPLVLQATPRLAAHLYGAGK

>aaaa01016714.1 $FI (indica cultivar-group) runs off end, one frameshift
50% to AP003850.1 probably in 85 clan, no introns missing about 23 aa at end
MDASAMLVALLTILATAAAVASSSLRRRKNQPPGSLGLPVVGHTLALLRALRSNAA (fs)
RAAAYGPVSTISLFGRPTAFL 4604
4605 AGASCNKLLFSSDKLAAMSSASFLRMVGRRNIREVAGDDQRRVRAMMARFLRL 4763
4764 DAVKNYVSAMDDEVRRHLRAEWGGRAAVAVMPSMKSLTFDVMCTVLFGLERRGDHAAVRR 4943
4944 ELSSEFQQLVRGIWAVPVNLPFTTFGKCLAASRRGRRAVARIVE 5075
5076 ERRRAMPRGGGGGGSAGDLVTHMLAEGMDEEEIIDNVVFLMVAAHDTTAV 5225
5226 LLTFLLRHLDGNRAAYERVAAEQEAIATQRRRRGGSGSGSGSALTWDDLAGMRYTWAAAM 5405
5406 ETLRMVPPTFANMRKAVADVEVGGYVIPKGWQVITAATMTHLDPTIFPDPGRFEPARFE 5582
5583 AAAAKSAPPPFSYVPFGGGARACPGNEFARAETLVAMHYIVTGFRWRLAAGCD 5741
5742 GGFSRHPLPCPNQGLLLDIEPKE 5810

>aaaa01017052.1 (indica cultivar-group) orth AP003232.1 $F chr 1 99%
2850 SDESLRDVVTNFVLAGRDTTSSALTWFFWIVSGRPDVEDRVVREIRAVRASSGSTDATFS 3029
3030 FDELREMHYLHAAITESMRLYPPVAIDTHSCKEDDFLPDGTFVGKGWLVMYSAYAMGRME 3209
3210 GIWGADCEEYRPERWLDEAGAFRPESTFKYPVFNAGPRICIGKEMAYIQMKSIVACVLEK 3389
3390 F 3392

>aaaa01017255.1 $PI (indica cultivar-group) 81% to AP003232.1 
probable pseudogene due to frequent frameshifts
2147 MELSSTSTSLFFILIPFLPLLYFLYLH frameshift
     LDPRKQPHAHGLKSYPVVGTLPHFVKNRDRFLEWSTG 2342
2343 VMKRSPTHTISFKGLGLTAGAITANPANVEH frameshift
     VLKTNFDNYPREGL 2479
2480 ISLAEDFLGRGIFSSDGEQWLWQRKAASYEFNKRSLRNF 2596 frameshift
     VVDSVRFEVVERLLPLLEQAAGRDGRTLDVQDVL 2699
2700 ERFAFDNICRVAFDEDPACLTEESMATPQSAEFMRAFND 
2817 AQNTILSRFLSPAKSLWRAKRLFNMEPERRMREAINTVHTYTERIVRERREREEAGLARR 2996
2997 DDFLSRFAAGGEHSDESLRDVVTNFLMAGRDSTSSALTWFFWLLSDRP 3140
3141 DVEGKIVHEIRAVRSASISGGMGSTTFSLDELRDMHYLHAAITESMRLYPPVPINARTC 3317
3318 KEEDSLPDGTFVGKGWHVTYCAYAMGRMEDIWGADCEEFRPERWLD 3455
     EAGVFRPESPFKYPI frameshift
     FHAGPRMCIGKEMPYIQMKSIVAXXXXXXX frameshift and small deletion
     LRYAREEGHPGLVLSLTLRMEAGLPMKVTSRE*

>aaaa01017257.1 (indica cultivar-group) small seq gap of about 3 aa
might be a frameshifted region before that just after VIARQMV (partialI)
connot complete in indica or japonica seq.
     MATPEDTGSWLLYLSLAAKCSGDGDGQPHRLLGFVVVCAVAGLVTCLLHWSFPGGPAWGRW
3808 WWTRRRRRGSPCGVAAVPGLRGLPVIGSMWLMTGLAHRKLAAAAEAAGAGRLMALSLGE 3984
3985 TRVVVAAHPDVAREILHGAAFADRPVKESAYGLLFHRAIGFAPHGAYWRALRRVA 4149
4150 STHLFSPWQVAASAPQRAVIARQMVRAIKLQQRSRSGDSAAGA 4278 small seq gap
     RRASLHNVMWSVFGRRYELQLDPGKESDEVRELRALVDEGYDLLGQLN
     WSDHLPWLARFDLQSTRARCSRLVPRVNRFVTRIIDEHRSSAPVAAAI
     DFTDVLLSLQGSDKLADSDMVAVLWVRH (0)
4829 EMVFRGTDTVAVLIEWVLARLVLQQDVQARVHDELGRVVGLDRDVTESDTASLVYLH 4999
5000 AVIKETLRLHPPGPLLSWARLATSDVHVDGYLIPAGTTAMVNMWAIAHDPDVWAEPMEFR 5179
5180 PERFIGKAAEFSVMGSDLRLAPFGSGRRSCPGKSLAMATVAFWLATLLHEFALLPSPDP 5356
5357 AHGVDLSEVLRLSCEMATPLAVTAWPRRVV* 5449

>aaaa01017492.1 $FI (indica cultivar-group) ortholog of AP003850.1 96%
5100 MALAVVVVALLVAFLTPLAVYLAGRSTRTTPRRRRNLPPGSLGLPLVGQSLSLLRAMRR 4924
4923 NTAERWLQDRIDRYGPVSKLSLFGAPTVLLAGPAANKAVFLSEAMAPKQPRSLAAIIGRR 4744
4743 NMLELVGDDHRRVRGALAQFLRPEMLRRYVGTIDGEVRRHLAGRWAGRRAVAVLPLMKLL 4564
4563 TLDVIATLLFGLARGAVRERLAAAFADMLEGLWAVPLDLPFTAFRRSLRASARARRLLAA 4384
4383 TVREKKANLEQGVSSPSDDLISYLVSLRDGDGDGRPLLTEEEIIDNAIVCLTAGHDTSAI 4204
4203 LMTFMVRHLADDPASLAAM (?)
     HEEIARSKRDGEALT 4024
4023 WEDVARMKLTWRVAQETLRMVPPVFGSFRRALEDVELDGGYVIPKGWQVFWAPCVTHMDP 3844
3843 AIYHDPGKFLPSRFDAQAAPAPPYSFVAFGGGPRICPGMELARVETLVTMHYLVRHFRWR 3664
3663 LCCGGEENTFVRDPLPSPANGLPVELDHIAPLHCDEF* 3550

>aaaa01017554.1 $FI (indica cultivar-group) added 8 aa to Nterm
483 MTGGLEVAMVAGGSNGGAAVLVGITVLLFVVVVVVVVLVRWWSGGEGGAAPSPPALPVLGHLHLLKKPLHR 695
696 SLAAVAAGVGAPVVSLRLGARRALVVSTHAAAEECFTACDAALAGRPRTLAGEILGYDHT 875
876 IVLWAPHGDHWRALRRFLAVELLSAPRLAALAADRHAEAASLVDAILRDAAGGAKVTLR 1052
1053 PRLFELVLNVMLRAATTRRRHASVDARKLQEIIEETFSVNGTPSVGDFFPALR 1211
1212 WVDRLRGKVGSLKKLQARRDAMVTGLIDDHRQWRSGSAGDGDQDKEKKGVIDALLA 1379
1380 LQETDPDHYTDNVVKGIIL (0) 1436
1896 SLLFAGTDTSALTIEWAMAQLVTHPETMKKARAEIDANVGTARLVEEADMANLPYIQC 2069
2070 VIKETLRLRTAGPVIPAHEAMEDTTVGGFRVARGTMVLVNAWAIHRNGDVWDAPEEFRPE 2249
2250 RFVDSDAGGAVTAPMMPFGLGRRRCPGEGLAMRVVGVSVAALVQCFDWEVGDDDVV 2417
2418 DMTEGGGLTMPMATPLAAVCRPREFVKTILSTSM* 2522

>aaaa01017559.1 (indica cultivar-group) orth AP004346.1b $F 98%
3049 DCCLHPVCTRFFSPYSAYWREMRKLLVIELTSIRRVQSFAYARAAEVAR 3195
3196 LVDTLAASLAGVPVDLSSALYTFSDGVIGTVAFGKVYGSAAWSSSEWGGSFQEAMDETM 3372
3373 QVLGSFSFEDFFPSSALARWADALTGAAGQRRRVFHRIDGFFDAVIDKHLEPERLSAGV 3549
3550 QEDMVDATVKVWREQKDEAFGLTCDHIKAIL 3642

>aaaa01017648.1 (indica cultivar-group) orth of CYP72A23 $F AP002839
2676 YLPTKKNRRMRRINSEVESILRGIIGKRMQAIAEGESTNDDLLGLLLESNMRHADENGRS 2497
2496 SPGMTTEDVIEECKLFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLGLFGRDKP 2323
2322 EYEGLSRLKTVSTRRNNN
2159 EVLRLYPPAIVFSRKTYKEMEIGGVVYPRGVILELPVLFIHHDREIWGRDVHEFR 1995
1994 PERFAEGISRASNDRGAFLPFGWGPRVCIGQNFALLEAKMALCMILQRFEFELAASYT 1821
1820 HAPHTVMTL 1794

>aaaa01017763.1 (indica cultivar-group) orth AP003990.1c $F chr 2 97%
1306 FLFLALMVVRLRTKRRGDNNGGVKLPPGPWRLPLVGNLHQVMARGPLVHRTMADLARRLD 1485
1486 APLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSPTTRRLRCDGEGVVFATYGAL 1665
1666 WRQLRKLCVVELLGARRVRSFRRVREEEARRLVAAVAASPRGEAVNVSERITAVITDAT 1842
1843 MRAMIGDRFGRRDEFLELLADIVKIGSGFSLDDLFPSWRLAGAIGGMARRAEANH 2007
2008 RRTYELMDSVFQQHEQRRVHVAAPADGAMDDAEEDLVDVLFRIQKDGGLEVPLTIGNI 2181
2182 KAIIL
2562 DLFNAGSETSANTLQWVMSELMRNPKVMRKAQAELRNNLQGKTTVTEDDLTNLKY 2735
2736 LKLVIKETLRLHPVLPLLLPRECQEACNVIGYDVPKYTTVFINVWAINRDPKYWDMAEMF 2915
2916 KPERFDNSMIDFKGTDFEFVPFGAGRRICPGIAFAQSNMELVLATLLYHFDWELPSGMSP 3095
3096 EELDMTEDMGLSVRRKNDLYLHPTV 3170

>aaaa01017833.1 (indica cultivar-group) N-term pseudogene fragment
3692 LMYLVLLPDVNRSNRPERWEDGDGWQRLPP*PRRLPLLRYLHLLGAPLHQAFHPLPR 3862
3863 HMAWCYYSSSNACRWWLSSFAATSRPKSAMAEQLLYGCDVAFAPYGEY* 4009
4010 S*ECRICVLFFRCIREEEVAVLVKHVRHPCR 4102

>aaaa01018092.1 $FI (indica cultivar-group) ortholog of AU031131
2350 MDKAMAFIPPRDLVVVLPFLALLLPLYIYLRYSR
     SAKANPSLPTEWPLVGMLPSLVANIHNLFDYATALLAA 2135
2134 SGNSFEARGPPMSGLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFDVMGDSFFNADGE 1955
1954 SWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPFDLQRLLTRFAFD 1775
1774 VTAMAVFGVDTCRLSIDMPPLDVANAMDAVMEVGFFRHTVPVSCWKLMRSLRIGPERKLT 1595
1594 AAQRLLRRFVAEMIEKRRVAGGACKATDDEQGGVPPPADIVSSYINDPEYVDEDGNPR 1421
1420 EFMYATFINYMVAGRDTVGTALSWLFFNLTEHPRVVARIREELEPIASSKA 1268
1267 GGGGMVVFDPEETKPLVYLQAALFESMRLYPPGPIERKATLADDVLPSGHTVRAGDNILI 1088
1087 PVYSMGRMASVWGKDSGEYRPERWVTEDGKLRHVPAHRFMPFNAGPRLCLGKDISVLQMK 908
 907 SVAAAVAWNFDLEVVAGHAVEPKVSIVMQIKNGLMVKVKKR* 782

