Ixodes scapularis JCVI PROTEINS 0.5 (first in list, 133 entries)

Ixodes scapularis VB PROTEINS 0.5

From Fungal P450 Database (second in list, 195 entries)

Wikel strain joint effort by the Broad Institute and the J. Craig Venter Institute (JCVI) Assembly was performed at JCVI and consists of 369,492 scaffolds built from 570,637 contigs with an estimated 3.8x coverage of the assembly.

 

From the combined JCVI and VectorBase sets of sequences.

 

There are 331 sequence pieces, 223 different non-overlapping sequences.

 

Blocks of yellow sequences are adjacent on the same contigs

 

D. Nelson Nov. 2, 2009

 

CYP2 clan (99 sequence pieces, 63 different non-overlapping sequences,  some will join)

 

>&P450_Is127, VBpre_P001765

77% to P450_Is307

MSFLSEKVLFFWDWRWLTTALVFLLSYLVVRFDHKVSKYPKGPFPLPVVGNLLELRNTKELYKAANNWSQKFGDPITLWM

GEKPMVVLNTHKLVKEAFIERRHEFAGRFSTKMAELQRQGNHNIMFEDYNSTWKTLRKLALTAVR

 

>EW883500 EST G894P549RJ1

3 aa diffs to P450_Is127 & = frameshift

MSFLSEKALFFWDWRWLTTALVFL

LSYLVVRFYHKVSKYPKGPFPLPVVGNLLELRNTKELYKAANNWSQKFGDPITLWMGEKP

MVVLNTHKLVKEAFIERRHEFAGRFSTKMAELQRQGNHNIMFEDYNPTWKTLRKLALTAVR

KYAVSDSLENLCCEVVDAYVDSLK &

EGPNIVDSRAPFMYMLYNIIGMSVYGAKFDKESP

 

>&P450_Is154, VBpre_P002090

82% to P450_Is307

WLTTALVFLLSYVVVRFYRKVSKYPKGPLPFPVVGNLLALRNTNQLYKMAENWARQYGDPITFWMGEKPMVVLNTQKVVK

EAFVEKRHEFAGRFSTKMAELQRQGNNNIVMEDYNPTWKALRKVALTAVRKYAVSDSLENLCCEVVDAYVDSLKEGSNVV

DSKAPFLYMLYNIIGMSVYGAKFDKESPELA

 

>EW835101 EST

4 aa diffs to P450_Is307 (first seq)

MSFLSEKALLLWDWRWLTTALVFLFSYVAV

RFYYKVSKYPKGPFPLPVVGNLLGLRNTSELYKATVEWSTKYGDPITLWMGERPMVILNT

QKLVKEAFVERRHEFAGRFPSKMGDLQTQGNHNIIMEDYTPTWKALRKVALTAVRKYAVS

ESLETLCCEVVDAYVDSLKEGPNVVDSKVPFEYTLYNIIGMSVYGAKFDKESPELTKLQA

INR

 

>EW958639 EST

1 aa diffs and two frameshifts to P450_Is307 (first sequence)

MSFLSEKALLLWDWRWLTTALVFLFSYVAVRFYYKVSKYPKGPIPLPVVGNLLGLRNTSELYKATVEWSTKYGDPITLWM

GERPMVIINTQKLVKEAFVERRHEFAGRFPSKMGDLQTQGNHNIIMEDYTPTWKALRKVALTAVRKYAVSESLETLCCEV

VDAYVDSLKEGPNVVDSKVPFEYMLY &

XIIGMSVYGAKFDKESPELTKLQXXX &

REFLRIAPNGLPSDIVPWLGLLYRNRER

 

>EW951039 EST

1 aa diff to P450_Is307 (first seq)

MSFLSEKALLLWDWRWLTTALVFLFSYVAVRFYYKVSKYPKGPIPLPVVGNLLG

LRNTSELYKATVEWSTKYGDPITLWMGERPMVIINTQKLVKEAFVERRHEFAGRFPSKMG

DLQTQGNHNIIMEDYTPTWKALRKVALTAVRKYAVSESLETLCCEVVDAYVDSLKEGPNV

VDSKVPFEYMLYNIIGMSVYGAKFDKESPELTKLQAINREFLRIAPNGLPSDIVPWLGLL

YRNRERKVELLFKEFLEIVDTLYKRAAKSY

 

>&P450_Is132, VBpre_P002091

Same as P450_Is307 (first sequence)

GTGTSMAQLQWLSLIMTRKPEIRERMMTEIETNLGQDRPRLQDREKLPYTQACIMESLRRFPNVPLGLPHNTTCDTEVGG

KFVPKDTGILYNIYAI

 

>&P450_Is177, VBpre_P013577

Same as P450_Is307 (second sequence)

MTPEPHVGEHSSGRIVRNISPRPLFYKAVDRIRRQ SVIGQKESLEFRCAAYALKQFVAGTGDQTNIMSFMSEKVLLFWDW

RWVTTAVVFLLSYVVVRFYHKVFKYPKGPFPLPIVGNLL TLRNINELYEATEAWARKYGDPITLWMGEKPMVVLNTQTLV

KEAFIERRHDFAGRLPTKMGELQTLGNHDIIFEDYNPRWKALRNVALTAVR KYAVSESLDTLCCQVVDAYVDSLKEGPNV

VDSKVPFEYMLYNIIGMSVYGAKFDGESPELAELQAINREFFKVAPNGLPSDIVPWLGLLYRARERKIELLFKKGWKILD

DLYKRASKSYVPG QDRPKLQDREKLPYTQACILESLRMYPNAPLGIPHSTSCDTEV GGKFVPKDTGILYNIYAINHDPNL

WDDPEAFRPERFLDPVTGKVKQELLPQLMTFGLGPRTCPGEKLAHVDMFYVLVRFMQRVEISAPEGKANTAIAPL GSSLF

LIPGEQDVVLTRKD

 

>&P450_Is133, VBpre_P002092

Same as P450_Is307 (third sequence)

FENEGPELARIRRINESVTELAPNGLPSDIVPWLGILLRNREKKIESLYTEFFELIEALYKKAVHCHVPGSIQNFTHSML

AAREEALLQKKCDSQYLTEANMVQILLDVFGASTDTTIGELRWLCLTMTRKPEIQAKIQREIQDYL

 

>&P450_Is134, VBpre_P002093

Same as P450_Is307 (fourth sequence)

LVFLLSFHLVRFYRKVSKYPKGPFPLPLVGNLLSLRGETPLHLKAEQWHRRYGDPFTMWMGEKPMVMLNSYQVLREAFVD

KRHEFAGRFPTKIVALIIKQNTPVNEEAALNISRQTPPTLQDKEKLPFTVACLYETLRFYPILPMGFPHNTACDTHA

 

>P450_Is307, 35669.m000078

at least 4 genes

MSFLSEKALLLWDWRWLTTALVFLFSYVAVRFYYKVSKYPKGPIPLPVVGNLLGLRNTSELYKATVEWSMKYGDPITLWM

GERPMVIINTQKLVKEAFVERRHEFAGRFPSKMGDLQTQGNHNIIMEDYTPTWKALRKVALTAVRKYAVSESLETLCCEV

VDAYVDSLKEGPNVVDSKVPFEYMLYNIIGMSVYGAKFDKESPELTKLQAINREFLRIAPNGLPSDIVPWLGLLYRNRER

KVELLFKEFLEIVDTLYKRAAKSYVPGKIDNFTHSMLAARDEAIEQAKNDAEHLTEANMVQIIIDIFGA GTGTSMAQLQW

LSLIMTRKPEIRERMMTEIETNLGQDRPRLQDREKLPYTQACIMESLRRFPNVPLGLPHNTTCDTEVGGKFVPKDTGILY

NIYAI NHDPNLWDDPEVFRPERFLDPVTGKIKQELLPQLMTFGLGPRTCPGEKLAHVDMFYVFVRFMQRVDISAPEGKAD

AAIKPSVIGQKESLEFRCAAYALKQFVAGTGDQTNI

 

MSFMSEKVLLFWDWRWVTTAVVFLLSYVVVRFYHKVFKYPKGPF

PLPIVGNLLSEYLNPQFNAKLILTEI KYAVSESLDTLCCQVVDAYVDSLKEGPNVVDSKVPFEYMLYNIIGMSVYGAKFD

GESPELAELQAINREFFKVAPNGLPSDIVPWLGLLYRARERKIELLFKKGWKILDDLYKRASKSYVPG GKFVPKDTGILY

NIYAINHDPNLWDDPEAFRPERFLDPVTGKVKQELLPQLMTFGLGPRTCPGEKLAHVDMFYVLVRFMQRVEISAPEGK

ANTAIAPL

VVDAYVDSLEKGPNTVDSKDPFQFIILNIVGTYVFATR FENEGPELARIRRINESVTELAPNGLPSDIVPWLGI

LLRNREKKIESLYTEFFELIEALYKKAVHCHVPGSIQNFTHSMLAAREEALLQKKCDSQYLTEANMVQILLDVFGASTDT

TIGELRWLCLTMTRKPEIQAKIQREIQDYL GQTPPTLQARDKLPYTVACIYDLLTVNDQLPYVWPHLTHLRGKFIPKNTG

LLYNIHAVNHDPALWTDPEVFRPERFLEPRTGKLKLEGQPPLLTFGLGPRTCPGEKLAHLKMFYVLVRLMQRVTFG LRGE

TPLHLKAEQWHRRYGDPFTMWMGEKPMVMLNSYQVLREAFVDKRHEFAGRFPTKI GALQTRSNHGILFEDYNPSFKALKK

VTLTAVRFDKESPEVVRLRQITDRFSEVAPNGLPSDIMPWLGILYRKTEKTIECLFSEFIELIEVLYERAVDSYIPGKFD

KESPEVVRLRQITDRFSEVAPNGLPSDIMPWLGILYRKTEKTIECLFSEFIELIEVLYERAVDSYIPGKRQVIPKNTGIL

YNIHAVNHDPSLWKDPEVFRPERFLDHATGKLNLEGQPPLLTFGLGPRTCPGEKLGHVKMFYVLVRLMQRLSCLRNETKL

YKKAQEWSRQYGDPFTLWMGEKPTVILNSYQVLREAFVDKRHEFAGRFPIKLGALQTQGNHDILFEDYNPTWKALRKVAL

TAVRKYAISESLETLCTEVVDAYVDSLEKGPNTVDSKYPFMFILFNIVGTSVFGTKYGTIH

 

>&P450_Is308, 35669.m000079

MLAAREEALQQEKSDAQYLTEANMVQILIDIFGGATESSIGTMRWLCLTLAQRTDIQTKIQQEIEDNIGSSPPTLKDRER

LPYTVACIYETLRVYPVGPLGFPHNTCCDTQAGGKFIPKDTGVLYNIHAVNHDPALWKDPEVFRPERFLDPVTGKLNLEG

QPQLLSFGLGPRTCPGEKLGQMDMFYVLVRLLQRVSFGVPDGASCTDIKQLASSVFLMPAVQETVLTRMY

 

>&P450_Is309, 35669.m000080

MNLLSEKAFFWDWRWLTTGLVFLLSYHVVRFYRKVSKYPEGPFPLPLVGNILSLRSETQLFKKVGEWSRKHGDPFTLWMG

EKPMVMLSSYPVIKEAFIDKRHDFSGRIQLKLAALRLRGNHGIVFEDYNATWKALRKFALIAVRKYAMNESLETLCTGVV

DAYVESLKKGDNTVDCKESFMFIIFNIIGTSVFGTKYD VVAWSLLFDFFNQMGML SMLVAREEAIGQEKGDAQYLTEGNM

IQVLFDIFAGGTETTIGTLQWLCLKMTREPEIQLKIQKEIEDNLGEAPPTMKDRDKLPYTVACIYETLRFYPVAPVGLPH

KTSCDTEAGGRFIPKDTALLFNVYGANHDPALWEDPDAFKPERFLDPSTGKLNLEGLPPILTFGLGPRTCPGEKLAHMDI

FYVLVRLMQRVSCSVPAATMNKDIKKMDSNLFLVPAAQDIIFTRRD

 