>aaaa01018418.1 (indica cultivar-group) orth CYP72A22 $F AP002839 100%
2436 MVQVTMILYEVLRLYPPAVTLTRQTYKQIEIGGVTYPAGVIIELPLLLIHSDPDI 2272
2271 WGSDVHKFNPERFAEGISKASKDPGAFLPFSWGPRICIGQNFALLETKMALCMILQH 2101
2100 LELELALSYTHAPQSIITLRPTHGAQIKLR 2011

>aaaa01018574.1 (indica cultivar-group) orth AC119149.2 $F chr 10 99%
1103 SLLLTTVALSVIVCYALVFSRAGKARAPLPLPPGPRGWPVLGNLPQLGGKTHQTLHEMTK 1282
1283 VYGPLIRLRFGSSDVVVAGSAPVAAQFLRTHDANFSSRPRNSGGEHMAYNGRDVVFGPYG 1462
1463 PRWRAMRKICAVNLFSARALDDLRAFREREAVLMVRSLAEASAAPGSSSPAAVVLGKEVN 1642
1643 VCTTNALSRAAVGRRVFAAGAGEGAREFKEIVLEVMEVGGVLNVGDFVPALRWLDPQGVV 1822
1823 ARMKKLHHRFDDMMNAIIAERRAGSLLKPTDSREEGKDLLGLLLAMVQEQEWLAAG 1990
1991 EDDRITDTEIKALI 2032

>aaaa01018882.1 (indica cultivar-group) 91% to AP004139.1 $F
4729 PFWHAVFRDLLGDGIFNSEGETWVTQRKTTALEFTTMAAAAAVA 4598

>aaaa01018916.1 $PI (indica cultivar-group) missing Nterm, inverted seq at end
85% to Nterm of AU172561.1 4 diffs with BI808700.1 95% to AP005254.1a $F chr 8
4748 RRLPPGPTPLPVIGDVLGLRGNMHHALARLARERYGPVMTLKLGLVTAVVVSSPGA 4581
4580 AREAFTRHDRRLAARTVPDISRARGLAGRSMIWLPSSDPRWKTLRGVVAAHVFSPRSLAA 4401
4400 ARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLVSNAFFSGDVVDVGEESAHGLRE 4221
4220 AVEDMISAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYDTVFDILDNITNSRLADASAGNH 4041
4040 AGDFLTPSLGLMSYGKIARDDVTTIMFDVFGAGTDTIAITVQWAMAELLRNPSIMAKART 3861
3860 EMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHQAAEDGVEIGGYAVPKG 3681
3680 STVIFNVWAIMRDPTAWERPDEFMPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAE 3501
3500 RVVPFIL
Inverted sequence orientation
ASLLHAFEWRLPDGMSAEELD

VSEKFTTANVLTVPLKAVPILASSASELQAS* 3321

>aaaa01018940.1 (indica cultivar-group) orth AP004022.1b $F chromosome 2 99% 92A like
880  FLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPHRSIRDLSQRYG 1059
1060 PLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYW 1239
1240 RQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVIS 1419
1420 RMVFGKK 1440
3491 ELITGSTDTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYL 3664
3665 DAVVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVW 3844
3845 GDDAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHG 4024
4025 FAWRLPGGAAAEELSMEEKFGISVSRLVQLKAIP 4126

>aaaa01019060.1 $FI (indica cultivar-group) one stop in exon 2
4042 MASLATVPNLPLLLLLHYALATFTASRARKNNKDRLPPSPLALLVIGHLLHLMGSLPRTSPSAASPHG 3839
3838 TGPTCSSGLAPCRCSLRRRRVPAAEAILRTHDHVFASRPRTVLLANIVFYRSRDVRFAPY 3659
3658 GDHWRQARKLVTTHLLSAKKVRSLRLAREEE (0) 3584
2413 VSLVMTKISKAATASAVVDIGQILRSFTNDMICRTVSGKCPRDDR*KRIFQELANETSLL 2234
2233 LGGFDIEEYFPVLARVGLVGKMMCLKAERLKKRWDELLEELINDHENDDHSCNLISDQND 2054
2053 EDFVDILLSVRQEYGFTREHVKAIL (0) 1979
1622 DVFFGGIDTSALVLEFTIAELMQRPRMLKKLQDEVRACIPKGQKIVSEVDINNMAYLRAV 1443
1442 IKEGIRLHPVAPVLAPHISMDDCNIDGYMIPSGTRVLVNVWAIGRDPRFWEDAEEFVPER 1263
1262 FIDSMSSAAANVNFTENDYQYLPFGYGRRMXPGMKFGIAVVEIMLANLMWKFDWTLPPG 1086
1085 TEIDMSEVFGLSVHRKEKLLLVPNNMSSC* 996

>aaaa01019517.1 (indica cultivar-group) ortholog to AQ869312.1
47% to 76C2 78% to AC078944.5 
4547 ALLPWLPWLLAALLSVYLLDLLAHSRRRLPPGPRPLPLIGSLHLLGDRPHRSL  (fs)
4373 PHHSLAGLAKKYGPLMSLRLGAVTTVVASSPEVAREFLQKHDAVFATRSTPDATGD 4206
4205 HARNSVAWLPPGPRWRELRKIMATELFSTRRLDALHELRQEKVAELVDHVARLARDGTAV 4026
4025 DIGRVAFTTSLNLVARTIFSHDLTSLDDHGASKEFQRLITDVMEAVGSPNLSDFFPALAA 3846
3845 VDLQGWRRRLSGLFARLHRLFDAEMDHRRLHGMKEKDGDFLEVLLRLAARDDDTARLDGD 3666
3665 TLRSLFT (0?) 3645
2339 DLFTAGSDTSSSTVEWAMAELLQNPISMAKLCDELRRVVGSRRRIEESEIGQLPYLQAVI 2160
2159 KETFRLHSPAPLLLPRQATRTIQIMGYTIPKGTRVLINVWAMGRDEDIWPEAGKFMPERF 1980
1979 LERTIDYKGGDLELIPFGAGRRICPGMPLAVRMVHVLLASLLIHFKWRLPAEVEGNRIDM 1800
1799 TEKFGVTLAKANHLCAMAAPT* 1734

>aaaa01019610.1 $FI (indica cultivar-group) orth CYP98A4 AC108505.1 $F chr 5 100%
4141 MDVASLLPFALALVAIPISLALLDRLRLGR
4051 IPPGPRPWPMVGNLWQIKPVRCRGFLEWAERYGPIVSVWFGSSLNVVVSTSELAKEVLKE 3872
3871 NDQLLADRPRNRSTQRFSRNGMDLIWADYGPHYIKVRKLCNLELFTPKRLEALRPIREDE 3692
3691 VTAMVESVHRAVTQP 3647
2059 GSEHKPIVVRNHLAMVAFNNITRLAFGKRFMNANGDIDEQGREFKTIVNNGIKIGASLSV 1880
1879 AEYIWYLRWLCPLNEELYKTHNERRDRLTKKIIDEHAKALKESGAKQHFVDALFTLREQY 
1699 DLSDDTVIGLLW 1664
 977 DMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMSETDFQSLPY 807
 806 LNAVVKESLRLHPPTPLMLPHKASTNVKIGGYNIPKGANVMVNVWAIARDPKVWSNPLEY 627
 626 RPERFIEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHQFEWSLPEGTRP 447
 446 EDVNMMESNGVVTFMSTSLQVIAKPRLDNPDLYKRFPVEM 327

>aaaa01019769.1 (indica cultivar-group) orth AC074232.2a $F chromosome 10 100%
2785 KGSFNHGNMSDLFGDGIFAVDGDKWKQQRKIASYDFTTRALR 2660
2484 LQGFLMRATMDSIFTIAFGQDLNTLDGSGEGRRFAAAFDDASEFTMLRYLNPFWKLSR 2311
2310 LLNVGAEAMLKERIKVVDGFVYKLIRDRSDELSNTKAHD 2185
2090 ILTRFIQATTSDSGTVDYKYLRDIILNIVIAGKDTTAGSLAWFLYMMCKHPEVQEKICH 1911
1910 EAMEATNAGEAASIDEFSQSLTDEALNKMHYLHAALTETLRLYPA 1755
1681 DNKQCFSDDVLPNGFNVSKGDIVFYIPYAMGRMESLWGKDAESFRPERWL 1502
1501 DENGVFQQESPFKFTAFQA 1331
1330 GPRICLGKDFAYRQMKIFAAVLLRFFVLKLRDEKEIISYRTMITLSVDQGLHLTAMAR 1157

>aaaa01019878.1 (indica cultivar-group) orth AC104708.1b $F 72A like seq 2 diffs
3434 EEIIDECKTFYFTGKETTANLLTWATLLLALHQEWQNKARDEVLQACGKSEHPNTENLSN 3613
3614 LKIVNMVLKETLRLYPPAMFLNRMV 3790
3791 NRDVKLGKLDIPAGTQLHFPILDIHHDVNIWGTNADEFAPSRFAEGKSYHLGAYF 3955
3956 PFGIGPTICVGQNLTMVEEKVALAMILQRFALALSPSYVHAPMHGVTLQPQYGAQVLAH 4132
4133 K 4135

>aaaa01019887.1 $FI ortholog of AC068924.9f 97% 14 diffs
2919 MANVDASQWLMLLLAFLVALFILLSLRGGGERKCGGRGRVPPGPLAVPVLGTLLWLSHSS 2740
2739 ADLEPLLRRLVARYGPVVSLRVGSHLSIFVADRRVAHAALVARGAALADRPEVTRALLGE 2560
2559 NGNTITRGNYGPTWRLLRRNLVAETLHPSRARAAFAPARSWARRALVDGLVGGGAVLADA 2380
2379 FRHAMFCLLVLMCFGEWLDEAAVRAIGDAQHGWLLHYATKMKVFAFCPAVTKHIFRGRIQ 2200
2199 TSLALRRRQKELFMPLISARRERKNQLVERAVPEKETTTFEHSYADTLLDIKLPEDGGDR 2020
2019 ALTDDEMVRLCSEFLDAGTDTMSTTLQWIMAELVKNPTIQSKLHDEIKSKTSDDHDEITE 1840
1839 DDTHKMPYLKAVILEGLRKHPPGHFALPHKAAEDMEVGGYLIPKGATVNFMVAEMGRDER 1660
1659 EWENPMQFMPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLNTAMLHLEYFVANMV 1480
1479 WEFEWREIAGEEVDFAEKLEFTTVMAKPLRAQLVRRRMN 1363

>aaaa01020350.1 (indica cultivar-group) orth AP004591.1 $F chr 8 99%
3627 QDMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDGVVGRGRMVAESDLGQLTYLR 3454
3453 CVVRESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINTHALGRNTRIWDDVDAFRP 3274
3273 ERHLPAAADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFDWSPPD 3094
3093 GLRPDDIDTQEVYGMTMPKAKPLVAV 3016

>aaaa01020516.1 (indica cultivar-group) orth AP003571.1c $F chr 6 95%
3   IVFAPYGDYWRQLRKITVTELLSARRVASFRAIREEEVAAMLRAVAASAAAGRAVEMRPL 182
183 LSALVSDSTVRAVMGDQFPHRDVFLRELDRSIELVAGFNPADLWPSSRLAGCLT 344
345 GTMRQAKKCWDTMSSVLESTIQEHLQKNGSSGGGAGATDEDLIDVLLRIQKEGGLQFP 518
519 FDMDVIKSVI 548

>aaaa01020842.1 (indica cultivar-group) orth AP004591.1 $F chr 8 100%
2410 FLLSIILCSWIFVVVSWKKLNCMRRRLPPGPPRWPIFGNLLQLSPLPHKDFARFCTKYGP 2231
2230 LVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWK 2051
2050 RMRRVCMEHLLTTKRLESFAAHRALEAEHLCQFVWAKAQSGKPVNLREVLGAFSMNNVTR 1871
1870 MLLGKQYFGLQSAGPGEAMEFMHITHELFWLLGLIYLGDYLPAWRWLDPYGCEKKMR 1700
1699 EVEKKVDDFHQKIIDEHRKAREAKKSASLDDDNKEDMDFVDVLL 1568
875 DMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDGVVGRGRMVAESDLGQLTYLR 702
701 CVVRESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINTHALGRNTRIWDDVDAFRP 522
521 ERHLPAAADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFDWSPPD 342
341 GLRPDDIDTQEVYGMTMPKAKPLVAV 264

>aaaa01020908.1 (indica cultivar-group) 71% to aaaa01022933.1 $FI
2139 LPSIAANLHNLHDHLAGVLAASGHTVMARGTAATSSIRFFITCDPENVRHIFTSNH 2306
2307 GNYPKGHEFAEIFDIMAGVSFTLDGEPYLRLRAKMLSILGDPRLVASMAASCLDKVRDG 2483
2484 VLPFLARVATAGAPFDMQD 2540
2908 ARNADADADSXDIISSHINDPEYKGAALLQTTAIAYMVAGRDTIGTTLPWFFYNLA 3075
3076 VNPRVVSGIREELKPIAASRRAASPSPSPSNGDRTTTVMFSPEDTKPLVYLQAALFETLR 3255
3256 LYPPGHMERKTAVADDVMPSGHEVRAGDAVLISLYSMGRMESLWGKDCREYRPERWLTGG 3435
3436 DGGGSGGAQLRHVPSHKFLAFNSGARMCPGKSIAVMLMKTIAAAVVWNFDVEMVEGQAVE 3615
3616 PKMSCLFQMKNGL 3654

>aaaa01021177.1 $FI (indica cultivar-group) ortholog to AC120537.1c
AAAA01039974.1 (indica cultivar-group) Nterm 132 aa
396 MEMTLPLLGAAVVLAAFLLFFLVKNNRCCWSPAAERRLRLPPGPWRLPLVGSLHHVLLSR 217
216 HGDLPHRALRELAGRYGALMLLRFGAVPTLVVSSAEAAREVLKTHDACFASRHMTPTLAV 37
36  FTRGGRDILF 7
3930 SPYGDLWRQLRRICVLELFSARRVQSLRHVREDEAARLVRAVAEECAIGGGGGAVVPIGD 3751
3750 MMSRMVNDSVVRSAIGGRCARRDEFLRELEVSVRLTGGFNLADLYPSSSLARWLSGALRE 3571
3570 TEQCNRRVRAIMDDIIRERAAGKDDGDGEDDLLGVLLRLQKNGGVQCPLTTDM 3412
3411 IATVIM (0) 3394
2892 EIFSAGSETASTTLEWAISELVRNPKVMDKAQSEVRKLFEGQDNLTEDDMSRLSYLHLVI 2713
2712 RETLRLHAPAPFLLPRECREQCNVMGYDITEGTRVLVNAWAIARDTRYWEDPEIFKPERF 2533
2532 NANLVDFKGNYFEYIPFGSGRRVCPGITLGLTSMELVLASLLYYFDWELPGGKRCEEIDM 2353
2352 SEAFGITVRRKSKLVLHATPRVPCLH* 2272

>aaaa01021346.1 (indica cultivar-group) orth AP003571.1c $F chr 6 98% 1 diff
158 LPPGPWQLPIIGSLHHLVGKLPHQAMRDLARRHGPVMMLRLGEVPTLVVSS 6

>aaaa01021379.1 (indica cultivar-group) orth AC093612.15 $P chr 10 97%
CYP98A
2574 GEEGKPMVMRKHLSMVAFNNITRLTFGKRFIDAAGELDEQGSELKAIVNNGIKIGASLTI 2395
2394 AEHIRVLRWLNPVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFVDALFTLRDKY 2215
2214 DLSDDTVIGLLWDMITAGTDTTVITVEWAMAELARNPRVQMKAQEELDRVIGRGRVMLEA 2035
2034 DIPNLPYLQAVVKESFRLHPPTPLMLPHKASTSVKIAGYDVPKDASVVVNVWAVARDPGV 1855
1854 WDNPLEYRPERFLEESIDIKGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQFTWA 1675
1674 LPDGTRPEDLDMMESPGLVTFMATPLQVVAMPRLDKEELFKRVPVDM 1534

>aaaa01021406.1 (indica cultivar-group) ortholog of AU070007 (1 diff)
runs off end 53% to 77A4
AAAA01011465.1 (indica cultivar-group) Cterm of CYP77A 
2975 MQPTWLATMPAASSLVVGVAFTAAVAVAVAAAVARRAWRHRGLRLPPGPPSWPVVGNLLQ 3154
3155 VVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESP 3334
3335 IRSIFSSGKFTVNSAVYGPEWRSLRRNMVSGMLSAARLREFRPARLRAMERFVARVRAEA 3514
3515 AASRDGASVWVLRNVRFAMFCVLLDMTFGLLDLDEELVVRVDAVMKRVVLAVAARIDDYL 3694
3695 PFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPY 3853
aa 294-338 missing
8908 LARVMDNPSIQARLHGEIMQRVGDARPVDDRDTDGMPYLQAFVKELLRKHPPTYFALSHA 8729
8728 AVEPGSKLAGYDVPVDANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVR 8549
8548 MIPFSAGRRICPGVGMGTAHIALMVARMVQAFEWRAHPSQPPLDFEDKVEFTVVMKRPLL 8369
8368 AMVTPRKLSF* 8336

>aaaa01021677.1 (indica cultivar-group) orth AC084319 $F 99%
841 QDTFVGGITTTSVTLHWAMSELIRNPRVMKKAQDEIRAVVGEKERVQHHDMPKLKYLK 668
667 MVVKETFRLHPPATLLVPRETTRHFKVGGYDIPEKTKVIVNEWAIGRDPNIWKDPEEFIP 488
487 ERFEEMDIDFNGAHFELVPFGSGRRICPGLAMGVANIEFILASMLFCFDWELPHGVRKED 308
307 IDMEEAGKLTFHKKIPLLLVP 245

>aaaa01021750.1 (indica cultivar-group) orth to AC107226.1 $F chromosome 3 100%
521 LPRRPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRAERYGSTVVRINVPPGPFMARDP 700
701 RVVALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSLTGGYRVCAYLDPSEPNHAKIKQLL 880
881 LSLLVSRKDAFVPVFRSNFGALLDTVESQLASGGGKSDFTALNDATSFEFIGEAYFGVRP 1060
1061SASSSLGTGGPTKAALWLLWQLAPLTTLGLPMIIEDPLLHTLPLPPFLISSDYKALYAYF 1240
1241AAAASQALDAAEGLGLSREEACHNLLFATVFNSYGGFKLLLPQILSRVAQAGEKLHERLA 1420
1421AEIRSAVADAGGNVTLAALEKMELTRSVVWEALRLDPPVRFQYGRAKADLEIESHDASFA 1600
1601IKKGEMLFGYQPCATRDPRVFGATAREFVGDRFVGEEGRKLLQYVYWSNGRETENPSVDN 1780
1781KQCPGKNLVVLVGRLLLVELFLRYDTFTAEAGKKVVITGVTKAS 1912

>aaaa01021848.1 (indica cultivar-group) 57% to 90A1 see AAAA01015179.1
2015 RARMPPGSTGLPLIGETLRLISAYKTPNPEPFIDERVARHGGVFTTHVFGERTVFSADPA 1836
1835 FNRLLLAAEGRAVHSSYPSSIATLLGARSLLLTRGAAHKRLHSLTLTRLGRPASPPLLAH 1656
1655 IDRLVLATMRQWEPAATVRLMDEAKKITFNLTVKQLVSIEPGPWTESLRREYVKLIDGFF 1476
1475 SIPFPLACLLPFTTYGQALK
     FLQARKKVAGALREVIKKRMEEKAENGGSIGDDEGKKEKKDMVEELLQAEGGSFSEEE 1116
1115 MVDFCLSLLVAGYETTSVLMTLAVKFLTETPAALAEL 1005

>aaaa01022265.1 (indica cultivar-group) orth AC097276.6 chr 3 99%
3584 GTDTVAILLEWVLARMALHPDVQAKAQAEIDAAAVSGDAAALPYLHCVVKEC 3429
3428 LRMHPPGPLLSWARLATRDAHLDLGADAGGRAALVPAGTTAVVNMWAIARDGGLWRDPGV 3249
3248 FRPERFLGDGEAAGVGVAGGAGGYDLRLAPFGAGRRACPGRALAMATVHLWLAQLLRSFR 3069
3068 WVPSGDRGVDMSERLGMSLEMEKPL 2994

>aaaa01022495.1 (indica cultivar-group) 52% to AC118132.1 $F  
1275 IYYYHLQTKKASASEPTEWPVLGHLFGMFANIHRFHDWATDILAGGWHNFE 1427
1428 ARAGLTGIRFFITCDPSNVRHIFTSNFANYPKGDEYAEIFDVLGNGIFNADGESWRSQR 1604
1605 AKAQMLMAGARFRAFAARSSRDKAEKSLLPLLAHAADTGARCDLHDLFLRLTFDVTCTLV 1784
1785 FGVDTGCLSAGLPVIPFARAMDDVLETLFLRHIIPMSCWKLMYRLEVGTERKMAVARRTI 1964
1965 DRFVAETIAKRRADMIRQGTSNSDDLLSSFISHDDDDTSNGNDVVDETDEFLRDTTVNLL 2144
2145 LAGRDTTGAALSWFFYILSKNPRVEQKLLEELAPIAAQKGGDGGGMVIFDASELKNL 2315
2316 VYLQAALSECLRLYPSVP 2369
2384 VAADDVLPSGHEMKAGDKVLVFSYSMGRMEGVWGKDCTEFLPERWITSEGKLRYEPSY 2557
2558 KFFSFNAGPRTCLGKELAFVQLKTVAAAVMWNFAVEVVPGHAVEPKLSIILHMKNGLAVT 2737
2738 VKRR 2749

>aaaa01022933.1 $FI (indica cultivar-group) 96A like ortholog of D46472
AAAA01066972.1 (100%) AAAA01040384.1 (4 diffs) 38% to 96A9
1337 MASLTPSLQDL
1370 LVSSLMILLVLLYIAYWRSKYQSLFPVDWPIVGLLPTLVANLHRLHDKITEYLAASGHS 1546
1547 FTGNGPAASNMRLFVTCDPDNVRHIFTTNHDNYPKGHEFAEIFDIMAGAFFTMDGELYRR 1726
1727 QRAKTHSILSDPRMVASMASSCADKVRDGLLPLLTSMASTRTPFELQDLATRLMFDVTAM 1906
1907 PVFGVDPGRLSPDMPSMHVSAAMDTIMEVGLFRHTVPPSCWKAMRRLKIGPERKLAAAHA 2086
2087 ALHVFVSEMMEKARKQEAAPSSMSMDVLSSYINDPDYVGLLHSIL 2221
2222 ITYMVAGRDTVGTTLPWFFYNLAMNPRVVSGIREELAHNIATSTCNGDGAPVMFSPEDTK 2401
2402 SLVYLHAALFETLRLYPPGWIERKTVVADDVMPSGHEVRAGDAVLISIYSMGRMESLWGE 2581
2582 DCRVYRPERWLYDSRGGRKMRHVPSHKFLSFNSGPRMCPGKNIAVMQMKIIAAAVVWNFD 2761
2762 LEVVEGQAVVPKLSCLLQMKNGVMVKVKKRAV* 2860

>aaaa01022934.1 (indica cultivar-group) orth AC105364.1 $F chr 3 100%
2179 PLVGHLPQFLANRHRILDWMTEVLSRQPTRTFVLRRPGGVRGVITANPANVERFLRSGF 2003
2002 DNYPKGERFASLLHDFLGRGIFNADGEAWRSQRKAASYEFNTRSLRAFVARCVHGELH 1829
1828 GRLLPLLRRAAAEGRAIDLQDALERFAFDNICRVAFDHDPGQLPDASGGGALAEADDGST 1649
1648 ASGRFADAFRDAANLSAGRFRYAVPWFWRVKKALHIGSERRLRESIAIVHDFADRIIRSR 1469
1468 REEIRAGLEKHDLLSRFMASHDESYTEVALRDVVISFLLAGRETTSSALTWFF 1310
1309 WLLSSRPDVERRIREEVATVRARRGDGDVDRVGFDLDELREMQYVHAAITESMRLYPPVP 1130
1129 VDSLHAQEDDVLPDGTAVEAGWFVAYNSYAMGRMESVWGKDAAEFRAERWLEDAAAATFR 950
949  PESPFRYVSFHGGPRVCLG 893

>aaaa01022983.1 (indica cultivar-group) orth AC068924.9b $F  99%
duplicate of aaaa01024897.1
272 LLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPVVQRLMSRHGPVVSLRF 451
452 GSQLLVFVADRRLAHAALVESGASL 559