>P450_Is136, VBpre_P002095

Same as P450_Is309, 31% to CYP2B6 human CYP2 clan member

WRWLTTGLVFLLSYHVVRFYRKVSKYPEGPFPLPLVGNILSDETQLFKKVGEWSRKHGDPFTLWMGEKPMVMLSSYPVIK

EAFIDKRHDFSGRIQLKLAALRLRGNHGIVFEDYNATWKALRKFALIAVRKYAMNESLETLCTGVVDAYVESLKKGDNTV

DCKESFMFIIFNIIGTSVFGTKYD KEGPELARLKEINEAFSEEAPNGLPSDVVPWLGILYRKREKKIERLFAEFIDILEG

LYTRALESYVPGTIQNFAQ SMLVAREEAIGQEKGDAQYLTEGNMIQVLFDIFAGGTETTIGTLQWLCLKMTREPEIQLKI

QKEIEDNLGEAPPTMKDRDKLPYTVACIYETLRFYPVAPVGLPHKTSCDTEAGGRFIPKDTALLFNVYGANHDPALWEDP

DAFKPERFLDPSTGKLNLEGLPPILTFGLGPRTCPGEKLAHMDIFYVLVRLMQRVSCSVPAATMNKDIKKMDSNLFLVPA

AQDIIFTRRD

 

>P450_Is135, VBpre_P002094

Same as P450_Is308

TTGNFTHS

MLAAREEALQQEKSDAQYLTEANMVQILIDIFGGATESSIGTMRWLCLTLAQRTDIQTKIQQEIEDNIGSSP

PTLKDRERLPYTVACIYETLRVYPVGPLGFPHNTCCDTQAGGKFIPKDTGVLYNIHAVNHDPALWKDPEVFRPERFLDPV

TGKLNLEGQPQLLSFGLGPRTCPGEKLGQMDMFYVLVRLLQRVSFGVPDGASCTDIKQLASSVFLMPAVQETVLTRMY

 

>&P450_Is296, 35231.m000073

MQDRGKLPYTVACLLETLRMYPIVPLGLPHNTTCNTEVGGQFIPMDTGIFYNIYAMNRDPQLWAEPEVFRPERFLDPVTG

KVNQELLPQLMSFGLGPRTCPGEKLAHVDMFYVLVRFMQRVSCSAPAGKSGSAIAAVNSNLFLCPAEQDIVLTRVY

 

>P450_Is129, VBpre_P001770

Same as P450_Is296

MTRKPEIQERIKEEIERNLGQARPG

MQDRGKLPYTVACLLETLRMYPIVPLGLPHNTTCNTEVGGQFIPMDTGIFYNIYA

MNRDPQLWAEPEVFRPERFLDPVTGKVNQELLPQLMSFGLGPRTCPGEKLAHVDMFYVLVRFMQRVSCSAPAGKSGSAIA

AVNSNLFLCPAEQDIVLTRVY

 

>&P450_Is128, VBpre_P001769

94% to P450_Is296

VRGSIFISQPSETGQVRPG

MQDRGKLPYTVACLLETLRMYPIVPLGLPHNTTCNTEVGGQFIPKDTGIFYNIYTMNRDPQ

LWPEPEVFRPERFLDPVTGKVNQELLPQLMSFGLGPRTCPGEKLAHVDMFYVLVRFMQRVSCSAPAGKSDTPIAAINSNL

FLTPAEQDIVLTRVY

 

>&P450_Is227, 34558.m000012

31% to CYP2J2 human

VKIGTANVVILSDVDHIKKFYSSKSGVVRPSNAILEELRPSTKIVP

GISNLNGEAWTQNRTFILRVFGDLGFGEPSMEDH

IMEELQELVSRISNTTGCLINIKDYITASVSNIIAAVMFGSRFKTGDAEHDYLVKLVRSVLDGSESGLMVDKKPNWLSRV

ATSLQTKAQVNQKSRLMMQDFVKEQITEHK NTLNPDFNRDFIDGYLKKIKESDYKSASHFNENNLLGNAAEFLLTGTGPS

STRIFWFLHICAQNPNSVQNRIQREIDDVVGPHRQPTWEDRKKMPFTMASLKEGLRWKTIGPIGGSRGTLKDTFIGEYLI

PKGTIVLLNLRAVHRNPAYWDNPDEFDATRFMTSDGKLLEKNEDYFIPFGVGRRNCPGQVLGNAQMFLYTTTLLQKFNIF

PEYQDQLESIGSPDLATADPRVQKLRFVPR

 

>P450_Is058, VBpre_P003813

Same as P450_Is227

GISNLNGEAWTQNRTFILRVFGDLGFGEPSMEDHIMEELQELVSRISNTTGCLINIKDYITASVSNIIAAVMFGSRFKTG

DAEHDYLVKLVRSVLDGSESGLMVDKKPNWLSRVATSLQTKAQVNQKSRLMMQDFVKEQITEHKNTLNPDFNRDFIDGYL

KKIKESDYKSASHFNENNLLGNAAEFLLTGTGPSSTRIFWFLHICAQNPNSVQNRIQREIDDVVGPHRQPTWEDRKKMPF

TMASLKEGLRWKTIGPIGGSRGTLKDTFIGEYLIPKGTIVLLNLRAVHRNPAYWDNPDEFDATRFMTSDGKLLEKNEDYF

IPFGVGKRNCPGQVLGNAQMFLYTTTLLQKFNIFPEYQDQLESIGSPDLATADPRVQKLRFVPR

 

>&P450_Is139, VBpre_P013148

66% to P450_Is227

MDDKFTLKKKAQNIGTSKFNGKAWKQNRNFLLTVFEDLGFGKPSIEDHIMEELQELISQLSNTAGCLINVKDYITASVSN

IIAAVMFGSRFETGETTHKCLVKHLKNILDGGEFGLPVETKPKWLSRVMASLRLNKPEGKRESWLAIRELVREKITEHKN

TLNPDWNRDFIDGYLQKMREHHADPTSPFSEENLQEHTAEFLLSGTGPLSMRISWVLHICAHNPNSVQFKIQKEIDDVVG

RHRPPTWEDRKEMPFTLAALKEALRWISVGTIGCSR

 

>&P450_Is089, VBpre_P010580

66% to P450_Is227

GTSKFNGKAWKQNRKFLLSVFEDLGFGKPSIEDHIMAELQELVCQLSNTAGCLINVKDYITASVSNIIAAVMFGSRFDAG

ETKHKCLVKHLKNILDGSEFGLTVETKPKWLSKVMSSLPLNKPEVKRESWLAIRELVREKITEHKNTLNPDFNRDFIDGY

LQKMREHHADPSSPFSEENLQEHTAEFLLSGTGPLSMRIFWVLHICAQNPNSVQSKIQKEIDDVVGRHRPPTWEDRKEMP

FTLASLKEALRWISVGTIGCSRSVPEDTVIGDYFIPRGSIALINVRAVLRNPAYWSNPDDFDPTRFLTNDGDKLVKKGDA

FIPFGVGKRSCPSQSLAIVEMFLYIATLLQKFNVFPEYGDQLVNIGSANATADTFVQRLRFVLR

 

>&P450_Is017, VBpre_P009003

85% to P450_Is227

QNTLNPDFNRDFIDGYIKKIKESDSESASHFNENNLLGSTAEFLLTGTGPPSSQIFWFLPICAQNPNSVQNKIQKEIDDI

VGPHRQPTWKDRKSMPFTMASLKEGLRWKTIGIISGSRGILKDTFIGEYFIPKGTIVFLNLRAVHKNPAYWNNPDEFDPT

RFMTSDGKLLEKNEDCFVPFGVGKRNCPGQVLGNAQLFLYTTTLLQKLNVFPEYQDQLDIIGSVDLAEIDPRVQRLRFVP

R

 

>&P450_Is266, 27977.m000023

MGNDVLCDWKNFIREAAADELASRPPLGGVSEVVQVDESLFRASGSTTVDGFWRGNNVPGCSSDHYRGTKDKGPWIVGLI

WESSGELHLFEVKKRDRRTLHTIKVKNVHPGTTVILNKWKGHNGLWTVHNELGHMVLNHLTVNRSENFVDPETGAHTQMI

KSAWTALKQDFLKRGKGTSNTLHPSHLTWYWWNSINGRTMYRGPFLRLLEVIGQRWLLNRAAEFVADPSVADVAPDMYDV

RALESLLCDTPSALQQRLEYAIMKSMQICTQHCQAVLEGLGKKNSHLASSQIAAATR

GIVNSAGALWREQRAFLHRVFRD

FVPRHGRPGSVALEQKMQVHIGEFLASVDSFEGSSSQVRHSIARAVSSILGSFLMSVTYSSRDSKFEQLLALFEEGFRLL

TLAVPVNFIPALRYVPGSNWAYRRIKRNRRKTADYFRRIADAHRLSYVEGTVRDIVDAYLVQLAHDKARGPPDRDGSSYF

SEEQLVQVLMDIFSAGLETVTSTL

D

DVELAGYHIPADTHVISNLWAIHMDTELWHEPELFNPGRFLVNGRVHKPDFFMPF

SVGRRMCLGNHLTQTEVFLFLSNLVQRYSLELPPGENLPSMDGHVAVSHTPTPFKLKVTPRAPLCKAVA

 

>P450_Is160, VBpre_P007817

Same as P450_Is266

RSSSRCPPGPRGLPLVGFLPFLGKDFHRTLQTLAAVYGPVYQIFLGSKRVVVISDHKLVRRAFSQAAFSGRPDTELTKLL

QGY

GIVNSAGALWREQRAFLHRVFRDFVPRHGRPGSVALEQKMQVHIGEFLASVDSFEGSSSQVRHSIARAVSSILGSFL

MSVTYSSRDSKFEQLLALFEEGFRLLTLAVPVNFIPALRYVPGSNWAYRRIKRNRRKTADYFRRIADAHRLSYVEGTVRD

IVDAYLVQLAHDKARGPPDRDGSSYFSEEQLVQVLMDIFSAGLETVTSTL

EWAILFLVRHPDVQERLLFPGKLSRTREPKSLQKKLIHSTFREPMVRPFFRKHMLLKESQDHPLPRS

DVELAGYHIPADTHVISNLWAIHMDTELWHEPELFNPGRFLVNGR

VHKPDFFMPFSVGRRMCLGNHLTQTEVFLFLSNLVQRYSLELPPGENLPSMDGHVAVSHTPTPFKLKVTPRAPLCKAVA

 

>&P450_Is320, 34890.m000109

VRMGSTDVLVLHDVQSIKEGLNKDEVLARPPYFLLRRMGMDGVITMNGQPWLDNRRFCLHVLRDLGFGRKSMEQHIKEEV

AQLCDVLQSWDGQPKAITDIITSSISNNITALVFGERFHYDDPRRHFLDTRLVQFALNASFVSTLDFLPILRKLVSYVPS

SKIRIAQEQLKDVHDFISEQMRERSNALNANVNKDLMSAYWNKINENNGGNASFNP

QTLTGNALNFFGA

GTHSVRASMLW

HLLNCARDPEGVQRKLQQEVDEVVGRVRAPEWEDRKNMPYTMAVIWEMLRWRTVAPLGIIREAERDTTIGGFHVPAGTVV

MSNVWALHHDPDVWEHPMDFDPTRFLSTDQTKLLPKPAALLPFSTGRRMCPGETLSMMELFIYLATLMQRFTVLPKEGDT

ISMDIFDGFITLPLHTQEIRFVPR

 