>aaaa01023161.1 (indica cultivar-group) ortholog of AC097276.6
AAAA01022265.1 (indica cultivar-group Cterminal missing 5 aa
2560 MVSFSYLDSTFLPLLATTMASPLHACLLLALLFLALAFFHPGGVAWALSSSGGHGAAAIP 2381
2380 GPRGVLLAFAGPNPHRALASLAASTRGATRLMAFSVGLTQFVVASHPDTAREILAGAAFA 2201
2200 DRPVKEAAAELMFHRAMGFAPHGGYWRRLRRLASAHALAPGRLAARRRAIGEETV 2036
2035 RRVAAAMARDGAVGVSRLLHLASLDNVMASVFGVGLGELGAGAVSELEEMVGQGYELLGT 1856
1855 FNWGDHLPLLRLLDVHGVRRKSRALASRVKVFVSKIIEEHQTRRDAKYGGCDGDGDFVDA 1676
1675 LLGLEGEERLEEEDMVAVLW (0) 1616
3584 XXXXXGTDTVAILLEWVLARMALHPDVQAKAQAEIDAAAVSGDAAALPYLHCVVKECLRMHPPGP 3405
3404 LLSWARLATRDAHLDLGADAGGRAALVPAGTTAVVNMWAIARDGGLWRDPGVFRPERFLG 3225
3224 DGEAAGVGVAGGAGGYDLRLAPFGAGRRACPGRALAMATVHLWLAQLLRSFRWVPSGDRG 3045
3044 VDMSERLGMSLEMEKPLICLALPRTSST* 2958

>aaaa01023188.1 (indica cultivar-group) 45% to 72B
2732 KVAGPQLLKGTYLFVPVSTIHHDVAAWGPTARLFDPSRFRDGVAAACKHPQASFMPFGL 2556
2555 SARTCLVQNLALVEVKTLVAAVLGRFEFTLSPEFGLRLRI 2436

>aaaa01023253.1 (indica cultivar-group) orth of AP004090.1 $F chromosome 2
3179 YFAQWGEDGVVDIKYEMGNLILLIANRCLLGKQFGESKLEQVSTLLHELFDNGFHLISLF 3000
2999 FPYLPTPQHRRRDKARAMLGEMIHEAVRSRRNSGVAEDDVLQKFLDSKYINGRCMTENEI 2820
2819 AGLLICMMFAAQHTSSSTSTWTGACLLSHGHRSYLAAAIQEQKRIIQQHGDRINWGILLQ 2640
2639 MTTLTHCIKEALRLHP 2592
2584 LLIRHASKSFSVQTRQGHRYQIPKGHTLATCTTVGNRLPYIYKDPNVYDPSRFGPGR 2414
2412 EEDKVGGKFSYTPFSAGRHVCLGEDFAYMPN*GDMEPFAQGNFDLELISPFPEEEWEKFI 2233
2232 PGPKGKVMVTYKRRRL 2185

>aaaa01023514.1 (indica cultivar-group) orth AC087220.7 $F chr 3, 99%  
614 LLETLRLYNPALFIQRKPTADITVGSLAIPAGVAVYIPVPIMHRDREVWGHDAGEFNP 441
440 LRFRDGAARAAAAAGIPHALLSFSIGPRSCIGQGFAMLEAKVAMAAMLRRLSFRVSPGYV 261
260 HAPVDLITLKPKFGLPVIVR 201

>aaaa01023722.1 $FI (indica cultivar-group
71  MELTTLLLLALISFFFLVKLIARYASPSGRESALRLPPGPSQLPLIGSLHHLLLSRYGDL 250
251 PHRAMRELSLTYGPLMLLRLGAVPTLVVSSAEAAAEVMRAHDAAFAGRHLSATIDILSC 427
428 GGKDIIFGPYTERWRELRKVCALELFNHRRVLSFRPVREDEVGRLLRSVSAASAEGGA 601
602 ACFNLSERICRMTNDSVVRAAFGARCDHRDEFLHELDKAVRLTGGINLADLYPSSRLVRR 781
782 LSAATRDMARCQRNIYRIAESIIRDRDGAPPPERDEEDLLSVLLRLQRSGGLKF 943
944 ALTTEIISTVIF (0) 979
1125 DIFSAGSETSSTTLDWTMSELMKNPRILRKAQSEVRETFKGQDKLTEDDVAKLSYLQLVI 1304
1305 KETLRLHPPAPLLIPRECRETCQVMGYDVPKGTKVFVNVWKIGREGEYWGDGEIFRPERF 1484
1485 ENSTLDFRGADFEFIPFGAGRRMCPGIALGLANMELALASLLYHFDWELPDGIKSEELDM 1664
1665 TEVFGITVRRKSKLWLHAIPRVPYYSTY* 1751

>aaaa01024052.1 (indica cultivar-group) 70% to D48181
1297 QGKLPPGSRGLPILGETLDFFSQSPSLELLGFFKRRLDK 1413

>aaaa01024345.1 (indica cultivar-group) 76% to CYP98A4
1816 MDTPALLPLALALVAIPIVILLFNRIRPGRLPPGPRAWPVVGNLFDIHPVRCRCFMEWAGKYG 1628
1627 PIMTVWLGTSPTVVVSTSELAREVLKNNDQQLADRPRNRSSERFSRGGVDLIWADYGPH 1451
1450 YIKVRKLCNLELFAPRRMEALRPIREDEVTAMVESIYRAITAPGR*YSTMN 1298

>aaaa01024460.1 (indica cultivar-group) 91% to AAAA01023188.1   
2927 DFDMVSRMRTVGMVVQETLRLFPPSSFVVRETFRDMQLGRLLAPKGTYLFVPVSTM 2760
2759 HHDVAAWGPTARLFDPSRFRDGVAAACKHPQASFMPFGLGARPCLGQNLALVEVKTLV 2586
2585 AVVLARFEFTLSPEYRHSPAFRLIIEPEFGLRLRIRRAG 2469

>aaaa01024682.1 (indica cultivar-group) orth of AP004090.1 $F chromosome 2
Nterm join with AAAA01023253.1
1522 LSMAVLFVATKMIQQRPRTLYLYEKENKEEELLLPPVMSVVSVLTAYLPTLIAKGLPAVI 1701
1702 HDLHSRLGSVFTVSVFGLKKVTLLVTAHFFQASESEIRQSNIYKVTVPVFGRGVLY 1869
1870 DVDLATRSRQISFCTDSIKPINLRGHVDSMVHEVE 1974

>aaaa01024897.1 (indica cultivar-group) orth AC068924.9b $F 98%
duplicate of aaaa01022983.1
2436 LLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPVVQRLMSRHGPVVSLRF 2615
2616 GSQLLVFVADRRLAHAALVESGASLADRPSQAASARLVGEGDTMNSRASYGPVWRLLRRN 2795
2796 LVADTLHPSRVHLFAPVRARVRRLLVDRLRE 2888

>aaaa01025086.1 (indica cultivar-group) orth of AP003752.1d $P chr 7 100%
183 PNGVSKEAKNPNALLSFSSGPRSCIGQNFAMLEAKAVITMILQRF 49

>aaaa01025138.1 (indica cultivar-group) 55% to 94B3
699  PRSYPLVGCLLDFYRNRRRLLAWYTGLLAASPSQTIVVDRLGARRTVVTANPAN 860
861  VEHVLRANFGNYPKGKAFTDVLGDLLGGGIFNADGERWFAQRKLVSHEFSARVMREAVGV 1040
1041 ALEREARARLLPALDAAAEGGGGVVVVDVQELLRQFAFNVICRVALGGGGGEVALALPLS 1220
1221 RLAAAFDAAAAISARRGAAPVAAAWKVKRALGVGSERRLREEVKVIRDAIMEFVRDSSSR 1400
1401 RRREQLLAAARGRDDLVSRMAAAGYPDEAICDMVVSFIMAGRDTTSSALTWFFWLMTRHR 1580
1581 DVEREVLDEVDACMGDGGDGGGLAGVDLEGSRRARVLHAVLCETMRLYPPVAWDSK 1748
1749 HAAEDDVLPDGTRVGRGDRVTYFPYGMGRMEAIWGADAGEFRPGRWLAAAAAGGGVSP 1922
1923 FKYPVFQGGPRTCLGKDMAFVQMKFVASAVLRRFELRPVAPEGSPEFVPLLTAHMAGGLK 2102
2103 VTVRRR 2120

>aaaa01025223.1 (indica cultivar-group) orth? AP003571.1g $F chr 6 95%
1835 QRLPPGPWMLPAIGSLHHLAGKLPHRAMRDLARRHGPVMLLRIGEVPTLVVSSRDAAREV 1656
1655 MKTHDTAFATRPLSATLRVLTNGGRDLVFAPYGDYWRQVRKIAVTELLTARRVHSFRSIR 1476
1475 EEEVAAVLRAVAVAAGTVEMRAALSALVSDITARTVFGNRCKDRGEFLFL 1326
1325 LDRTIEFAGGFNPADLWPSSRLAGRLSGVVRRAEECRNSVYKILDGIIQEHQER 1164
1163 TGAGGEDLVDVLLRIQKEGELQFPLAMDDIKSII 1062
991 QDIFSAGSETSATTLAWAMAELIRNPTAMHKATPEVRRAFAAAGAVSEDALGELPYLH 818
817 LVIRETLRLHPPLPLLLPRECREPCRVLGYDVPRGTQVLVNAWAIGRDERCWPGGSPEEF 638
637 RPERF 623
588 RGADFEFLPFGAGRRMCPGMAFGLANVELPLASLLFHFDWEVPGLADPAKLDMTEAFGI 412
411 TARRKADLHLRPCL 370

>aaaa01025351.1 (indica cultivar-group) orth? AC116603.1 $F 94% 2 diffs
2705 LPPGPRPLPLIGSLHLLGDLPHHSLAGLAKKYGPLMSL 2818

>aaaa01025401.1 (indica cultivar-group) orth AP004000.1c $F chr 2 98%
2324 KPRLPPGPWRLPVIGNLHQVAMGGPLVHRTMADLARRLDAPLMSLRLGELRVVVASSADA 2145
2144 AREITKTHDVAFATRPWSPTIRVLMSDGVGLVFAPYGALWRQLRKIAMVELLSARRVQSF 1965
1964 RRIREDEVGRLVADVAAAQPGEAVNVSERITALISDSAVRTIMGDRFEK 1818
917 LFGAGSETSASTLHWAMTELIMNPKVI 837
832 DELSNVIKGKQTISEDDLVELRYLKLVIKETLRLHPVVPLLLPRECRETCEVMGY 659
658 DIPIGTTMLVNVWAIGRDPKYWEDAETFRPERFEDGHIDFKGTDFEFIPFGAGRRKCPGM 479
478 AFAEAIMELVLASLLYHFDWELPDGISPTKVDMMEELGATIRKKNDLYLVPTV 320

>aaaa01025743.1 (indica cultivar-group) orth AP004346.1b $F 99%
1225 FLLLPLVYLLFFKGDGNGGVMDSASAPSPPGPPRQLPVLGNLLQIGSRPHRYFQAVARRY 1404
1405 GPVVQVQLGSIRTVVVHSPEAAKDVLRTNDLQCCSRPSS 1521

>aaaa01025826.1 (indica cultivar-group) orth AC096855.1 $F chr 3 98%
604 YFFFLQSLLLCIAAVALLQLAKVAATMRRRPRTPPGPWRLPVIGSMHHLVNALPHRALRD 783
784 LAGVHGPLMMLRLGETPVVVASSRGAARAVLKTHDANFATRPRLLAGEIVGYGWADILFS 963
964 PSGDYWRKLRQLCAAEILSPKRVLSFRHIREDEVTARVEEIRAAAAPSTPV 1116
1672 DMFAGGTGTSASALEWAMSELMRNPAVMKKLQGQIREAFHGKAVVMEADLQASNLRYL 1851
1852 KLVIKEALRLHPPAPLLVPRESIDTCELDGYTIPAKSRVIVNVWAIGRHPKYWDDAEEFK 2031
2032 PERFDDGAIDFMGGSYKFIPFGSGRRMCPGFNYGLASMELVLVAMLYHFDWSLPVGVKEV 2211
2212 DMEEAPGLGVRRRSPLLL 2265

>aaaa01027238.1 $PI (indica cultivar-group) similar to AP003927.1
note the fs is in the same place  This is a conserved pseudogene 
1448 PLLVPHHARQDTVVTG 1401
seq. gap
1291 RVLVHVRAIAPDPASWPDRTDAFLPERFLPGAGGCDGGVDVHGQHFELLPFGSGRRISPA 1112 
1111 TNLAKKMVALGVASLLQGFAWRLPD (fs) 1037
1035 EDVSMEELVRLSTRRKVPLVTVAEPRLPPHLYAAAAA* 922

>aaaa01027323.1 (indica cultivar-group) orth AL606630.1 $F chromosome 4 100%
1106 PPPPPAEPAVPPRHRGHLHLFKKPLHRALSGLAATHGPVLLLHFGSRAVLHVTDPAVAEE 1285
1286 CLTDHDVTFANRPRLPSSCHLSNGYTTLGSSSYGPNWRNLRRIATVEY 1429

>aaaa01027888.1 (indica cultivar-group) orth AP005285.1 gene 1 $F 100%
2157 AGTETSAAVVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCVVME 1978
1977 TLRLYPPVPLLAHESSADCDVAGFHVRKGTMLLVNTFAIHRDPQVWDEPESFFPDR 1807

>aaaa01027906.1 (indica cultivar-group) orth AP004000.1a $F chr 2 99%
1930 LFGAGSETSANTLQWAMTELIMNPRVMLKAQAELSNVIKGKQTISEDDLVELKYLKLI 1757
1756 IKETLRLHPVVPLLLPRECRETCEVMGYDIPIGITVLVNVWAIGRDPKYWEDAETFIPER 1577
1576 FEDGHIDFKGTNFEFIPFGAGRRMCPGMAFAEVIMELALASLLYHFDWELPDGISPTKMD 1397
1396 MMEELGATIRRKNDLYLIPAV 1334

>aaaa01028263.1 (indica cultivar-group) 73% to AP003866.1
8   GQHTSSSTSTWTGARLLTNPDHLRAAVEEQARLLRRHGGDRVDHAALAAMDTLQRCVKET 187
188 LRLHPPALMLLRHARRSFVVHSEDSGGGEREYEVPEGHTMASPLLLHNALPRVYRDPGE 364
365 FDPGRFGAGREEGAGGLAYTAFGGGRHACVGEAFAYMQIKVIWSHLLRNFELQL 526
    VSPFPETDWTVVMPGPKGKVMVTYKRRKLT*

>aaaa01028453.1 (indica cultivar-group) 66% to 98A3
365 GVTFIDAAGELDEQGCELKA
425 IVKDGIKIGASVPIAEHIPVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERH 595
596 GAKQHFVDALFTLRDQYDLSDDTVIGLLWDMIAAGSDTAVITAEWAMAE 742
743 LARNPRVQAMAQEELDRVVGRGRLMLEVDIPNLPYLQAIVKESLRLHPPAPLMLPHKASA 922
923 GVKIAGYDVPKGANVIVNVWAVGRDPSVWDSPLEYRPERFLEESIDIKGSDYRVVPFGAG 1102
1103RRVCPGAQVGISLVASMIGHLLHQFTWALPDGTRPEDLDMME 1228
SPGLVTFMATPLQVVAMPRLDKEELFKRVPVDIS*

>aaaa01028498.1 (indica cultivar-group) 71% to >aaaa01014333.1
847 FNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFAATGESCNLQDVF 668
667 MRLTFDTTTMVVSGADTGCLAISLPEVAFARAMDDATRVLLVRHIVPLSWWKLVRRLGIG 488
487 YERTMAEALRACDHFVNETIEKRRAEKAKGEADGSADLLSSYINDDDEEENASSSFLRD 311
310 TTMNLISAGRDASAMALSWFFYLLTKNPCVVSKILEELDSVNGITTPDGMVTFDP 146
145 DELRPLVYLHAALSETLRLYPPVPLEHKGVLAADALPSGHDVRPGDKI 2

>aaaa01028537.1 (indica cultivar-group) orth AP003261.1 $P chr 1 98% 1 diff
817 RRLPPGPPGVPVLGALPLVGPAPHADLASLARKYGPIMYLKMGTCGVVAV 668

>aaaa01028620.1 (indica cultivar-group) 65% to CYP711
1050 VVVVVYFYAPWWGVRRVPGPAALPVVGHLPLLAAHGPDVFAVLAQKYGPIF 1205
1345 RFHLGRQPLVIVAEAELCKEVGIRQFKSIANRSLPAPIAGSPLHQKGLFFT 1500
2065 RDARWSAMRNTIISLYQPSHLAGLIPTMHSCVARAADAIAAAEQRDVDFSDL 2220

>aaaa01028711 (indica cultivar-group) orth AL606448.1 $P 
two short pseudogene fragments = D15209
82 AFGDLLGNGIFNSDGETWVAQRKTLA 159
514 STSIKARKLELAAESGKGDASS 577

>aaaa01029060.1 (indica cultivar-group) 82% to D24290 
11  IVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEEFMPE 190
191 RFIGSKIDVKGQDFQLLPFGSGRRMCPGHSLGLKVIQLSLASLLHGFEWRLPDGVSAGEL 370
371 SMEEVFGLSTPRKVPLEVVVKPKLP 445

>aaaa01029515.1 (indica cultivar-group) orth CYP72A19 $F AP002839 chr 1 100%
950 LYEVLRLYPPGIGFVRQTYKEMEIGGVKYPAGVMIELPLLFIHHDPDIWGSDVNE 786
785 FKPERFAEGISRASNDHGAFFPFGWGPRICMGQNFALLEAKMALCMILQRFEFELAP 615
614 SYTHAPHIVLMLRPMHGAPIKLR 546

>aaaa01029883.1 (indica cultivar-group) orth AC074232.2b $F chr 10
1837 KGPLNSEILNDLFGEGIFAVDGEKWKTQRKIASYDFTTRALRDFSSDVFKRNAAKLAGVV 1658
1657 SNHAASNSKCSFLQGLLTRATMDSIFTIAF 1478
1477 GQDLNTLDGSGEGRRFAKAFDDAGEYLLLRYLNPFWKLARLLNVGAEATLKERIKVVD 1304
1303 EFVYKLIRAR
1152 KQRSRDDLLSRFIQATTSDSGTVDYKYLRDIVLNIVIAAKDSTSGSLAWFLYMACKRPEV 973
972  QEKIFDEVMEATNAGDSASIDEFLTSLTDQALNKMHYLHAALTETLRLYPSVP 814
698 KQCFSDDVLPNGFSVSKGDGVFYMPYAMGRMEFLWGKDAEAFRPERWLDEHGVFQQESP 522
521 FKFTAF 504
402 AGPRICIGKDFAYRQMKIFAAVLIRFFVFKLRDKKDNVSYRTAITLAIDQDLHL 241

>aaaa01031277.1 (indica cultivar-group) orth AP003523.1b $F chr 6 99%
1393 LPPGPWRLPFVGSLHHLAVMRPRGVVVHRALAELARRHDAPVMYLRLGELPVVVASSPEA 1572
1573 AREVLKTHDAAFATRAMSVTVRESIGDKVGILFSPYGKKWRQLRGICTLELLSVKRVRSF 1752
1753 RPIREEQVARLVDAIAAGA 1809

>aaaa01032107.1 (indica cultivar-group) orth AP003232.1d $F chr 1 100%
909  ESLHDVITNLVLAGRETTASALTWFFWLVSGRPDVEDNIVREIRAVRRASSSNGVTSGAA 1088
1089 FSPHELRDMHYLHAAITESMRLYPPVSLDTYVCKEEDFLPDGTFVGKGWQVTYCAYAMAR 1268
1269 VEDIWGTDCEEFRPERWLDEAGVFRPESSFKYPVFHGGPRMCLG 1400

>aaaa01032282.1 (indica cultivar-group) orth AP003571.1c $F chromosome 6 100%
297 NVFGAGSETSATTLGWAIAELIRNPMAMKKATAEVRQAFAAAGVVSEAALSELRYL 470
471 HLVIKETLRLHPPGPLLLPRECREQCKVLGYDVPRGTQVLVNVWAIGRDPRYWPGGSPEE 650
651 FRPERFGDGEPAAALDFKGTDYELLPFGAGRRMCPGLAFGLANVELPLASLLFHFDWEVP 830
831 GMADPTKLDMTEAFGIGVRRKADLIIRPIL 920

>aaaa01032609.1 (indica cultivar-group) 70% to AAAA01019060.1
138 VKIVMEKISKAAFAREAVDIGQILCSFTNDLACRVVSRKLVGDDRQKKLLQELVNKTIKL 317
318 LSIFNVEEYFSILARIGVIGKVMCARAERLKKKWDMLLKKLIADHESKCDSYLVCGRNK 
    DDFVDILLSVRKEYGLTEEHVKAILE
1064 DVFIAGTQSSARVIEFTFAELMRKPHMLKKVQDEVRACIPNGQAIVSEVQVNNMTYLRAV 1243
1244 VKEVLRLHPVAPLLATHVSMADCNINGYMIPSGMRVLVNAWAIGRDERFWYDPEKFMPER 1423
1424 FVESVNGSATASVNFWVNNYQYLPFGSGRRMCLGMNFAMAVIEITLANLLWKFDWALP 1597
1598 AHAMEVDMSEEFGLSVRLKEKLLLVPKQHV* 1690

>aaaa01032612.1 (indica cultivar-group) orth AP003571.1c $F chr 6 100%
1464 LPPGPWQLPVIGSLHHLVGKLPHQAMRDLARRHGPVMMLRLGEVPTLVVSSPEAAREVTK 1643
1644 THDVSFATR 1670

>aaaa01032717.1 (indica cultivar-group) orth AC105377.3 $P like 98A3 chr 10 99%
 484 GEEGKPIGVRKHLSMVAFNNITRLTFGKRFIVAAGELDEQGCELKAIVKAGIKIGASLPI 663664     
     AEHILVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFVDALFTLR
 835 DQYDLSDDTVIGLLWDMIAAGSDTAVIMAEWAMAELVRNPRVQMKAQEELDRVIGRGR 1008
1009 VMLEADIPNLPYLQAVVKESFRLHPPTPLMLPHKAS 1116
1101 PTQGQRRVKIAGYDVPKGANVIVNVWAVGRDLSVWDSP 1214
1220 LEYRPERFLEESIDIKGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQLTWALPD 1399
1400 GTWPEDLDMMESPGLVTFMATPLQVVAMPRLDKEELFKRVPVDM 1531

>aaaa01034116.1 (indica cultivar-group) missing some Nterm and Cterm seq.
(partialI) no introns
    TIATAMLTQYARSKSKSTVKPRKIHSLGTK
92  IPIVGDLLESLKHKARHDWISDTSLRFQNEPWQINVPGGAKTIVLSDPATIEDVMVT 262
263 QSDVFVRGVQIRDIMHDLIGDGIANADGEQWFHQRKTAAKFFSARTLRLCMTQ 421
422 TMQRNIEQVHQHLDAQCGTGRLADLTDLFQQFTLQTFLDVGVGIDARIIGKSEPEAFRAL 601
602 DEATILLMRRLALPTFVWKLQRWLNVGREKELKELLVTVRTYVNRLVTQCLSKKNNEA 775
776 GGDDEGEKIRTAVELFVEHSADDKAGLRPRDLVDFLLGFLFAARDTSAVTTMWFFYEL 949
950 GQHPEIEAKIRQELAVKLPQLGVGRGGYITADHVKQLVYLEAVIKETLRFRPAAANTTRL 1129
1130 ANQDTVIDGDIYVRKGEIVNLSTYALARNPRVWGPDAGEFKPERWIDTKTGELLSFPATK 1309
1310 FFSFGAGPRSCLGMKLAMLNLRVLIANLLHRYKFEIDPSCDGRHTAAMVMSPKHSVLA 1483
1484 QGRAGVSFRPPFSQGGATLPNVIEYIALHE 1573

>aaaa01034252.1 (indica cultivar-group) 77% to AP003523.1b
1319 R*VVHRALADLVRRCDDLAPLMYLCLSELRVVVASTPDAAREVLKTHDAAMSTVVSAN 1146
1122 FAPYGKRWRHLRGICTLELLSAKRVRSFRPIREEQDARLVGAVVAAAAPSGESVNVRRLI 943
942  GGPMTDLALRAIMGE 898

>aaaa01034650.1 (indica cultivar-group) 91% to aaaa01000965.1d $PI
598 YAYSMLLILPLILYMSYHLTRTLAEKKPTTHGLKAHPLLGHLPAFVRNSHRFLDWSTEFI 419
418 AGSPEMRIGLWIPGMRSGIVTGNPADVEHILRTNFANYPKGQHAIGMLEDFLGH 257
256 GLFNSDGEQWLWQRKNASYEFSKRSLRKFVVDVVQAEVANRLLPLLRRAAGDGVGGDAVV 77
76  LDLQDVLQRFGFDTICMVAFG 14