>P450_Is021, VBpre_P000673

Same as P450_Is320

MDIILALVAILILSVLLFKNKSKATDKNKILAPGPKGLPILGYMPFIGPTPHVKYKELSKTYGPIVR

VRMGSTDVLVLHD

VQSIKEGLNKDEVLARPPYFLLRRMGMDGVITMNGQPWLDNRRFCLHVLRDLGFGRKSMEQHIKEEVAQLCDVLQSWDGQ

PKAITDIITSSISNNITALVFGERFHYDDPRRHFLDTRLVQFALNASFVSTLDFLPILRKLVSYVPSSKIRIAQEQLKDV

HDFIRQQMRERSNALNANVNKDLMSAYWNKINENNGGNASFNP

LSYFDHETYFCSTWADYMSS

GTHSVRASMLWHLLNCA

RDPEGVQRKLQQEVDEVVGRVRAPEWEDRKNMPYTMAVIWEMLRWRTVAPLGIIREAERDTTIGGFHVPAGTVVMSNVWA

LHHDPDVWEHPMDFDPTRFLSTDQTKLLPKPAALLPFSTGRRMCPGETLSMMELFIYLATLMQRFTVLPKEGDTISMDIF

DGFITLPLHTQEIRFVPR

 

>&P450_Is328, 33939.m000014

35% to CYP392C1

MESEALAPGGIAWEWA

SFVPLFAITAAIIWYIYQSQDNSKLPPGPKGVPLLGYIPFLGKNHHLKFAELAKVYGPIVRFKY

GMVNVVVLNDYASVKKWLTHTAFHSRLRNVFCTNTGLLG-----IGTLNGEAWRTNRRLCLGILRDNGWKQAVMEEQTKEELQYF

CGKLSQYREKPVPIKQLAMTSIANGIMKILMSVSYPFGDPRRVLLDRHMSQVGRAISSCSLIVWAPLWLYSLVGRLPYTS

LHSMRSGFQGIVAFIKERVREHQELLDENSSLDFTDAFLKETCEYRKGPDSHISVKYAAGHVLALLSAGTNPVSSSIVWH

LLNCADKPGLQNKIREEIDRVIGQQRMPAWGDRYNMPFTMACIWETYRWRTMNPIGIPRGCEEDVSID

NYVIPKGTIVLP

NLWAVHMDPTLWKDPEAFDPSRFLTADGSGLIAKPEHLVPFSVGKRMCPGEAASNMQIFLYLTGILQKFIVMPEDGVPVD

LSVDCVTFNSPMMQNLRFIPRS

 

>P450_Is165, VBpre_P002963

Same as P450_Is328

SFVPLFAITAAIIWYIYQSQDNSKLPPGPKGVPLLGYIPFLGKNHHLKFAELAKVYGPIVRFKYGMVNVVVLNDYASVKK

WLTHTAFHSRLRNVFCTNTGLLGTTFAGIGTLNGEAWRTNRRLCLGILRDNGWKQAVMEEQTKEELQYFCGKLSQYREKP

VPIKQLAMTSIANGIMKILMSVSYPFGDPRRVLLDRHMSQVGRAISSCSLIVWAPLWLYSLVGRLPYTSLHSMRSGFQGI

VAFIKERVREHQELLDENSSLDFTDAFLKETCEYRKGPDSHISVKYAAGHVLALLSAGTNPVSSSIVWHLLNCADKPGLQ

NKIREEIDRVIGQQRMPAWGDRYNMPFTMACIWETYRWRTMNPIGIPRGCEEDVSID

 

>&P450_Is164, VBpre_P002959

91% to P450_Is328

LQNKIWEEIDRVIGQQRMPAWGDRYNMPFTMACIWETYRWRTLSPIGIPRNCEEDVSIDNYVIPKGTIVLPNLWAVHMNP

KLWKDPEAFDPSRFLNADGSGLIAKPEHLVPFSVGKRMCPAEAASNIQIFLYLTGILQKFIVMPEDGVAVDLSVDCVVFN

IPKTQNLRFIPRS

 

>&P450_Is176, VBpre_P013575

70% to P450_Is328

VKYGMVNVVVLNDYASVKKWLSHSAFQSRLRNVFCRNTGVLGIATLNGEAWRENRRVCLNILRDNGWKLANMEEQIQEEL

QYLCSKLTKHNGIPVHINQHLKASIEKCIMKMLIGEYYRIGDPRRRLLDKCMSQVGRGLSSCSLVVWAPSWLYTIAGYLP

FSSVHMLRSGYRGVVEFVSEKIREHQEVLDEHTILDFTDAYLKETCEYRKDSNPHISVKYAAGHVVGLMGAGVDPVSNSI

VWHLLNCADKPSLQNRIRQEVDGVIGQRRAPTWQDRYSMPFTMACIWETHRWRTMSPIGIPRG

 

>&P450_Is185, VBpre_P011203

54% to P450_Is328

VQSRIHAEIDRTVGRNRQPAWKDRFEMPFTTASMWEILRWRTEGSLGMPRGVKEDIILGGFIIPKGTVVLPNSRGIKRSP

ELWKRPDDFDPTRFLTPDGAALIKKPEYHLPFSVGKQTISLRSILRLVWRYMHLINGHTFRQMT

 

>&P450_Is218, 23011.m000014

38% to CYP392A20 mite

MEWLSVLYLAVASVLAAYLLAILPRKRTLPRGAKLAPGPSGLPILGHLPFIARSIHEVKCRDWAKTYGPIVRINMCYLDV

VVLNDLESIRDYFCKQEVLNRPSNWLFKLSGIQ GLGLLNGHQWRDNRRFSMHVMRDLGYGKTHMEQHVMEESQYLADKIA

EAKGEPVVLEKYLNPSASNIMSALLFGARYPYEDPRRTLLDNNMARIVSILSSGSVVAFPPAWFHKVAGMVPFLVNGVVR

SITQNLVDFVRREIKQHLDTLEEHTNRDFIDGYLKKITKHKHEPETNYTTDFLVGNIMSFFIAGSNTVAVSIQWHLLNFA

KNPDTLQARVHREIDEVIGRERRPAWDDRHLMPFTIATIWEMYRWRTNSPFGLPRGAEEDTYFGEYFVPKGTVVLSNLWA

VHMDPDVWKNPEEFNPSRFFTEDGSRLAPKPDHLIPFALGKRMCPGETLSTMEIFLFLTTILQRYRVDAEEGREVELACD

GAMSHPIPGQRLRFIAR

 

>P450_Is010, VBpre_P003539

same as P450_Is218, 34% to CYP2U1 human

FVDNHA

GLGLLNGHQWRDNRRFSMHVMRDLGYGKTHMEQHVMEESQYLADKIAEAKGEPVVLEKYLNPSASNIMSALLFG

ARYPYEDPRRTLLDNNMARIVSILSSGSVVAFPPAWFHKVAGMVPFLVNGVVRSITQNLVDFVRREIKQHLDTLEEHTNR

DFIDGYLKKITKHKHEPETNYTTDFLVGNIMSFFIAGSNTVAVSIQWHLLNFAKNPDTLQARVHREIDEVIGRERRPAWD

DRHLMPFTIATIWEMYRWRTNSPFGLPRGAEEDTYFGEYFVPKGTVVLSNLWAVHMDPDVWKNPEEFNPSRFFTEDGSRL

APKPDHLIPFALGKRMCPGETLSTMEIFLFLTTILQRYRVDAEEGREVELACDGAMSHPIPGQRLRFIAR

 

>&P450_Is271, 34517.m000009

41% to CYP392A12, 46% to CYP5147A2  Phanerochaete chrysosporium

AYVPGNIQTFLGAGTNAIQRSLAWILVTCADKPSTVQAKIQQEIDRVVGQERQPIWEDRYQMPFTMATIWEMQRWRPILP

LTLPRATDKDMELGGYVIPKGTIMLANIWAVNMNADLWDDPEKFRPERFIEQGGSKLRPKLDYFIPFSVG

 

>P450_Is078, VBpre_P009077

Same as P450_Is271

MDTFCFFFTGAILILIAYIAWLRFGDFKRPKLSPGPAGCPILGYLPFLGRNHHAMFRDLARTYGPVVRISIGTVSIVAIN

DYQLIKSAFTNSAVQSRIRSLFLELTGFPGVGTLNGQAWRENRQLSMNILRNLGFGKTTLEEVIKDEVSRLTERLAAMNG

KPIIARMEIVTSTSNVFTSLFFGTRHPHDHPTRAALNKLLLLADRVVCTGSLVVFLPNWMFEIAGLMPFTRIYCFKKAFG

GLLGFIRKQVQKHEKMELSDRNQDYIDCYLEHAQQRLENPGSHIQS AYVPGNIQTFLGAGTNAIQRSLAWILVTCADKPS

TVQAKIQQEIDRVVGQERQPIWEDRYQMPFTMATIWEMQRWRPILPLTLPRATDKDMELGGYVIPKGTIMLANIWAVNMN

ADLWDDPEKFRPERFIEQGGSKLRPKLDYFIPFSVG KRMCPGEALAPVEIFLFTTGILQKFTVLPEDGKTIDLTVDSGAF

SSPKYQKLRFVPR

 

>&P450_Is243, 25458.m000013

37% to CYP392E6 mite

TAEYTALLYATGVTALASFLLLFWYQHEGGRPSKVKLPPGPRGLPLLGNVTVSSYDFHYRKCTEWAQKYGPIFRFCIGKV

NVVVLNDFASIKKYLSMEATLIRSQRSIFEGVTMGMTTLSGPAWVENRRFCLRVLKDLGFGKKSMEEHIKEELRYLIARL

VDAKGSP VPIREHLIPSTSNVITALLFGTTYSFDDPKRKYLDKLLARLFKIIMSGSAVDFQPYWLRKIADRIPYTRSYAL

RKASLDLHAFIRERVKEHQETIDPNFHRDFIDGYLNKVTEHQDNPNSHFREAYILGNAIDFFVAGTGTVAASIQWHLFNC

AKNPDTVQAVIQREIDGVIGREREPAWEDRSQMHFTMACIWEMLRWRTVVPLGLPRGTREDTFFDDYFIPKDTVVLANLL

AVHRDPELWERPDEFDPTRFLKKDGTGLVKKPEHLIAFSVGKRMCPAEALTTVEIFLYLTTFLQKFRVLPAEGQQLPNLS

SPALTVAHPSLQRLRFLPR

>P450_Is030, VBpre_P005786

Same as P450_Is243

VPIREHLIPSTSNVITALLFGTTYSFDDPKRKYLDKLLARLFKIIMSGSAVDFQPYWLRKIADRIPYTRSYALRKASLDL

HAFIRERVKEHQETIDPNFHRDFIDGYLNKVTEHQDNPNSHFREAYILGNAIDFFVAGTGTVAASIQWHLFNCAKNPDTV

QAVIQREIDGVIGREREPAWEDRSQMHFTMACIWEMLRWRTVVPLGLPRGTREDTFFDDYFIPKDTVVLANLLAVHRDPE

LWERPDEFDPTRFLKKDGTGLVKKPEHLIAFSVGKRMCPAEALTTVEIFLYLTTFLQKFRVLPAEGQQLPNLSSPALTVA

HPSLQRLRFLPR

 

>&P450_Is015, VBpre_P005174

40% to P450_Is243

KKGGATLPPGPWGIPLLGNLAILRKDFHRKQGIEWAKKYGPVFRIRIGVRNIVLVSDFELIKEILCKKECLFRPQRWVFK

HIGGVGSLNGKAWQENRRYCVKSLRELSSGKKSMLEHVREEFQCLRDKVADARGQPLRMRPLLLPAVANTIAALVLGSRY

ASSDPRLDQLEQHLETFVRIFFSVPPVNPLPSWLDWMSPYIPILGEYKGSKFARDILKFVG

 

>&P450_Is312, 35065.m000009

NEINDRLETVDSDINPHFIKGYLALVTQHNENPKSNINARALHGNMVDILVAGSASVAASILYILLYCAEKPDTVQAKIQ

EEIDRVVGSGRTPTWEDHRFMPYSMAVVWEMSRWKTLTTLDLPREVDEDVFLSGYVIPKGTIVVANFWAAHFDPKYWKNP

EEFDPSRFMTPDGSALLPRPEFLIPFSI

GKRMCPGGALATIQIFLCVTTLLQAFRVLPVEGASYSVGSDLFADLLMQGLCFVPRMPE

 