>aaaa01034672.1 (indica cultivar-group) 56% to 90A1
1519 RLPPRSTGLPLIGETLRLISAYKTPNPEPFIDDRVARHGSGVFTTHVFGERTVFSADPAF 1340
1339 NRLLLAAEGRAVDCSYPSSITTLLGAHSLLLTKGPAHRRLHTLTLTRLGRPASPPLLAHI 1160
1159 DRLILATMRDWEPAATVRLLDEATKVTFNLTMKQLVSIEPGPWTESIRREYVKLIDGFFS 980
979  IPFPFAYLLPFTTYGQALKARKKVAGAL 800
799  REVIRKRMDDKVGNGGAEGEDEEKREKKDMVQELLEAEDGSFSVEEMVDFCLSLLVAGYE 620
619  TTSVLMTLAVKFLTETPTALAPL 551

>aaaa01034814.1 (indica cultivar-group) 76% to AP004181 $F chromosome 2
811 WLVFQLHPIASKVVKPWPLEDLLLHTFSLPPFLVRRGYATL 689
650 GHPRDVLLDNLVFVAIFNAFGGFKIFLPHIVKWLARASPELHAKLATEVRATVPTGGAHE 471
470 PAG 462
175 LVWEALRMNPPVEFQYGHARRDM 104
102 VVESHDAAYEVRKGEMLFG 43

>aaaa01035499.1 (indica cultivar-group) 53% to AP005114.1b (partialI)
no ortholog in known set 
3   TMPTTIQGYHIPAKTIAFINVWAIGRDPAAWDTPDEFRPERFMGSAVDFRGNDYKFIPFG 182
183 AGRRLCPGIILALPGLEMVIASLLYHFDWELPDGMDVQDLDMAEAPGLTTPPMNPVWLIP 362
363 RCRTI* 380

>aaaa01035549.1 (indica cultivar-group) orth AP003278 $P chr 1
964 EVLRLHPPFIEIGWKTYKEMEIGGVTYPAGVSIKIPVLFIHHDPDSWGSDVHEFKPER 791
790 FSEGISKASKDPGAFLPFGWGPRICIGQNFALLESKMALCLILQRLEFELAPSYTHA 620
619 PHTMVTLHPMHGAQM 575

>aaaa01036102.1 (indica cultivar-group) 76% to aaaa01011417.1
1398 EALFLGGLCLQDLQRRVRQQHDQLWLRLLQPPLCPGWCACSARLGVLRLVCTLGEGA*V 1222
1221 SKARMRADGEPEYLVDYWMQETVRE 1147

>aaaa01038529.1 (indica cultivar-group) 74% to D24290 ortholog of AP005419.1
860  VAILLTTMLFLRAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRYGPL 1036
1037 VYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAYWR 1213
1214 QARRVVLTELFSARRIESYEHIRREEV 1294

>aaaa01039155.1 (indica cultivar-group) 34% to 71B25 Nterm
85  EHPARSLFLLIICIPILYVIGNEYVRYSRRIKGFPGPTNWPLVGNIPDIKVNAAEKYREW 264
265 SKTFGAVYQIQLGNEPVIVVNSAEAAKKI 351

>aaaa01040030.1 (indica cultivar-group) 33% to 94D new family?
190 FVVTLKMMWRHGARVYDWILEHSKLYGGKPWRIQLLGRPVTVIFNSPDVVXDIL 351
352 KTQFEIFDKGEYTSRAAFDVLGNGIFVADGDLWSHQRKTGSHLFSLQMMRESMEES 519
520 VRSHCVLLFERLDTVAANTAAAAGEQANVVEMKRLLDLFTMDVFTKIGFGVDVGGLQGR 696
697 GSHAFLDAFERSSLALLYRFQQPMWLWPLKKKLNIGVERQLKKDMKVINGTISGIITRSM 876
877 EERQRGQAQSDRRDLIALFLDKPPPESLASTSGGMDPALIRDMAMNFIAAGRDTTSQSM 1053
1054AWFLIMMNRYPLVLERVREELDARLPFLRAEKSRIPSMQDVQELVYLEAAIRE 1212
1213SLRLNPS 1233

>aaaa01040160.1 (indica cultivar-group) orth AP003571.1e $F chr 6 96%
667 MQDIFGAGSETSATTLEWVMAELIRNPKAMRKATAEVRRAFAANGVVSESALGKLHYL 840
841 HLVIRETFRLHTPLPLLLPRECREPCRVLGYDVPRGSQVLVNVWAIGRDERYWPGGSPEE 1020
1021FRPERFED 1044
1064 LDFRGADFELLPFGAGRWMCPGFGVRARQRG 1156

>aaaa01040889.1 (indica cultivar-group) orth AL606614.1b $F chr 4 100%
822 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVVAAGDKVREADLPELHY 986
987 LRLVIKETLRLHPAAPLLVPRETTEPFRTAHGVEIPARTRVVVNAMAIHTDPGVWGPDAE 1166
1167RFVPERHRD 1193

>aaaa01041444.1 (indica cultivar-group) orth AP003523.1a $F chr 6 100%
17  EEFRPERFDGGAVDFKGTDFEFVPFGAGRRMCPGVAFAVAIMELGLASLLFHFDWELAGG 196
197 TAAGELDMAEGLGITARRKSDLWL 268

>aaaa01041819.1 (indica cultivar-group) 96% to AAAA01016714.1 $FI
411 AMLVALLTILAAAAAAAVASSSLRRRKNQPPGSLGLPVVGHTLALLRALRSNAAEDWLHR 232
231 RAAAYGPVSTISLFGRPTAFLAGASCNKLLFSSDKLAAMSSASFLRMVARRNI 73

>aaaa01042113.1 (indica cultivar-group) new family ?
59  IPIIGDMLEVKKNLGARHDWIAATSLRFRNEPWRIKAPAAPEMIILSDPATIED 220
221 VMVKQTDVFIKGSLQREITHELFGEGILGVDGEQWYHQRKTAAKFFSARTLRLCMMQTMQ 400
401 RNVEQVYEVLDAQCGTGSLVNLTNLFQQFALQTFLEVGVGIDAPVIGTSEPGAF 562
563 KALEEAVVYIARRRILPRFVWKLQRWLNVGPEKKIKDLMETVHAYVAQLVKKSLSKENGD 742
743 V 745
831 PRDLVDFVLNFVGAARDTSALTTQWLF*RLSKTPGKVEAKDPGGNSLFN 977
978 WRSLASGRGGYITADHVKQLVYLEAVIKETLRLHPAAPTVMRVAEENTVIDGDVFIRKGQ 1157
1158IINMSVY 1178

>aaaa01042159.1 (indica cultivar-group) 60% to AP003434.1b
164 FKLNTKFFLIFLQDIMGAATDTSFVTLEWIMTELIRNTQVMSKLQNEI 21

>aaaa01043764.1 (indica cultivar-group) orth AP004346.1a $F 97%
905 LSAAVLFFFLLPFLYLLFLRGSNGEVRGRQGNSASAPSPPGPCRQLPVLGNLLQIGSRPH 726
725 RYFQAVSRRYGPVVQVQLGGVRTVVVHSPEAAEDVLRTNDVHCCSRP 585

>aaaa01044854.1 (indica cultivar-group) new family? 55% TO AAAA01050446.1
1038 QKPSPENDATVRSAIDLFVEHSDPNKVGLRPQDLVDFMLTFVVAARDTTALTLAWFFYSV 859
858  HKHPEIEAKLRQELGAKLPALGITDKSDYITTDHVKHLVPLEAAIKETLRLYPAGP 691
690  FNVRQAVDDTLVNGDLFLKKDQVVAIPIYAMARNVNVWGPDANEFKPERWIDVETGKLLP 511
510  QPADRFVSFSSGPRMCIGMKLAMTSLRVVTANLLYRFKFEIDPSNDGTYVNSAALAMK 337
336  HNL 328

>aaaa01045745.1 (indica cultivar-group) 64% to AC096855.1 $F
98% to aaaa01006105.1a $FI 2 diffs
2   ESIDTCEIKGYMIPARSRIIVNAWAIGRDPRYWDDAEEFKPKRFEKNMVDFTGSCYEYLP 181
182 FGAGRRMCPGVAYGIPILEMALVQLLYHFDWSLPKGVVDVDMEESSGLGARRKTPLLL 355

>aaaa01045877.1 (indica cultivar-group) 84% to AP003232.1f
1102 KIVHEIHAVRSASISXGMGSTTFSLDELRDMHYLHAAITESMRLYPPVPINARTCKE 932
931  EDSLPDGTFVGKGWHVTYCAYAMGRMEDIWGADCDEFRPERWLGEAG 791
750 FHAGPRMCIGKEMAYIQMKSIVAS 679

>aaaa01048292.1 (indica cultivar-group) ortholog to AP005285.1 gene 1
clone is only 1060 bp long missing N and Cterminals
1   AFADKPRLPSGEILSYEWSTMGTASYGPYWRHIRRITVTELLSAHRVQHFAGVNAREVRA 180
181 MARRLYRRAAAAAASAGGRARVELKSRLFELFMNIMMAMICDRIFYGDGDDEVSEEARWF 360
361 RSVVKETMELSGASTAWDFLPAAARWLFARRLTRRMRELSDSRTRFYQRLITDHRTKEKT 540
541 DDDNSAAGDHSPAPRRRTMIGVLLS
617 LQSKDPDACPDQLIRALCI (0)
    GSLQAGTETSA 796
797 AVVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCVVMETLRLYPP 976
977 VPLLAHESSADCDVAGFHVRKGTMLLVN 1060

>aaaa01048884.1 (indica cultivar-group) orth AP003571.1e $F chr 6 97% 3 diffs
1024 VRLHTPLPLLLPRECREPCRVLGYDVPRGSQVLVNVWAIGRDERYWPGGSPEEFRPERFE 845
844  DGEAAAAVDLRGADFELLPFGAGRRMCPGLAFGLANVELALASLLFHFDWEAPDVADPAE 665
664  FDMTEGFGITARRKANLPLRPTL 596

>aaaa01049788.1 (indica cultivar-group) orth AC074054.1a $F chr 10 98%
5   TIEWAMAELLQNPKSMIQLPEELKGLIGTKTHVAESDISQLPYLQAVIKETLRLHPTV 178
179 PIAFNKAEATVEIQG*KIPQGTTVYVNIWAICRRAKIWDDLDKFMPYRFLGRDINFLGT 355
356 NFEFIPFGAGRRICLGM 406

>aaaa01050076.1 (indica cultivar-group) orth AP005285.1 gene 1 $F 96% 2 diffs
66  VIPFGMGRRGCPGESLAMQMVGLTLGTLIQCFDWERVGEELVDMGESSGITMPKKLPLE 242

>aaaa01050446.1 (indica cultivar-group) new family? 55% TO AAAA01044854.1
23  FFYELGLHPEIEAKIREELALKLPQLGVGRDGYITADHAKQLMYLEAVIKETLRF 187
188 HPAASITTRIANQDTVIGGDVYREVMNLSMYGMARNSRLWGPDAAEFKPERWIDTKT 358
359 GEPLSFPATKFFTFGAGPRSCIGMKLAMLNLRVLTANLLHRYKFEVAPENDGSHISGM 532
533 VLSMKHKLMVKVE 571

>aaaa01050703.1 (indica cultivar-group) orth AU173808.1 100%
127 DFAFLPFGGGPRKCVGDQFALLESTVALALLLQKFDVELRGSPDEVEMVTGATIHTKSGL 306
307 WCRVRRRT 330

>aaaa01051575.1 (indica cultivar-group) 69% to AP004326.2b
855 DVFAAGSETTATATIWAMSELVRTPRLMERAQAEIRQLLQGKTRVAEEDIQGRLPYLQMV 676
675 IKETLRLHPPAPLILPRLCAESTKILGFDVPEGTTVFVNAWALGRDDKSWVDANEFKPER 496
495 FEDDDRVDFSGADFRFIPGGSGRRMCPGLTFGLANIETTLANLLYHFDWKLPGGANPYEL 316
315 DMAESYGITARRTTDLLLEATPYVPHGSVS* 223

>aaaa01053816.1 (indica cultivar-group) 80% to aaaa01014014.1 $FI
978 VVSKILEELDSVNGITTPDGMVTFDPDELRPLVYLHAALSETLRLYPPVPLEHKGVLAAD 799
798 ALPSGHDVRPGDKIVVSLFAMARMEAVWGSDCREFRPERWISKDGKLRYVPSYKFMTFS 622
621 SGPRTCLGKDMAFVQLKAVAAAVVKNFEIEAMPGHVVEPALSIVLHMKNGLMVRVKRR 448