>P450_Is130, VBpre_P004854

Same as P450_Is312

VKLGVQSMVIVNDFELIKEILCKKECLFRPRTWVFKDVGGIASLNGKAWQENRRYCVKTLRELSSGRKSMLEQVREEFQY

LREKVTETKGHPIMVRPFLLPCVTNNIAALLLGSRYDFNDPRLNRLDTLLEAFLRIFSGVSPVDPLPKCLKWIAPYIHCL

GGGNGLELQQKFFKFIR

NEINDRLETVDSDINPHFIKGYLALVTQHNENPKSNINARALHGNMVDILVAGSASVAASILY

ILLYCAEKPDTVQAKIQEEIDRVVGSGRTPTWEDHRFMPYSMAVVWEMICCANISGTYLTSFRVDEDVFLSGYVIPKGTI

VVANFWAAHFDPKYWKNPEEFDPSRFMTPDGSALLPRPEFLIPFSI

 

>&P450_Is279, 34759.m000141

34% to CYP392D4, 32% to CYP2C8 human

MDIILVLVATLILSALLFKIKSKATDKKRALAPGPTGLPILGYMPFLGPRPHVKYKKLSEVYGPIVRVKMGSVDVLVLHT

VQSIKEGLNKDEVLARPPYFRLRSLGMDGIVTMNGQPWLDNRRFCLHVLRDLGFGRKSMEEHIKEEILQLCDVLRSWDGK

PKAVTDVLTSSVSNNITALLFGERFHYDDPRRHFLDTKAVKFALNASFVSALDFLPSVRNLVSYIPSSKFGISKDVLKSV

HDFISEQVREHSKTLEAVVNTDFIGAYLKKINENNGGNASFNPQTLTGNALNFFGAGTNTVRASMLWHLLNCARDPEGVQ

RKLQQEVDKVVGRVRAPEWEDRHKMPYTMAAVWEMLRWRTVAPLGVIR V

 

>P450_Is047, VBpre_P008490

Same as P450_Is279

MDGIVTMNGQPWLDNRRFCLHVLRDLGFGRKSMEEHIKEEILQLCDVLRSWDGKPKAVTDVLTSSVSNNITALLFGERFH

YDDPRRHFLDTKAVKFALNASFVSALDFLPSVRNLVSYIPSSKFGISKDVLKSVHDFISEQVREHSKTLEAVVNTDFIGA

YLKKINENNGGNASFNPQTLTGNALNFFGAGTNTVRASMLWHLLNCARDPEGVQRKLQQEVDKVVGRVRAPEWEDRHKMP

YTMAAVWEMLRWRTVAPLGVIR

 

>&P450_Is209, 24992.m000015

best match to CYP307A1 mite

ESEAGIVYEERHRGYARGANGAEDHRFVMTFLFGLDGSEGLYITLVSMLVATFCAVLHLRERYYDRRRAPGPKGFPVIGS

SHIIGRYPNVWDAFGDLRRQYGDVFALTLGSKRCLVVSSVEALREVLVAKAADFADRR

 

TRCATTPSSRATGTFVSRCFTTPLAHPCAWVRESV

 

EVQDKIRVEAIRAAGAEGASERVLTLADKPKLSFTESSVYEVIRIVNSPIIPHVCAKDTTVQGFYVP

KGTMVMFNTNDINYSAELWEEPWSFRPERFLNEDGTVSKPRHFFPFGTGKRSCMGDGIVRATLVLGLSTLLRHFRI

TLAEDQKPANFASFRCKV

IFDKDPKLLFDPIS

 

>P450_Is049, VBpre_P004973

Same as P450_Is209

MPWLKIVQNRELCLLKEKSLEIFHFTNAILDARDDEPKAADGPRDLLDVLLISLDAPGSLLNRLDVSIIIEDLIGGHSVI

ANLWVWCLYILASHG

EVQDKIRVEAIRAAGAEGASERVLTLADKPKLSFTESSVYEVIRIVNSPIIPHVCAKDTTVQGFY

VPKGTMVMFNTNDINYSAELWEEPWSFRPERFLNEDGTVSKPRHFFPFGTGKRSCMGDGIVRATLVLGLSTLLRHFRITL

AEDQKPANFASFRCKV

SST

 

>&P450_Is293, 34824.m000012

QYLLGNIAELLLGSASNSPSLIHWLLLVCAQNPDRIQAKIQKEVDDVVGRQRQPTWEDRKAMPFTMASVIEITRWKVILA

IGLPRGVQKDTSIGGHHIPKGTMVLVNVMGVHRNPELWENPNEFDPTRFLVAEGTELSKKPEHHIAFSLG

NAQIFA

 

>P450_Is142, VBpre_P003005

Same as P450_Is293

IPVLHFIFPSILNVSSALLFGTRYALGDPKREHLTKHVEAYVQLFHSGTLIESKPRWLSRLEASLPFTRTGAMRRLRNVL

LDFISGCGRRKNGFRYLSLSYVIKVLLNTVHIYEPKLNYPRT

QYLLGNIAELLLGSASNSPSLIHWLLLVCAQNPDRIQA

KIQKEVDDVVGRQRQPTWEDRKAMPFTMASVIEITRWKVILAIGLPRGVQKDTSIGGHHIPKGTMVLVNVMGVHRNPELW

ENPNEFDPTRFLVAEGTELSKKPEHHIAFSLG

RRKCPGEMLGNVELFLYLATLLQNFSVFPEEGTQLPDLGSLATTCCHPSVKKLRFVPRR

 

>&P450_Is090, VBpre_P010581

81% to P450_Is293

GMANLNGEAWTENRNFSLRVLRDLGFGKTPMEENIKEELLNLINKIEGAKERAVPVFEFILSSTLNVTSLLLFGNKCVLD

DPKRGNLVKHVEKFSELLHFDSIIECKPQWLSRLEASLPFTRTGAMRRTRQVLLDFISFRIERIESSWLRHFKCPPTVAI

RATESASQVSLFICTE RHLLGNTAELFLGAASNAPSLIHWLLLVCAQNPDRLQVRIQKEVDDVVGRHRQPTWEDRKAMPF

TMASVLEITRWKVMIPIGMPRGVQEDTSIGKYFIPKGTMVLANVMGVHRDPELWANPDDFDPTRFLTADRTELSKKPEYH

IAFSLG KRNCPGEMLGNVQMFLYLATLLQKFSVLPVEGRPLPDLGCLTTTCSHPSVKELRFVSRQ

 

>&P450_Is247, 25607.m000009

MSSVSNNITALVFGERYSHDDPRRQFLNPQLKMIARNASFAAAGDFLPAVWKLLSYSSLSKSRLFRQYMDGLVHFIR

KE

VNEHSKTLSANVNRDFIDVYLKKISENKGRNSSFNLHTLIGNVQNLFGAGSNTVSTSIEWILLLCARDPKGVQRRLQQEVD

NVLGRERAPGWEDRHRMPYTMAVIWETLRWRTITPLGLIREAERDTSIGSFHVPAHTAVIFNFWAIHHDPEIWRHPFDFD

PTRFLNADRTRLLPKPAALMPFTAGRRMCPAETLAMMEIFMYLSTLMQTFTVLPKEGETISLEIHQGISTIPLHTQELRF

LPR

 

>P450_Is057, VBpre_P003769

Same as P450_Is247

GIASISGQAWVENRSFMQVLRDLEFGRKSMEDHIKGTTAFCIAELCDVLKSWNSRPAPTADVI

MSSVSNNITALVFGERY

SHDDPRRQFLNPQLKMIARNASFAAAGDFLPAVWKLLSYSSLSKSRLFRQYMDGLVHFIR

Q

VNEHSKTLSANVNRDFIDV

YLKKISENKGRNSSFNLHTLIGNVQNLFGAGSNTVSTSIEWILLLCARDPKGVQRRLQQEVDNVLGRERAPGWEDRHRMP

YTMAVIWETLRWRTITPLGLIREAERDTSIGSFHVPAHTAVIFNFWAIHHDPEIWRHPFDFDPTRFLNADRTRLLPKPAA

LMPFTAGRRMCPAETLAMMEIFMYLSTLMQTFTVLPKEGETISLEIHQGISTIPLHTQELRFLPR

 

>&P450_Is048, VBpre_P008496

75% to P450_Is247

MLDFIRKEADQRSKTLSPDENRDFIDAYLKKINESNGTNESFNLRTLMGNALNLFGAGTNTVRASIEWNLLYCARDPEGV

QRKLQQEVDNIVGRERAPEWEDRHRMPYTMAFIWEMLRWRTPTPLGLIRTAERDTTMGGFHVPAGTVVLSNFWAVHHDPE

VWEHPFDFDPTRFLNADHTVLLPKPAAFIPFSTGRRMCPGETLAIMEIFIYLTTLMQKFTVLPKEGETISMDIHEGITNI

PLYSQELRFLPR

 

>&P450_Is229, 31645.m000008

EDIFLDGYFIPKGTVVLSNVMAMSMNPGHWTRPFQFDPTKFLSPDGSGLIKKPEYLIPFASG

 

>P450_Is189, VBpre_P013319

Same as P450_Is229

YVFRPGRGYESALALAVHTISENLNSGATWEHVQLDFRQAFDNREMQSLVNKIGEAKGSTISVREHLLSISFDVITTVLF

GSTFKLNDHKHRELEKLLCGILQELHVDSFVDFKPVWLSNIMASVPFTKMAAMRNTMRLLREFIRERIKEHRNTPKDATF

DFVDYYLNQIKEHKDDPDSYFRENHLIGCAMDFLVGGVASPPYFANWLLLVCAKSPDTVQSRIQAEIDRVVGSERQPKWS

DRLEMPFTMACTVK

EDIFLDGYFIPKGTVVLSNVMAMSMNPGHWTRPFQFDPTKFLSPDGSGLIKKPEYLIPFASG

KRMCPGEALASVQLFLYTTCLLQKYSVLPEEGQELPCLDSVVT

 

>&P450_Is045, VBpre_P005467

gray = same as P450_Is287

MPSIKQFYCSEDEQGRPVESIFYEVSRGTLGMFNLGGDASTKQRSFSLRVLRDLGFGKTSMEEHIKEELLDFVNGIDGTK

ERGVPVLELILQSLMNVTSALLFGTRYPLGDPKRKYLAKLATDYMQRVHCAPIIQFKPQWLCRFEAKLPFTRTGAMRKCR

LAMIDFIRDQVKQHEDTIQADVTRDFIDGFLKQVEKHRHETNSAFE

VCHLVFNTVELFFGSSSNVPVLMHWLLLVCAQNPERVQARIQKEVDDVVGRDRQPTWEDRK

 

>P450_Is287, 26650.m000013

MVS

VCHLVFNTVELFFGSSSNVPVLMHWLLLVCAQNPERVQARIQKEVDDVVGRDRQPTWEDRK

AMPFTMASVLEITRWKVTEPIGLPRG

 

>&P450_Is087, VBpre_P008294

73% to P450_Is287

GMFTLNGEVWNENRNFTVRVLRNLGYGKTAMEEHIKEELLSLVKQIEEARGRAIPVFELVLSSVLNVTSGILFGIRYPPG

DLKREYLTKHAAGYVEGIHCDPIIEWKPCWLSRLEASLPFTRTGAMRRHRKALADFIRDQVKEHEDTMEADVTRDFIDGY

LKQVEKHQHDPNSAFR VSHLLGNSLELISGSATNTPALIHWLLVVCAHNPDRVQARIQKEVDDVVGRQRQPTWDDRKAMP

FTMASVLEITRWKATTLFPMPRG VQEDTTIGKYVIPKGTMVLINLMGVHKNPDLWENPDRFDPTRFLTADGSELEKKPEH

LIPFSLGKRKCPAEKLGYVEMFLYLSTLLQRFSVFPDKGTVLPDLESPTAPCRDTSLKKLRFVTRP

 