>aaaa01053818.1 (indica cultivar-group) orth AP003571.1b $F chr 6 100%
600 LLTKRSRKATAQRLPPGPWQLPVIGSLHHLAGKLPHHAMRDLARRHGPVMMLRLGEVPTL 779
780 VVSSPEAAQEVMRTHDAVFATRALSATVRAATMGGRDIAFAPYGDRWRQLRKIAATQLLS 959
960 ARRVASF 980

>aaaa01054542.1 (indica cultivar-group) 76% to AP003434.1c $F
96% to aaaa01006398.1d $PI 
581 DMFAAGTDTTTTAMEWAMAELITHRNAMHKVQDEIRAVVGVTGCVTEDH 408
407 IDRLPYLKAVLKETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIGRDPATW 228
227 GEHAEKFIPERFLNNYVDYKGQDYGLVPFGAGRRGCPGMGFAVPTIEMALASLLYISAWE 48
47  TRPVDR 30

>aaaa01057581.1 (indica cultivar-group) orth AP003752.1d $P chromosome 7 1 diff
346 EAKNPNALLSFSSGPRSCIGQNFAMLEAKAVITMILQRFSFTLSP 480

>aaaa01058627.1 (indica cultivar-group) 70% to AL606640.1 $F
747 ILTALLALSIALLLALLHFSWRRRAGAGKNRNHPPVAGTILHQLLNYDRLMDYHTELSRR 568
567 HRTFRILTPTCNDVYTVDPANVEHILKANFSSYGKGALMHGVMEDLLGDGI 415
414 FNVDGAMWRHQRKVASHELSTRVLRDYSSAVFRDTAAELAAIIVAAAGAGEKVDMEDLL 238
237 MRSTLDSILKVGFGVSLGAVFGSGNEEGAAFARAFDDASQQVMYRFIDPLWKVKRLLN 64
63  VLSEADMKRSVRTINDFV 10

>aaaa01059584.1 (indica cultivar-group) 62% to AP004000.1
596 VAAKTRVIINTWAIGRDSIIRENAEEFLPERFIDNGIDYNSKDFSFIPFGAGRRGCPGIAFATRLA 793
794 ELALANLMYHFDWELQEGQDLESFQLVSPSVIQTWGSS 907

>aaaa01060623.1 (indica cultivar-group) 71% to AAAA01034116.1
RRLVPTYVWKLQRWLNIGSEKKIKELMEHVNTYVTEKINQSLSKTNGEASGQGESDSI
RTAIELFVEHSGDDKAGLRPRDLVDFVLNFMVGARDTSAVTTQWLFYELSRHPEIEAKIR
EELASKL
    SQLGVGPDGYITADHVKELVYLEAVIKETLRLHPAAPLLMRVAKQDAV 526
527 VAGDIFIRKGQSVNMSVYAMARNPRVWGPDAAEFKPERWIDATTGTLHSFPATKFFTF 700
701 GAGARACIGMKLAMLNLRVLTANLLLRYKFEIDPANDGSHVSAIVLAMRHELLAKVERV* 880

>aaaa01061925.1 (indica cultivar-group) new family?
842 VGNTRELIKHNHRLYDWLTDLSLEFNGQPFRIEAYGLGYTVMLTSPRHVEAV 687
686 LKTHFDNFEKGAFVNEVLHDLAGQGIFASDGEAWFHQRKTASHLFTMRALRDSMTSLVHK 507
506 HLARLIETLDASAATNTAFDMAASLHDFTLRAFTDMAFGVDLSAIHERDDPQWRAFPAA 330
329 FNAAQRRLSFRLSVPRALWKFQRYWNLAGEATFKQHIKTIHAIVLDVIDKSLAQRQQAGS 150
149 DTSRATPNLVSLFLDNLEHETTGATFDPTYLRDFVVNTMVAGRDTTA 9

>aaaa01062436.1 (indica cultivar-group) 55% to 90D1
865 AVHLNNEHYENARTFNPWRWQ
685 NNKLQNAVGANIFTPFGGGPRLCPGYELARVVVSIFLHHLVTRFR 551

>aaaa01062516.1 (indica cultivar-group) new family?
439 FLAGFDTSSTLLSFLTHELTVNPDIQQKLYEEVRQTFDSLNGQRLTYDVLQKMKYMDACV 618
619 SEALRYWPPAAITDRLCVKEYEYDDGLINFKIEKGQYLFIPIYGLHHDEKYWKNPEVFDP 798
799 ERFSDENKHSINTGAYLPFGIGPRNC 876

>aaaa01063083.1 (indica cultivar-group) orth AP003522.1 $F chr 6 96% 
300 LYGAGASTTAALIEWGMVDLIQNPEVMTKVREELTNVLGDKLVMDESDIARLPYLQAV 127
126 VKETLRLRTVVPLVPRKAELDIEVNGYRFPRG 31

>aaaa01064375.1 (indica cultivar-group) 63% to D46472
605 PVCWPLIGMLPDLLANRHRIHDWITSLLTASQLNFRFTGPPSSNMRLFITCDPAN 769
770 VRHVFTSNFSNYPKGPDFTEIFDIFG 847

>aaaa01065204.1 (indica cultivar-group) exon 3
ortholog of AY022669.1 searched Genbank for extensions
(0) GYFARWGQSGTVNMKQEFEQLVTLIASRCLLGEEVRDKMFDEV
STLLRELNDGMRLVTILFPRLPIPAHRRRDRARARLGEIFSDIVRSRRGSSVGGGGGAPH
DDMLQCLIDARYKDGRATTETEVAGMLVAALFAGQHT

>aaaa01065390.1 (indica cultivar-group) new family? 53% TO AAAA01050446.1
VLPSLGVTKDTFLMADHVHHLVYLEATIHEVLRLYPTAPLVQRAPPQDTIICDDVLIPAD
TTVCLHTYAMGRNPDVWGPDAAEFKPERWIDPTTRELLKFPPTKFAAFSAGPHLCIGMKL
GMLELRVVAANLVHRYAMSLAVPNDGGYLVGITLLMKNPLLVKVRHV*

>aaaa01065746.1 (indica cultivar-group) 84% to D48181
460 FAIPKG*KIMISPSIVHLNPVVYKDPNIFNPWRWKVCK 347

>aaaa01066056.1 (indica cultivar-group) = aaaa01012243.1 $FI Indica rice genome CYP51
 591 DPNHRLIAGAALLVATLAFIKLLLSSAGGGKKRLPPTIPAAPLVGGLLRFMRGPIPM 761
 762 IREEYARLGSVFTVPILRRKITFLI 836

>aaaa01066426.1 (indica cultivar-group) 39% to AP003434.1
803 RKASVRHLLSPPRVRAYRAVREQEVAALLRRVTEQACGGGVVRLSELLSGFAKDVA 636
635 GRIVLGVRAGAGGDGGGWRARMDALLEESNVLLGAFHAGDYVPWLSWVSAVDGT 474
473 DARVRTAFEKIDRILDEIVDAAAARDTPSSSPGPGNGTDGDSDAFIHLLLSLQREGTEEW 294
293 RLTRDNVDLFGAGTEATIIVLEWA 114
113 MAELLRDKGAMGNLQREVRQQQA 45

>aaaa01067145.1 (indica cultivar-group) orth of AC108875.1b $F chromosome 5 1 diff
27  GRTGCVGEGYAYMQIKAIWSHLLRNFELR*LSPLPKSDFTKFVPEPHGELMVSYKRRQL 203

>aaaa01067419.1 (indica cultivar-group) 27% to aaaa01002989.1 $FI
mid up to Ihelix region
810 DHNIHRLRRIPLAKFFSRTMITRLEPDLHADVQKLCDKLLRQSGDNKPFDVTMAYSCFTA 631
630 DAISKYSFGESFGFLDQPGWFPNFREPTASILRPVFVFRFFPWIKAGTGVAKYLV 466
465 AYMPKDIAMFVQTLQIDMPARVQKTKDDLKAGITYERPTIFASLLQSELEIEDKAPQRL 289
288 AEEAAAVVGAGTETTSWALSVITYHLLTKPELLAKLTRELKTTVDDATQLPGWTVLENLP 109
108 YLGAVIQEGLRL 73

>aaaa01067490.1 (indica cultivar-group) orth AP003232.1b $F chr 1 100%
152 RTHGLKSYPVVGTLPHFINNKDRFLEWSTGVMKRSPTHTMSFKELGLTGGVITA 313
314 NPANVEHILKANFGNYPKGELAVSLLEDFLGHGIFNSDGEQWLWQRKAASYEFNKRSLRN 493
494 FVVDTVRFEVVERLLPLLEYAGRHGRTLDVQDVLERFAFDNICRVAFDEDPACLTEESMA 673
674 APQSAEFMRAFNDAQNAILDRFNSPAKSLWRIKKLFNMEPERRMRDSL 817

>aaaa01067877.1 (indica cultivar-group) new family?
31  EDAASLTYLEAVIKESLRLNPAAPLTSRVAIEDTVLTDGTFVPKGVRVVFPTYAAARMPW 210
211 LWGEDAAAFRPDRWIDETMGKLRQVSPCKFLVFHAGPRQCIGQKLAMLEMKIVAVAL 381
382 LTRFELVVKPGQTVTYGRSLTLTMKNPFMVHAERR 486

>aaaa01069231.1 (indica cultivar-group) orth AC068924.9b $F 96%
566 LLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPVVQRLMSRHGPVVSLRF 387
386 GSQLLVFVADRRLAHAALVESGASLADRPSQAASARLVGEGDTMNSRASYGPVWRLLRRN 207
206 LVADTLHPSRVHLFAPVRARVRRLLVDRLREEHGEAEAAAPRSVVETFQYAMSFLLVLMC 27
26  FGEQLDE 6

>aaaa01069756.1 (indica cultivar-group) orth AP005254.1c $F chr 8 100%
364 AQRRLPPGPTPLPVIGNVLSLSGDMHHELARLAREQYGPVMTLKLGLFTAVVVSSPDAAR 543
544 EAFTKHDRRLAARTVPDISRARGLTGRSMIWLPSSDPRWKTLRSAVATHFFSPRSLAAAR 723
724 GVRERK 741

>aaaa01070145.1 (indica cultivar-group) orth CYP72A21 $F AP002839 chr 1, 100%
364 LYEVLRLYPPAITFTRKTYKQMEIGGVTYPAGVIVELPVLLIHHDPNIWGSDAHEFKPD 540
541 RFAEGISKASKNPGAFLPFGWGPRICIGQNFALLEAKMALCMILQCFKLELMPSYTH 711
712 APYSMVTLRPMHGAQIKLR 768

>aaaa01070587.1 (indica cultivar-group) orth AP003990.1e $F chr 2 96%
84  YQVKVSHMLHFGIV*ELFCAGSETSSNAIQWAMSELVRNPRVMEKAQNEVRSILKGKP 257
258 TVTEANMVDLTYVKMIVKETHRLHPVLPLLTPRVCQQTCQIMGYDVPQGSVIFINSWTIM 437
438 RDPKHWDDAETFKPERFEDSEIDLKGTNYEFTPYGAGRRICPGLALAQVSIEFILATLLY 617
618 HFNWELPNGAAPKELDMTEDMGLTIRRKNDLYLLPTL 728

>aaaa01071198.1 (indica cultivar-group) 75% to CYP98A4 AC108505.1 $F
98% to aaaa01024345.1 
363 LPLALALVAIPIAILLFNRIRRGRLPPGPRAWPVVGNLFDIHPVRCRCFMEWAGKYGPII 542
543 TVWLGTSPTVVVSTSELAREVLKNNDQQLADRPRNRSSERFSRGGVDLIWADYGPHYIKV 722
723 RKLCNLELFAPRRMEALRPI 782

>aaaa01076398.1 (indica cultivar-group) orth AP003571.1b $F chromosome 6 99%
725 QLLSARRVASFRAIREEEVATMLRAVAAAAADGRAVEMRAALCVVVADSTARAMVGESCQ 546
545 ERDAFLREIDRSMELVSGFNPEDLWPSSRLAGRLSGAVRKIEASLHTVLGILDRIIQKRL 366
365 QEKIGGAGAAAASEDILDVLLRIHKDGGAGGLQVPLDMDDITLVITVSDQL 213

>aaaa01076605.1 (indica cultivar-group) ortholog of AP005254.1b 100% 
AU172561.1 (1 diff)
423 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALARL 602
603 AGEHGPVMALKLGLVTTVVVSSAGAAREAFTKHDRRLAARAVP 731