>&P450_Is061, VBpre_P011639

89% to P450_Is287

IPVFELLLQSLLNNISALLLGTRYRLGDPKCKYLAKLAGDFIERIHCAPIIQFKPQWLCRVEARLPFTRTGAMRRCRLAM

IDFIGDQVKQHEDTIQADVTRDFIDAFLKKVEKHRHDPNSAFQ VCHLVGNTVELFFSSSSNLPVMIHWLLLVCAQNPDKV

QARIQKEVDDVVGRDRQPTWEDRKVMPFTMASVLEITRWKVTEPIGMPRG VQEGTSVGKYLIPKGTAVVANVMAVHRDPE

LWENPDQFDPERFLTADGSELSKKPEHYIAFSLGKRICPAENLANIEMFLYLATILQKFSVFPDDGAQLPDLGCISTSWR

HPSVTKLRFVRRR

 

>P450_Is107, VBpre_P005300

Same as P450_Is294

IPVQEFLLPSTSNVITALLFGTTYALDDPRRKRLVQLVSTFVLRAISGPIV

NWMPDWLTEICSALPFSRMGAIRGARQALVAFV

TDRVQEHNLTLQKDINRDFIDGYLKKIKEHHNESNSPFQEKHLLGNAVDFYIAGTSTSASFIHWLLAVCAQKPDTV

QSRIQREIDDHVGRGRQPAWEDSKKMHFTMASVFEILRWKNPLPVTNARGTQEDTILNGYIIPKGTMVISNIMAVHRDPT

LWERPDDFDPTRFLSADGSCPAKRPEEIMTFSVGKRMCPADKLATVEIFLYVASLLQKFTVFPEEGKRLPCLDSLDVMKT

HPAVRNMRFVSR

 

>&P450_Is294, 35737.m000048

MCTTQEELRYLIQHISTASGTA

IPVQEFLLPSTSNVITALLFGTTYALDDPRRKRLVQLVSTFVLRAISGPIVNWMPDWL

TEICSALPFSRMGAIRGARQALVAFVR

 

>&P450_Is295, 35737.m000049

MCTTQEELRYLIQHISMACGTAIPVQEFLLPSTSNVITALLFGTTLALDDPKRKRLIQLVTTYTSLVTSGPIVNWMPDWL

SAIVSALPFSRMGAIRGARQELFQFVRNDDEDGRDTASDVSVTGVEMGLVVKRLRDPVPFPEDPGAEGTEGHLLGNAFDF

YIGGTHTPASFIHWLLAVCAQKQDTVQSRIQREIDDHIGCERQPTWEDSKKMHFTMATPSGQPAMCVHDSWDEGEGRRHL

RSSDGTFGVDRKMQQREGWRAGLKGLWDSTRAVTQGLGL

 

>P450_Is108, VBpre_P005301

Same as P450_Is295

VQSRIQREIDDHIGCERQPTWEDSKKMHFTMA

SVFEILRWKNPIPVTNPRGPQENTILNGYVIPKGTLVMSNIVAVHRDP

TLWERPDDFDPTRFLSADGSCLAKRPEQIITFSV

 

>&P450_Is326, 30852.m000013

MQ

DEVRCLLSQILELKGEPVFVSKYTTPSISNNITGLLFGRGYDFDDPRRVYLDENMDGAGKALSSGSLVMFLPTWVYTI

GAHLPFTRIYAIRRCFANIMNFTRAEEDTEIEGYFIPKGTVVIGNIWAVHMDPNLWKNPEEFDPTRFLDETGTKILPKPD

YLIAFSVGKRMCPSEALSSSQIFVYVTSILQKFSVHPEDDTTKINLITDCVTFNTPKPQKLRFIRR

 

>P450_Is120, VBpre_P013886

Same as P450_Is326

HFPAIACLEPRYLLEYPVAVAAILATIAAAAVWLQTRPQRKGILPPGPRGTPLLGFLPFLGKNLHVMFRDLAEIYGPVVR

QVSNPFTHTIRVGTANIVALNSYDSIKKGLSNSAIQGRSRSVFLDQSKSPGVATLNGKVWLENRQMCLKLLRELGMGKTC

LDEKIR

DEVRCLLSQILELKGEPVFVSKYTTPSISNNITGLLFGRGYDFDDPRRVYLDENMDGAGKALSSGSLVMFLPTW

VYTIGAHLPFTRIYAIRRCFANIMNFTRAEEDTEIEGYFIPKGTVVIGNIWAVHMDPNLWKNPEEFDPTRFLDETGTKIL

PKPDYLIAFSVGKRMCPSEALSSSQIFVYVTSILQKFSVHPEDDTTKINLITDCVTFNTPKPQKLRFIRR

 

>&P450_Is060, VBpre_P011603

62% to P450_Is326

LSSRATEDTHIRGFSIPKGTVVIANLWAVHMDPKLWTKPDEFDPTRFMDEEGRGILAKPEYLIPFSIGKRMCPGETLATV

EIFVYLTSLLQKFRVLPEEGQNVCLDTETTSFNIPRPQKLRFLPRH

 

>&P450_Is316, 20966.m000023

RFLFGN

VLNFFGAGSNTVMVTIMWHLLTYAKYPDTVQAKIQREIDDVVGRERQPKWEDRNKMPFTMAAIWEMYRWRTIAP

LGIPRAASEDVFYGEYFIPKGSMVLANLWTVHMDPKLWKDPQNFDPSRFLTKDGTELGPKPESLMPFSVGKRMCPGETLA

TVEVFLNITTLLQKYNV LPEEGQVIDLSTKGAAVIVPETQKLRFIPR

 

>P450_Is076, VBpre_P004015

Same as P450_Is316 insert in heme region

VLNFFGAGSNTVMVTIMWHLLTYAKYPDTVQAKIQREIDDVVGRERQPKWEDRNKMPFTMAAIWEMYRWRTIAPLGIPRA

ASEDVFYGEYFIPKGSMVLANLWTVHMDPKLWKDPQNFDPSRFLTKDGTELGPKPESLMPFSLWKIILLTHFHFARTPGK

RMCPGETLATVEVFLNITTLLQKYNV

 

>&P450_Is083, VBpre_P006726

56% to P450_Is316

NTSRGNLLNLFGAGTNSLNRSLAWHLLVCAANPDTSQRKIQKEIDDVVGQDRQPSWQDSHDMPFTVASIREMQRWKTVMP

LAIPRRQAENIVIGGYVIPKGTAVMANLWAVHMDPNLWESPETFNPYRFLVLDDQTLKITPKPDYLIPFSIGA

 

>&P450_Is217, 27380.m000014

MPATLASLTHKSSTLVIGFFRFQYAPVIACPAA

GSLPGYQAVAVAAILVAITAAVWLRCRPERRRTLPPGPRGFPLIGFL

PFLGRNHHVMFRDLAKIYGPVVRIRIGTANIVALNSYESIKRGLSNNAVQARYRSVFLEQTKSP

EGQMRPQASDPSSSGLSRRSSLTAASVLTWGDSVFSRSCCKASG

LDEAQYLVNRISELDGAPVLIRKYTVPSISNIITGLLFGSRYDYDDPRRTYL

DENMAGAGRALSSGSLVIFLPTWMYTFWAHLPFTRIHDMRHAFQNILDYI

R

 

>P450_Is149, VBpre_P013779

same as P450_Is217

GSLPGYQAVAVAAILVAITAAVWLRCRPERRRTLPPGPRGFPLIGFLPFLGRNHHVMFRDLAKIYGPVVRIRIGTANIVA

LNSYESIKRGLSNNAVQARYRSVFLEQTKSP

GLGSEQFGPVSSEQLNCGLCVDMGRQRLQQILLQSLRPCESLTVRGGCSTASSYSQGPEGA

SRGGSVCPQKDDGMVSRDCAVSGQWSLLVFLLPSRDEVVCTQLLGRRPHGHHVAGGGGG

RGGSELNFPPRIGLTTSAEGSLRRGQIDLLLLCSVGGSFGTDRLHYSASCGVAAS

LDEAQYLVNRISELDGAPVLIRKYTVPSISNIIT

GLLFGSRYDYDDPRRTYLDENMAGAGRALSSGSLVIFLPTWMYTFWAHLPFTRIHDMRHAFQNILDYI

 

>&P450_Is254, 21174.m000018

MSGIWRPSGNLLKGNVASFFGAGSETVRAAIDWLLLMSAVYPERQKKIQAEIDEVVGGTDRQVAWSDRNKMPYTQAFMWE

VMRCKPVNPLSLMRY ASKDVTVGRFVIPEGSIVIGSIWSVFYDAQSWGDPECFRPERFLVDGGARAVKPDRFIPFSYGKR

SCPGEVIANMEVFIYFTTILQHFNVEAPPNGPDLVFDEVLGISLRPKPQELIVRPR

 

>P450_Is074, VBpre_P010554

Same as P450_Is254 this one has an insert in the heme region that is not correct

VASFFGAGSETVRAAIDWLLLMSAVYPERQKKIQAEIDEVVGGTDRQVAWSDRNKMPYTQAFMWEVMRCKPVNPLSLMRY

ASKDVTVGRFVIPEGSIVIGSIWSVFYDAQSWGDPECFRPERFLVDGGARAVKPDRFIPAEPTQVTARTSPRYLRLLAGK

RSCPGEVIANMEVFIYFTTILQHFNVEAPPNGPDLVFDEVLGISLRPKPQELIVRPR

 

>&P450_Is065, VBpre_P011850

86% to P450_Is254

ASKDVTVGGFVIPEGSIVIASFWSVFYDAKFWGDPECFRPERFLVDGGTRAVKPDCFIPFSYGKRSCPGEVIANLEVFIY

FTTLLQHFNVEPPPNGPKLVFDEVLGLSLRAKPQELVFRQR

 

>&P450_Is041, VBpre_P002441

38% to P450_Is254

AVHRLKTICLDLLLSGTAPTTALLCWALKLVARHPEAQVRAQGEMDAVLASPDQLGSLFSRDNLPFTEAMVLEVHRLASV

CMLAPLRTNSEETTVGGFRIRAGSRVLANLWRAHRDPDFWSEPERFDPKRFLGDDGRPDKKDAFMPFSLGKRL

 

>P450_Is282, 25338.m000014

FIDGYLQLMSEHKTDPNTSFNMPNLIGNALAVFAAGSQTTCTTLLWSLLSLADKVDTVQRKVQEEIDRVTEGRRAPAWSD

RHDMPYTMATVWETQRWRTLSVMGIPRE

LLQKFTVLPEEGRTVDFNYDTEGFCMPRSQNLRFMPR

 

>P450_Is042, VBpre_P002559

Same as P450_Is282

KGPWEPHVNS

FIDGYLQLMSEHKTDPNTSFNMPNLIGNALAVFAAGSQTTCTTLLWSLLSLADKVDTVQRKVQEEIDRVT

EGRRAPAWSDRHDMPYTMATVWETQRWRTLSVMGIPRE

SNNEFGDFHNELPDIDYFYYHPVTVIDKIERMVYTKRLSYDY

TKTSLTFLFFVGKRMCPAENFANLEVFLYLAR

LLQKFTVLPEEGRTVDFNYDTEGFCMPRSQNLRFMPR

 

>&P450_Is310, 35684.m000065

MFFRINMGPGNVVILNDFNSIKKYFCKPEVLYRPSDWILTHSGVVGVATINGKAWVDNRRFCMQVLRDLGVGKKSMEKHI

QEESQYLVEKIAETKGRATDAQEFLTPSVSNNITALVFGRRYPYENESRKYMDDRLERVIKVLSRGSIVGILPAWVFSIL

VRIPSTTSNVIKTIADDLLGYASQKVKEHMESSELRTERDFIDRYLSKIKESDWNPDSSFTSK

 

>&P450_Is205, 24905.m000012

MVFCDNEITGLATLNGQAWLDNRRICIRVLRDMGFGKKPMEEHIKEESRHLVKRLEGTDGSAVLVQGHVAASTSNNVSAL

VFGSLYDFEDPRRKAMVENLEEFMKALGTGTMIEFFPEWIRAVVMALPFARVVAIKNVIRNLIELTSVDRVQYRIQEEID

KIVGRDRQPTWEDRHRMPYTVAAIWEMYRCKPTLTLPRA

 

>&P450_Is277, 26417.m000009

QPPGPWALPLVGNLGISDTVALYRRCVEWGKVYGPIFRIKIGVTNVVILSDVKIWKEFVAMEASLIRPHQSVVYQACRGY

LGIATLNGEAWADNRRFCLRVLRDHGFGKTAVEDHIKQQLQSLANQIEDSKGTA

IPIKECLFSISFNVISAVLFGSTYKDSDQKHRDVKTHIMNFMRVLAVNSLVDFYPVWLRTVMAC

 

>P450_Is085, VBpre_P010987

Same as P450_Is277

IPIKECLFSISFNVISAVLFGSTYKDSDQKHRDVKTHIMNFMRVLAVNSLVDFYPVWLRTVMAC

VPFTEVAKIRKKLAFA

RKFISARVMEHRDTLEEDTTRDFIDGYLKQMMDQKDNPNSHYRECHLIGCALDFFAAGVAGVPLAIHWLLLICAQNPYKV

QSRIHAEIDRVVGRERQPAWKDRLEMPFTMASIWELLRWRKEGLLGFPRGVKEDILLEGFLIPKGTVVLPNTTAMNRNPY

YWKRPEEYDPTRFLTPDGTELLEKPEYFIPFSFGKRMCPGESLATVQLFLYATCLMQKYCVQPEE

 

>&P450_Is274, 23487.m000018

FWVAGTNAINRSVIWHMLNCADKPGTVQKAIQDEIDEVVGRERQPAWNDRYRMVYTMAAIWEMLRWRPISPMGLPRGTSE

DVIIGGFTIPEGTIVMANLWAVNMDSSLWVHPEKFDPYRFIEEGRAKLKPKPEYFIPFSLG

 

>P450_Is003, VBpre_P000883

Same as P450_Is274

SVRYLPGNILS

FWVAGTNAINRSVIWHMLNCADKPGTVQKAIQDEIDEVVGRERQPAWNDRYRMVYTMAAIWEMLRWRPI

SPMGLPRGTSEDVIIGGFTIPEGTIVMANLWAVNMDSSLWVHPEKFDPYRFIEEGRAKLKPKPEYFIPFSLG

WLFFYTYSLES

 

>&P450_Is264 27926.m000028

DFVGAYLKRSEEQQNRSESNLNKNYLIGNAVSLYMAVSHSVPSFVHWHMLNCAQSKDTVQAGIHEEIDRVIGRDRPPAWE

DRLAMPYTMAVLWEMYRCKPNSTLPRSVGEDILLNDYIIPKGTVVMPNFWAVLMNDSLWENPGKFDPSRFLSEDGSRLLD

RPEHLISFSLG

RRMCPGEPLATMEIFMYLTTLLQKFVVLAEEGRPLSIDFKNATMDDYVEQKLRFVLR

 

>P450_Is157, VBpre_P013242

Same as P450_Is264

IKVGVVDVVVLNDFESIKNFLCKKEGLYRPENMVFSNVGVNGVATLNGPAWLENRRISMRILRDLGFGKKGMEGLVREET

RQLVEKLVKTNGLPIVTLKQFTPSASNVISRVLFGERDASTSPRGMAMVENLDKFSKALGAGSLIEVLPQWARHLVLLLP

FTRSVALRRFVQNLIELGSQYVTDHEDAKKSHPANE

DFVGAYLKRSEEQQNRSESNLNKNYLIGNAVSLYMAVSHSVPSF

VHWHMLNCAQSKDTVQAGIHEEIDRVIGRDRPPAWEDRLAMPYTMAVLWEMYRCKPNSTLPRSVGEDILLNDYIIPKGTV

VMPNFWAVLMNDSLWENPGKFDPSRFLSEDGSRLLDRPEHLISFSLG

WYPFK

 

>&P450_Is248, 24138.m000012

DQIREHKNTLPQDFNRDFIDGYLKKTMEQQSKTESYFDERHLLGNISEFLVTGTGPASMRIFWMLHICAQNPDSVQSRIQ

KEIDDVIGLQRQPKWEDRQAMPFTMATLKETMRWKTLRPIGGSRGIQENTFIGDYFIPKGTIVLLNSRTVHRNPDYWNNP

DEFDPTRFLTSDGTELVKNEESFLAFGAGRRNCLGQNLGYVQLFLYITTLLQKFSVFPEDGHQAPDIGSLDTTTDDPRLQ

KLRFVLR

 

>P450_Is018, VBpre_P009005

Same as P450_Is248

GVSNLNGKAWTQNRNFSLRVFGDLGFGHPSMEDHIMEELQDLVSQISDNAGGFINLKGYVIASVANVIAALLFGRRFNWG

DDKHDFLVKHLRNVLDGFESGLVVENKPNWLSTITASLPISKPGVMRRSRILLQEFVR

DQIREHKNTLPQDFNRDFIDGY

LKKTMEQQSKTESYFDERHLLGNISEFLVTGTGPASMRIFWMLHICAQNPDSVQSRIQKEIDDVIGLQRQPKWEDRQAMP

FTMATLKETMRWKTLRPIGGSRGIQENTFIGDYFIPKGTIVLLNSRTVHRNPDYWNNPDEFDPTRFLTSDGTELVKNEES

FLAFGAGKRNCLGQNLGYVQLFLYITTLLQKFSVFPEDGHQAPDIGSLDTTTDDPRLQKLRFVLR

 

>&P450_Is233, 24324.m000014

DTLHGSVV

DLLIAGSSTVAATILYILLHCAANPDAVQARIHEEIDAVVESCRSPKWEDHNGMPYTMAVIWEMYRWKTVSTLNLPR

 

>P450_Is044, VBpre_P005417

same as P450_Is233

73% to P450_Is312

DLLIAGSSTVAATILYILLHCAANPDAVQARIHEEIDAVVESCRSPKWEDHNGMPYTMAVIWEMYRWKTVSTLNLPR

EVAEDVVLNGYLIPKGTIVVANNWATHNDPRYWKNPERFDPSRFLTPDESQLLPRPEYLMPFSIG

 

>&P450_Is220, 31142.m000009

AEEDVSLNGYRIPKGTVVLANFWAVHFDPKYWKNPEEFDPYRFLTHDESALLSKPEYLLTFSIGKRMCPGELLATVDVFL

CVTTLLQKFRVLPEEGTSFSVATDHYTDLLAKRLCFLSRLPE

 

>P450_Is084, VBpre_P006785

Same as P450_Is220

MLHFLLAGVGSLNAKAWQENRRYCVKALRELSTGRKSMMNHIREEIRCLRDKVAEAKGGPMTIRSLLISCVVNVIAEMVL

GSRFEFNDPKLAELEQHLDTFAKLISGVTPVNPLPKCLKWISAYIPVLGGNKGLELARDLTNFFRYRSLRDFDNACNILT

FLACAVTLYCLLSHTVDTLHGNMLDFFVAGTASSAATISCIIYHCANQPDTLQAKIYGEIDRVVGSCNTPTWEDHQAMLL

YTMAVIWEMQRWKTLNPFNLPRL AEEDVSLNGYRIPKGTVVLANFWAVHFDPKYWKNPEEFDPYRFLTHDESALLSKPEY

LLTFSIGKRMCPGELLATVDVFLCVTTLLQKFRVLPEEGTSFSVATDHYTDLLAKRLCFLSRLPE

 

>&P450_Is211, 19705.m000018

KLYSSVYLSNQKFSLSLSLPSTEENLLGNTAEFLLSATGPSSTRIFWCLHICAQNPNSVQTKIQKEIDDVVGRHRPPTWE

DRKQMPFTMASLKETLRWMSLGSIGCSRGLLEDTFIGDYLIPKGTIVLLNLRAVLRNPVHWNNPDEFDPARFMTNDSTEV

GKNENAFVPFGVG

 

>&P450_Is208, 24966.m000014

DHLLGNVL

SFFVAGSTTVRSAIQWNVLYLASQPDNLQLMIQREIDEVVGKDRSPSWEDHENMPLTVATIWEMFRWRTDST

FGGPREIIEDIVVGEYSIPKGTMLLPNVRAVHSDPRLWKNPEDFDPFRFLSEDGTCLIPKPEYLIPFSLGT

 

>P450_Is066, VBpre_P011853

Same as P450_Is208

SFFVAGSTTVRSAIQWNVLYLASQPDNLQLMIQREIDEVVGKDRSPSWEDHENMPLTVATIWEMFRWRTDSTFGGPREII

EDIVVGEYSIPKGTMLLPNVRAVHSDPRLWKNPEDFDPFRFLSEDGTCLIPKPEYLIPFSLGT

 

>&P450_Is313, 34498.m000012

HITK

SINIASTNSCFRYSNVNSWLSRPFVCKDKCSFSRTAHALRGHVIDL

LLAGSSSVAITMLCILLHCADNPSTIQARIQREIDNVVGVDRSPTWEDHLLMPYTMAVIWEMTRWKTLNRLNLPR

 

>P450_Is028 VBpre_P005777

Same as P450_Is313

IVLRRTLLHSVSNNIATLLLGSRYQLNDPKQKQLEKLLMTFEILFTKVPQVEPLPKKISGKLASTKHEIHKTSRETRDYS

KDAV

SINIASTNSCFRYSNVNSWLSRPFVCKDKCSFSRTAHALRGHVIDLLLAGSSSVAITMLCILLHCADNPSTIQARI

QREIDNVVGVDRSPTWEDHLLMPYTMAVIWEMTRWKTLNRLNLPR

EAEEDFILNGFLIPKGTIVIANLWAAHMDPKYWKN

PEKFDPSRFLTQDGSALLPKPECLIPFSTGKRMCPGEFVATAQIFLCITTLLQEFRVKSEDGSSFCVAS

 

>&P450_Is291, 34809.m000003

AEAKGQPVLMRSLLLPSVSNNIAAFVLGSRYDFNDPRLKKLHKYMEDFVRIFSDVSPVDPLP

 

>&P450_Is290, 34916.m000005

AGPAEWLALLLTTAALVLAYFAATDWFSRFTSPVGKVLVPGPRGLPFVGNLFSMDNKFHFDKCVTWAKKYGPVFR

 

>&P450_Is265, 27941.m000011

LGVLLVQYVWDQLKRNFKKGLPPGPYGLPFVGYLPFMPKDGHRGVEALKDKYGTVFG

 

>&P450_Is263, 19508.m000016

EEIEYLIGKISDVKGRPIPVEQYLLPSVSNNVSALVFGHRYDFDDPKRKMLDGILDTGMRCLAAGAVITFMPRGFRTLTT

MCFTRFGALRPLVQKLTEFI

 

>P450_Is075, VBpre_P003976

same as P450_Is263

MTLNGTSWMDNRKYCVRLISSPAYGHKDMETQVQ

EEIEYLIGKISDVKGRPIPVEQYLLPSVSNNVSALVFGHRYDFDDP

KRKMLDGILDTGMRCLAAGAVITFMPRGFRTLTTMCFTRFGALRPLVQKLTEFI

CQEEGLGGKEHRKLRENNFVDGYLQLISEHNEDPNTSFN

 

>&P450_Is249, 24165.m000009

EHESTLHPDINRDYIDGYLKKMKERHSEPFSSFQENYLLGNTVESLVGGSGPSSFRVFWLLHVCAQNPITVQSRIQKEID

DVVGHRRRPTWQDREAMPFTMACLQEILRWKSLTPVGNQRG

 