>aaaa01077059.1 (indica cultivar-group) new family?
343 LFGRGVVASDGERWVHQRKAGVKFFSARSLRALMHTSMRKNAEQVCDVIANSQRLGEMV 519
520 DLKKLFHEFTLQTFVEMGLGSDLQWIGAADPHPFQHAIDRVSPIITKRFRQPAWMWKFQ 696
697 R 699

>aaaa01078205.1 (indica cultivar-group) new family? 50% TO AAAA01092846.1
677 SALSLSLLAWYATSRAKSTTKINAHKVHTLENRHVLFGDMKEVGENAERLHKWLLERSLH 498
497 FNGEPWRFYLPGIMDTTVITTPELVEEMLATQADIFIRGKVTNDMSEDMLGKSL 336
335 ISSDGPKWYHQRKAVAKFFSARALRKCMQVHMRKNVGQLHGVLDRAALDGTPVDMMPLF 159
158 QDFAMQTFAELALG 117

>aaaa01079567.1 (indica cultivar-group) orth AP003909.1a $F chromosome 8 99%
98% to aaaa01000238.1f $FI
672 DQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLSIQQEYGLTKDNIKANLVVM 511
510 FEAGTDTSYIELEYAMAELIQKPQLMAKLQAEVRGVVPKGQEIVTEEQLGRMPYLKAVI 334
333 KETLRLHPAAPLLVPHVSMVDCNVEGYTIPSGTRVIVNAWAIARDPSYWENAEEFMPERF 154
153 LSNTMAGYNGNNFNFLPFGTGRRICPGMNFAIAAIEVMLASLVYRFDWKL 4

>aaaa01081177.1 (indica cultivar-group) 53% to AAAA01034116.1 39% to 86C3
SDEDKAGMTARDLRDFILQFILGARGTSALSLAWIFLLIAKHPEVEQRIRDEMAVRLPEVMANDEAYVTSDHIQDLVYLEAT 452
451 IKEVLRLYPTIPMNRREAVKDTVIGDGIPVKKGEYVVLHPYAMARLPSLWGPDAAEFKPE 272
271 RWIDPTTGELLKVSSTKFLLFGSGPRTCIGMKLAMLEMRVVTANLIKRYRFSLAQPNDCS 92
91  HIVSMDLMLANPLVMSAKRTTKETPNE* 8

>aaaa01082499.1 (indica cultivar-group) 51% to aaaa01007897.1 $FI
646 IFQDLFVGATDRSSNTIEWALAELLQNSQTMRRPREELRAVISSKSRFDVSIQNINDQK 470
469 F*AVLKETLRLHSVVPML 416

>aaaa01083019.1 (indica cultivar-group) orth AP003571.1c $F chr 6 99%
501 MQNVFGAGSETSATTLGWAIAELIRNPMAMKKATAEVRQAFAAAGVVSEAALSELRYL 328
327 HLVIKETLRLHPPGPLLLPRECREQCKVLGYDVPRGTQVLVNVWAIGRDPRYWPGGSPEE 148
147 FRPERFGDGEPAAA*DFKGTDYELLTFGAGRRMCPGLAFGLANVELPL 4

>aaaa01083800.1 (indica cultivar-group) ortholog of AQ575117.1 100%
MGKRYVQGEVVHEEPGSARTTLAQFKELLEELFF
577 LNGVFNVGDQIPWLEWLDLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDM 398
397 VDVLLRLADDSSLEVKLSRDSIKAFTQ 317

>aaaa01085198.1 (indica cultivar-group) 58% to CYP711
5   HSTTSLKMDLSGSLSIVLGLVAPALQVPARRLLSR 112
112 PATADWRTARANERLRARVGAVVARRERAGGEARRARRDFLSAVLNARDGGSDRMRALLT 291
292 PDYVGALTYEHLLAGSATTAFTLSSAVYLVAGHPGVEAKLLDEVDRFGPPDAVPTADDLE 471
472 HKFPYLDQVI 501

>aaaa01085971.1 (indica cultivar-group) 45% to AC021892.5 48% to 75B1
AAAA01009188.1 (indica cultivar-group)
598 LASLARKYGPVMYLKMGTCGVVVASSPCAARSFLKALDARFANRPAVASAVDITYNYQN 422
421 MVFANYGARWKLMRKLASVHLLGARALADWAAVRRDEARRLLRGVAEASAAGRP 260
10552 YKDMIVSLLTGAGLFNISDFVPALAWLDLQGVQAKLRRIHDQFDVLITKLLADHAATNAD 10373
10372 RARAGRTDFVDRLRAAVGVDDEDGETISEVNIKGLIF 10262
6592 FRPERFMPGGAAERVDPLGNYFELIPFGAGRRICAGKLAGMVFVQYFLGTLLHSFDWR 6419
6418 LPDGEDKVDMSETFGLALPKAVPLRALVTPRLAPAAYA 6305

>aaaa01088222.1  i  not an exact match 64% to AP005114.1b $F
MEENKALLAAVSLSILLVILSKLKSFLATKPKLNLSPGPWTLPVIG
SLHHLVRSPNIYRAMRALAQKHGQLMTLRLGEVQCM

>aaaa01089015.1 (indica cultivar-group) orth? AP005285.1 gene 2 97%
2 diffs/59 aa
375 MVLLLVAAPALLSRLERRRRPPPGPVALPVVGHLHLLRRPLHRTLARLAARHGA 536
537 AAVMGLRFGSRRVAVVSSAPAAEECLGPHDL 629

>aaaa01090268.1 (indica cultivar-group) 66% to 90A1
309 RALMPPGSTGLPLIGETLRLISAYKTPNPEPFIDERVARHGGVFTTHVFGERTVFSADPA 130
129 FNRLLLAAEGRAVHSSYPSSIATLLGARSLLLTRGAAHKRL 7

>aaaa01090721.1 (indica cultivar-group) 55% to AL606640.1
632 AMARMTSVWGDDAEQFNPDRWLDPTSGKLVQVSPFKYPVFLGGPRTCLGMKFALMEMKI 456
455 TLAVLLSRYEL 423

>aaaa01092069.1 (indica cultivar-group) 61% to AC087544.2
AIAMAFRQTSVLTLADLFPSSRLMQALGTAPRKVLACRDKIQRILEQVIQEKAQEMGRGDEATAGNEGFV 414
413 GVLLRLQKEGSTPVQLTNDTI 351
207 DMFSAGSETSSTTLNWCMTELVRSPVVMAKAQAELRDAFKGKNTITENDLEGLSYLKLVI 28
27  KEALRMHAP 1

>aaaa01092197.1 (indica cultivar-group) orth AP003723.1 $F chr 6 100%
585 AWVTENPATWPDPEAWRPERFLEGGEGFDTDITATRALRMMPFGAGRRICPAATLGVLH 409
408 IQLMLANMVREFRWVPPAGEGPPDPTETFAFTVVMKNPL 292

>aaaa01092846.1 (indica cultivar-group) new family? 50% TO AAAA01078205.1
TDLLARQDTAAVAAATLLGGALALYVLQSLASRRTIPNKTKATDKLHLLPTRNAV
LGDLLEFARNAPRLHEWIAETSLAFGGEPWRAHIPGLQTMIVVTTQELVEEVMTTQFDTFQHGES
ANEISESLVGKAIATVDGEMWYHQRKAASRFFTTRSLRTCMTTQMRKNMTQVYNVIDSAT
ARGQAVDMLQLFHEFALQTFTEIGLG

>aaaa01093009.1 (indica cultivar-group) orth AP005254.1b $P chr 8 100%
3   TIAITVEWAMAELLRNPSVMAKARAEMNHVLAGKVKATEMEENDVEKLPYLQAVVKEVMR 182
183 LHPAAPILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPEEFMPERFLDMA 362
363 EEVDFRGKDHKFMPFGTGRRLCPGLSMAKRVVPFILASLLHAFEWRLPAGVTAEALDLSE 542
543 KFTTVNVLVTPIKAIPIL 596

>aaaa01093055.1 (indica cultivar-group) 32% to AAAA01007897.1
1   KIFKKLKDELRTACRTEADLNMDILGSLPYMNACIEEGLRIFPPVPIGLLRTVPKGGSLI 180
181 DGHAVPGGTSVCVSSWGASHSATNFVDPDSFIPERFLDSPECKDKYGKDVKKAAQPFSTG 360
361 PRGCIGRNLTYVELRLILGALLWNFDIEFADG 456
APLWNPKNEFEGLRAYNTWEKSPLMVRLTDIRKTPA*

>aaaa01098934.1 (indica cultivar-group) orth AP003571.1b $F chr 6 99%
131 MQDLFSGGGETVATLLVWAMAELIRNPMAMQKATAEVRRAFALPGVVSEGEGALGELRYL 310
311 HFVIRETFRLHPPGPLLLPRECSEPCQVLGYDVPRGTQVLVNVWAIGRDERCWPAAAGGG 490
491 SPEEFWPERFED 526

>aaaa01098941.1 (indica cultivar-group) 61% to AP004139.1, 59% to 86As
3   VRLYPSLPYNVKNAVEDDHLPDGTFVPAGTDVVYSPWFMGRSESFWGKNALEFRPERWL 179

>aaaa01099164.1 (indica cultivar-group) orth AC068924.9h $P 97%
28  EDGNRALTDKEMVSLCSEFLDAGTDTMSTALQWIMAELVKNPSIQSKLYEEIKATVSDDH 207
208 DEITEEDTKKMPYLKAVILEGLRKHPLGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAE 384
385 MGRDEREWENPMQFMPERFLPGGDGEGVDMTGSKRIRMMPFGVGRRMCAGI 537

>aaaa01101226.1 ortholog of AC068924.9e 95% 7 diffs (short piece = 478 bp)
(partialI)
478 LPWITKHLFRGRLDAWHALLRRQKELFVPLIEARREYKKLASQGLPPARETTFQHSYVDT 299
298 LLDVKIPEEGNRSLTDGEIVTLCSEFPNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEIK 119
118 ATCGGDGELLERSVRDKDNKMPYLNAVVMEGLRKHPPSH 2

>aaaa01101459.1 (indica cultivar-group) orth AP003571.1f $P chr 6 97%
463 LDFRGADFELLPFGXARRMCPGMAFGLANVELPLSSLLFHFDWEVPGMADPTKLDMTEAF 284
283 GITSRRKENLHLRPLL 236

>Oryza sativa allene oxide synthase (AOS) gene, complete cds.AY062258
AC107226.1 $F chromosome 3
MELGVPLPRRPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRA
ERYGSTVVRINVPPGPFMARDPRVVALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSL
TGGYRVCAYLDPSEPNHAKIKQLLLSLLVSRKDAFVPVFRSNFGALLDTVESQLASGG
GKSDFTALNDATSFEFIGEAYFGVRPSASSSLGTGGPTKAALWLLWQLAPLTTLGLPM
IIEDPLLHTLPLPPFLISSDYKALYAYFAAAASQALDAAEGLGLSREEACHNLLFATV
FNSYGGFKLLLPQILSRVAQAGEKLHERLAAEIRSAVADAGGNVTLAALEKMELTRSV
VWEALRLDPPVRFQYGRAKADLEIESHDASFAIKKGEMLFGYQPCATRDPRVFGATAR
EFVGDRFVGEEGRKLLQYVYWSNGRETENPSVDNKQCPGKNLVVLVGRLLLVELFLRY
DTFTAEAGKKVVITGVTKASTSAVNRTA

>zea mays 92A1  AY072297
MEPATWAVFLGIALCAAAALFLSRGRRPVYNPPPGPKPWPIIGN
LNLMGELPHRSMNELSKRYGPLMQLRFGSLPVLVGASVEMAKLFLKTNDAAFSDRPRF
AIGKYTAYDFSDLLWAPSGPYLRQARRICATELFSATRLESFEHIRDEEVRVMLRQLR
QAAGRTVRLRDYLQMLALGVISRIVLGNKYVMEEVADGEGDSAPAITPAEFREMVDEF
FALHGAFNIGDYIPWLDWLDLQGYVARMKRMKARFGRFLERVLDVHNERRLREGGNFV
AKDMLDVLLQLADDTSLEVQLSRDNVKAITQDLIIAGTDSNANTLEWAVSELLKNPKI
LAKAMEELNHVIGPDRLVTESDLPRLPYIEAVLKETMRVHPAAPMLAPHVAREDTSVD
GYDVLAGTVLFINVWAIGRDPGLWDAPEEFRPERFVESKIDVRGHDFQLLPFGSGRRM
CPGINLALKVMALSLANLLHGFEWRLPDGVTAEELSMDEAFKLAVPRKFPLMVVAEPR
LPARLYTGA