>P450_Is191, VBpre_P006471

Same as P450_Is249

LFRDQIR

EHESTLHPDINRDYIDGYLKKMKERHSEPFSSFQENYLLGNTVESLVGGSGPSSFRVFWLLHVCAQNPITVQS

RIQKEIDDVVGHRRRPTWQDREAMPFTMACLQEILRWKSLTPVGNQRG

VLEDTFIGGYLIPKGSTVLLNSMGVHRNQEHW

ETPDEFDPSRFLTNADTNLAKKYDHFVPFGLGRRNCPGKTLAYVQMFLYVATLLQRFRVFPEDEDRLPCLDSLDVTPAHP

SVQKLRFVLR

 

>&P450_Is239, 30404.m000007

NNLLGNAAEFLLSGTGPTSSQIFWFLHICAQNPNSVQNKIQKEIDDVVGPHRQPTWEDRKKMPYTMASLKEGLRWKAIGP

IG

 

>&P450_Is231, 21054.m000016

MVLIKDLDAIKQIQISKFKDCSARGMSHLLEHCTDEFLEVLDTACTQDVPINTIAVCRTFAANTMLRTGLSFRMDERDKT

GRDVRDSVKKLTLANIRVFQGGLLHLLSS

 

CYP3 clan (162 sequence pieces, 115 different non-overlapping sequences, some will join)

 

>&P450_Is238, 24553.m000207

32% to CYP3A4 human

KRRQHFNYFKKLEIPGPEPSIFFGNMMELYKKTPTVAYREWIDKYGKVVGYFNGYRPVLLVADLELLKNVQVKDFQDFID

RSLLFQSKRPPSPQNKSLIQLTGKRWKEVRSVLTPSFTSNKLKMMSAGVIETIQELMTKIDQKAKTGSEFEIGDMYQALT

LDVICRSAMGINYNLQQHPNHSFLVSSRMLFSSTFSIIAVLLTAFPELEFFLRYLNDFRMKSLNNGVHPFREVQEKCKSI

VMQRQMNNVQVHQKDLLQHMIEAKQSRVDVGSVTSDQLTAADDNDLEQKPASQLANGFTHSSKAVLDDDDITQNAFLVLI

AGYETTSNTLTLVTHMLVNYPDVQEKVRRELLSVIEQDEEITYSTVQKLPYLNCVVSETMRLYPPIFAFVTREAVVDKQY

GKLKIPVGTAVMAAIEYIHRDPDNWKDPNIFDPDRFLPQNKHFDPLAWQPFGAGPRNCIGMRFAHMELRLTLANVLRKYR

LEATENSDVDPPQIDMNPLVLRIKKGVNVRAVRL

 

>P450_Is026, VBpre_P011063

Same as P450_Is238

MDPTKVMWELVAACSIVFVVRWFV

KRRQHFNYFKKLEIPGPEPSIFFGNMMELYKKTPTVAYREWIDKYGKVVGYFNGYR

PVLLVADLELLKNVQVKDFQDFIDRSLLFQSKRPPSPQNKSLIQLTGKRWKEVRSVLTPSFTSNKLKMMSAGVIETIQEL

MTKIDQKAKTGSEFEIGDMYQALTLDVICRSAMGINYNLQQHPNHSFLVSSRMLFSSTFSIIAVLLTAFPELEFFLRYLN

DFRMKSLNNGVHPFREVQEKCKSIVMQRQMNNVVHQKDLLQHMIEAKQSRVDVGSVTSDQLTAADDNDLEQKPASQLANG

FTHSSKAVLDDDDITQNAFLVLIAGYETTSNTLTLVTHMLVNYPDVQEKVRRELLSVIEQDEEITYSTVQKLPYLNCVVS

ETMRLYPPIFAFVTREAVVDKQYGKLKIPVGTAVMAAIEYIHRDPDNWKDPNIFDPDRFLPQNKHFDPLAWQPFGAGPRN

CIGMRFAHMELRLTLANVLRKYRLEATENSDVDPPQIDMNPLVLRIKKGVNVRAVRL

 

>&P450_Is235, 31391.m000006

MSGSVISTVEELVGRVGQMAEKDEDFEIGPMYQALTLDVICRSALGINYNLQQNPKHPFLLSSCMLFGSTFSFIAVLL

 

>P450_Is104, VBpre_P010618

same as P450_Is235

MVQIKDFQDFLDRALLFQTKRPSSPHNKSLMQLMGARWKEVRSVLTPSYTSTKLKM

MSGSVISTVEELVGRVGQMAEKDEDFEIGPMYQALTLDVICRSALGINYNLQQNPKHPFLLSSCMLFGSTFSFIAVLL

ASFPGLEGPLRVLNGWRLRRMNNGVH

PFLDVQEKCKSIVTQRQKVSVELPLQKDLLQLMIEAKQSRVDVGSVTSDQLTAADENEHELKTHIQGSNGL

 

>&P450_Is216, 27341.m000009

FETTSNSMAFITHMLVNYPEVQEKVRQELLSVLGPDEEITYNTIQKLPYLHCVVCETMRMYPPIFGFVTREAAVDKQYGK

LKIPAGTAV

MSAVEYIHNDPDNWDNPHVFDPDRFLPENKQKFNPLAWQPFGAGPRNCIGMRFAQMEIRFTFAHILRKYRLVPTENTEK

VRSHL

 

>P450_Is153, VBpre_P002014

Same as P450_Is216

LLRPPPQLTFVLLQR

FETTSNSMAFITHMLVNYPEVQEKVRQELLSVLGPDEEITYNTIQKLPYLHCVVCETMRMYPPIF

GFVTREAAVDKQYGKLKIPAGTAVMSAVEYIHNDPDNWDNPHVFDPDRFLPENKQKFNPLAWQPFGAGPRNCIGMRFAQM

EIRFTFAHILRKYRLVPTENTEK

 

>&P450_Is077, VBpre_P004038

89% to P450_Is216

MSAVDYIHHDPDNWEDPYTFDPDRFLPENKHKFNPLAWQPFGAGPRNCIGMRFAQMEIRFTFAHILRKYRLVATENTEKD

PPKIDMNPLVLRIKNGVNVKAVPL

 

>&P450_Is280, 25181.m000016 (note: two P450s fused)

GRNRRILTNAEIQANAIVFLIAGFETTSTAMTFTTYLLAKFQDVQDRLRKEITAVLERDGKFTYDNVFGMRYLDQVISES

LRFYPPVTGFTTRTCQHDYEQNGLKIPAGMNVVIPPYQLQHDPALWSEPEKFDPERFSAKNKGSFDPMAFQPFGNGPRNC

VGMRFAQLEMKLTLAKMLAKYKFLLDKRHVE

GKFNYDNVFSMQFLDQVITESLRFYPPVVGFVTRTCQHDYHYKDLKIPA

GLSIVIPQYQLQHDPNLWSDPETFDPE RFSAENKGSFDPMAFQAFGNGPRNCVGMRFAQLEMKLTLAKMLAKYKFLLDDR

HLEEPAGPKFRHLARFDSTTIVSYLANSNFSDKVQHRTCPGTRTTC

 

>P450_Is131, VBpre_P004885

Same as P450_Is280

MKAPSDNIKFGIMPIIDMRRSNPEARREDLLQLLLNAEAEEGAAVDVHQLTVGYEGETSQSAESKSS

GRNRRILTNAEIQ

ANAIVFLIAGFETTSTAMTFTTYLLAKFQDVQDRLRKEITAVLERDGKFTYDNVFGMRYLDQVISESLRFYPPVTGFTTR

TCQHDYEQNGLKIPAGMNVVIPPYQLQHDPALWSEPEKFDPERFSAKNKGSFDPMAFQPFGNGPRNCVGMRFAQLEMKLT

LAKMLAKYKFLLDKRHVE

EDHLKLGSSFALCYPLDGAWLKVKKL

 

>P450_Is033, VBpre_P013452

Same as P450_Is280

MSCSNDQLSQANTTRRRRKHFSFFKDIGIPGPMPSLFSGNLSELIEKGSRLSFEEWVKKYGDLVGFYNGAEPMLIVKDLE

LIKRIQIKDFSNFRGRGISSLMDICTDEFLEVLDSLHDQDEAFEIRQVFQKLSMD

GKFNYDNVFSMQFLDQVITESLRFY

PPVVGFVTRTCQHDYHYKDLKIPAGLSIVIPQYQLQHDPNLWSDPETFDPE

 

>&P450_Is043, VBpre_P002360

67% to P450_Is280

I

LMFQGKFSYDNVFSMRYLDQVISESLRFYPPVTGFITRTCQHDYEYNGLKIPAGISVLIPPYQLHHDPNLWTEPEKFDPE

SSASNKVNDGDTLQTRTAWRGPAHAPAHVPLNV

DMKLTLAKMLAKYRFLLDERHVKEDSLKIGSTFIFCYPQEGAWLKVEKI

 

>&P450_Is184, VBpre_P011199

85% to P450_Is043

RRRSDFLRN

LMFQGSFNYDNVFRIRYLDQVISESLRLYPPVTGFTTRTCQHDYEYNGLKIPAGMSILIPPYHLHRDPNLWSEPEKFDPD

RLTCRCSVQLHTDPSVIIVPVIKVYDRSKSLNFSRR

NMKLTLAKMLSKYKLLLDERHVKEDCLKLGSTLIFCYPQDGVWLKLEKIGMSS

 

>&P450_Is081, VBpre_P009105

60% to P450_Is043

AVLTFTAYLLAKHQRIQDRLRAEIASVMERDCHFTYDNVFAMRYLDQVISESMRIYTPFVGFITRTCQREYNYNGLKIPA

GLSILIPAYQLHHDRDLWNEPNKFDPDRIERYSHTMKRGLHWNVHQLPKFQLRQLTLAKLLAKFRIKLDERHIKEDHLKL

GSTFIFSYPQDGVWLEFEEI

 

>&P450_Is144, VBpre_P003015

Gray regions same N-terms different

This N-term 55% to Is244

MWVLNRRRQHSLFARLGIPGPAPDLFSGNWVQLKKDPLEVMEHWIEKHGKMFGYYVGEIPYVAITDLEMIKQCFVKEDNV

VCNRPSLIVSIEPFGSSLVGLSGDEWKRVRTVLNPIFTSVKLKAVTEIIRRCADEMLEILDDYAERGCVVDMTKVSKGLS

LDVITKSAFAWQ

VDCQRNPSDPLLLAVQRIFNDSDNFLILSAVRFPALRKAMERIFLYSSYFKMITHISDKILKVLELRQ

SGQSPRANDMLQLMLDAQTGSEDANVDFKKRAKAIEDRHLLANCFIFLAAGFDTTASSLSFVMHLLAKYPEEQELVFDEI

QKTFPGDAELTYDGLQQLKYLDMVICETLRMYPPVVMFTSRHCKEDTMVMGQLFPAGVNVLVPVWHIHHDPELWPDPQRF

DPKRFDGEKSRNSAAYLPFGIGPRMCIGKRFALLELKLAICKIVRKYKVFPCEQTQDPLKFSVPTVVLHPKSPICVKLQQ

R

 

>P450_Is144, VBpre_P003015

same as P450_Is144

MWVLNRRRQHSLFARLGIPGPAPDLFSGNWVQLKKDPLEVMEHWIEKHGKMFGYYVGEIPYVAITDLEMIKQCFVKEDNV

VCNRPSLIVSIEPFGSSLVGLSGDEWKRVRTVLNPIFTSVKLKAVTEIIRRCADEMLEILDDYAERGCVVDMTKVSKGLS

LDVITKSAFAWQVDCQRNPSDPLLLAVQRIFNDSDNFLILSAVRFPALRKAMERIFLYSSYFKMITHISDKILKVLELRQ

SGQSPRANDMLQLMLDAQTGSEDANVDFKKRAKAIEDRHLLANCFIFLAAGFDTTASSLSFVMHLLAKYPEEQELVFDEI

QKTFPGDAELTYDGLQQLKYLDMVICETLRMYPPVVMFTSRHCKEDTMVMGQLFPAGVNVLVPVWHIHHDPELWPDPQRF

DPKRFDGEKSRNSAAYLPFGIGPRMCIGKRFALLELKLAICKIVRKYKVFPCEQTQDPLKFSVPTVVLHPKSPICVKLQQ

R

 

>&P450_Is181, VBpre_P005166

49% to P450_Is144, 32% to CYP3A4 human

MESALWMLWMSIFAFLATCVAVWLRERRHRHGFFKRMGIPGPEPDLLFGNWQQLRKDRINVMEDWIAKYGKTFGYFKGAA

PFFIISDLEMIKQCFVKEAHIFYDRPDPSILVEPYNQTLLFLKGDEWKNVRTLMNPSFTSAKMKLMTGIIDACVDEMVRV

LDKKAKDGAPVDVSKVSCGLSLDVVAKCALAWQVDCQKSPDDPFVLKLRNIVQNSETPVTNTFVAFASLRKLAALIYPFT

SHAKDTFSIVENLRRIVELRRRDSKNRRVDMLQLLLDGQAGKLTEGNTVNAEKKGGKSRLLMSDDRLLANSLLMLLAGFE

TTAMSLTFMIYLLSQHLDEQETLYNELVATSAINDLNYEKLMRLRRLDMVVRECFRLYPPVVLFLSRACNADTNIMGQFF

PKGSHVMVPVWHIHHDPEIWPDPFKFDPGRFGPEAPPHHPAAYLPFGVGPRICLGMRFALLELKSALCKIIRKYRIVPCE

DANAPPELTVPIYIINPKHPIKVMLQRR

 

>&P450_Is305, 35813.m000019

44% to CYP41, 38% to CYP3A5 human

YVARHKNYWKNQNVPHEKYSIFGHTRRMMSKTFHELDQERYIKYGKVYGMFEGGKPSLFVADPELIKQILVKDFLKLPNR

RSVKFHNPLLDNLMSVVSYKRWKVIRSVSTPAFSSAKLNKMFSLIESCIDVTKRHLIDAAEKEQDLELGHFYGNYTLDVI

ARCAFGTTMDSHSDQTNDFVRMSKIISGGKKNLALVLTFVFPALAKLLKLKLFNEESVMYYKDLSSAT

METRRKTKTKQD

DFLQIMIDAQERNRTLDVSQGGEEDAVKLFDIDSKLTDEAPLSSKTLSEEEALSQCMMFILAGHGTTSSVIAFSLYLLAL

NPEAQNKLRKEVDVCVKENGPKPSMDAIDKLQYLHGVVSEALRIFPPASRLERETTEDYVLGNTGIKVPKGCVVAVPVWA

LHHDPQYFPDPHSFKPERFSKENVDSIPPYVYLPFGAGPRNCIGVRLGLRAVKMALFHSICNVEFVRTAKTKVPLELFKG

FGVISSSDITVGVRKRTS

 

>P450_Is169, VBpre_P003856

Same as P450_Is305

METRRKTKTKQDDFLQIMIDAQERNRTLDVSQGGEEDAVKLFDIDSKLTDEAPLSSKTLSEEEALSQCMMFILAGHGTTS

SVIAFSLYLLALNPEAQNKLRKEVDVCVKENGPKPSMDAIDKLQYLHGVVSEALRIFPPASRLERETTEDYVLGNTGIKV

PKGCVVAVPVWALHHDPQYFPDPHSFKPERFSKENVDSIPPYVYLPFGAGPRNCIGVRLGLRAVKMALFHSICNVEFVRT

AKTKVPLELFKGFGVISSSDITVGVRKRTS

 

>&P450_Is168, VBpre_P003855

55% to P450_Is305

FTMVFRYLARFRNHWKDQHVPHESYALLFGPMLKMLYQPFHDIDIERYRKYGKVFGIFESGRPSLFVADPKLVKQVLVKD

FLLLPNRRTTKFLHPLLDNMLFVVPFDRWKVIRRISTPAFSSGKLRKVMVHVESCTRSTIKHLREAAERCEDLNLSQFYG

NFTLDLVARCAFGTMLESHSDQSNEFVSYGTKAFGEGISFASVIFFLWPGLAKLLRLKFFNQKTLIYFKKLSLSVMNNRR

RERT

 

>&P450_Is009, VBpre_P012339

58% to P450_Is305

LIVLGNRIDRSTTEDYALGDTGITLPKGCTITVPIYAMHRDPLNFIDPDSFIPERFTEDNAASVLPYTYLPFGAGPKGCL

GMNLALLAVKLCLMYSLRAIEFVRTSKTKVGQPCCNFL

 

>&P450_Is114, VBpre_P006307

72% to P450_Is223,

MLYPAVILVFTVLILLVVKVLRWRRRTFCYFKDLGIPGPSPNLIWGNLREYHEKGLFQALDKWCKQYGDVFGFYNGDVPM

LVVKDLEFLHYIFVKSSSNFTARG

 

>&P450_Is124, VBpre_P006873

61% to P450_Is223,

MAYQPFGDGPRNCIGKRLALLEIIYTGARMVQKFKLTLGESQKGTMKMEFHGMVSSPGLGPWIKFERL

 

>&P450_Is119, VBpre_P006312

56% to P450_Is223

MMPHVSEQAEVLIDILGEVSDLGRELSTFETFQALAMDNVGRTFFGLNSTFQHNVQDAFIAKALNVIPQMMTGPFHFIAH

CTTSFGRIVKPLAWLNKLLGTFALENFSRDIAKIVEQRRKNPSLRRNDVLQCLIDAEERPDDKTNEKSAKNFTDDRLSLL

IYCSFQTISISLCYATFLLAKHPDIQDKVRKEVSEAVAKSGSLSYETVMHKLWYLGQVLNETLRMYPPSLTFMTRAAKND

FEYNGTKFKAGLSIMSPVLHVHMDSRYWPEPHKFNPDR

 

>&P450_Is117, VBpre_P006310

64% to P450_Is223

GSLDYETVNQKLKYLGQVINETMRIWPAALTTERGPCKTLVNPLVQYPAG

 

>&P450_Is138, VBpre_P002172

45% to P450_Is223

RKKTFGYFKDLGIPGPEPSIIWGNLAEYQRNVSYVRLYIVSDLLNHFAAVKTKQKTATLKVVYIIIFLFQVTMRTDQVHP

SLGESLIHAKGSQWRFLRSCPSPEFTSHKLKQMMPYLVEQGDIFINQLDKLADERREESMLDAFQALSMDFICRAAFGID

TDFHHNKKNPFYVQAEGVIP

 

>P450_Is116, VBpre_P006309

same as P450_Is223

MLAHCTTSFGVLAAPIFWLNWTFGSFSFVRVSEEVAKVIELRKKNPELRRTDILQNLID

AEYEEQATTRTSSDKTTNTNQKD

VCNEFWLVTHR

FETTATTLCYLMFVLGKYPDVQEKVREEVKRAVDDSVSFASI

 

>&P450_Is223, 34549.m000042

29% to CYP41 tick, 31% to CYP3A4 human

MIVTVVLSTLLVLLAINLLRWRRKTFSYFKDLGIPGPKPSLIWGNLWEYHQNGLFRALDKWCKEYGDIFGFYNGDVPMLV

VKDLEFLKHVFIKNFSNFTDRGITMRTDEMHPFVGNAVAHAKGSHWKSIRQSISPWFTKLKLKLMMDHITQVGDVFMEVL

GKKADQGQEVCMFEATQALTMDYIGRAALGIDNSFQNDQKNPFLVTAQRAFREIMTGPFHMLAHCTTSFGVLAAPIFWLN

WTFGSFSFVRVSEEVAKVIELRKKNPELRRTDILQNLIDAEYEEQATTRTSSDKTTNTNQKDISKTRTLSSEEVIINTTV

LFTAGFETTATTLCYLMFVLGKYPDVQEKVREEVKRAVDDSGPLDYETVTQKLKYLGQVINETMRIWPAGLTFTTRQAKE

DFEYQGIKYKAGTCIMSPTLQIQRDERFFPDPMKFDPDRFSEENEDSFPKIAFQPFGIGPRNCLGMKLALIELAYTVARM

TQHFRWELGESQKGEMPIDQYGMVSSPASGPWVLFHRL

 

>&P450_Is224, 34549.m000043

MKYVGQVVNEALRIWPPALTFTTRQAKEDFEYKGIKYKAGTCIMSPTLQIHRDERFFPDPMKFDPDRFSEENESSVMKIA

FQPFGLGPRNCVGMRLALFEIAYTVVKMTQHFRWELGDSQLASSISKELPITITKSASSLSSPSLCAYHHHCS

 

>&P450_Is225, 34549.m000044

MMGHIAQMCDVFMDVLGEDADNGREVHMVSKFQGLTMDYLGRAAFGIDTSFQRDLNHPFLITAKEAAHGLMTGPVHMLAQ

CTTSFGNLATPLLWLNWIFGSFPVRKFAEHAAKVIRLRKNNPELRRNDILQNLIDAEYEELPTTPKTVSEQTKITGTLGT

DKIRRLRFEEVVMNTTLLFLAGFETTATALCYVTYALAKYPGVQERVRNEVNEALHGSGCLDYEAVTQKLKYLGQVVNEA

LRLWPPILTFSTRQATEDFEYKGIKYRAGTCIMSPTLQIHRDARFFADPTKFDPDR FSAENDGSFPKIAYQPFGLGPRNC

VGSMLALLEITYTVAMMTHRYRWELGQSQKGEMPLDQYAMVSIPGRGPWIVFHRI

 

>&P450_Is226, 34549.m000045

MYLLAIFCTLIVVPVVILVRWRKKTFEYFKNIGIPGPEPNIFWGNLLEYHRNGRDNALKRWYDKYGKVFGFYNGDVPTLV

VSDIDFLNYVFVENFKNFVDRGITMRSDQEHSFLGQAIVHAKEPQWRILRSITSKEFTPYKLRRMMPHLVEQGDIFMDVL

DKLADEGRAGVNE

 

>P450_Is118, VBpre_P006311

Same as P450_Is225

RHMGQNIQYLAFSCRVAFRRW

FSAENDGSFPKIAYQPFGLGPRNCVGSMLALLEITYTVAMMTHRYRWELGQSQKGEMPLDQYAMVSIPGRGPWIVFHRI

 

>&P450_Is161, VBpre_P009154

75% to P450_Is226

MMPYLVEQGDIFINDLGKLADERREESMLDAFQALSMDFICRAAFGIDTDFQHNIKNPFYVQAEGVIPGMMKGPFHAVAQ

CTTTFGRLIKPLSWLNRILGSFTMEIFAREMKKVVRLRTQNHGMQRNDMLQNFLEAEVINKYPFNKIASMNAKNSEGKI

 

>&P450_Is288, 35117.m000009

RQEDFLQLMMDAQDGSIATTVETVQSTEEKLFNLDSEIKTDTSFLGGVKGLFCLRSLTEDEAMAQCLLFFIGGQDTTSFV

ISYTVYLLALHPEIQAKLREEADECFKQHGPDPSLDVVSKLKYLHGVVSESLRMFPPQVRIERSALNDYVLGDTGIKVPK

GCVVVVPVYSMHHDPEYFPDPTTFDPNRFSDENIDSIRPYTYLPFGAGPRNCIGMRFALEAVKLSLLHSVHSVEFVPTKN

TK

 

>P450_Is023, VBpre_P001238

Same as P450_Is288

FFFFFACFLGWFLVSFGSLLFLRYAARYRNYWKDQNVIHEEFSLIFAAARRLIFKPFHQMDQDRYRKFGKLFGVYEGAQP

VLFVADPELVKRVLVKDFPSLPNRRAISFNDSLLDNMMSIVPVEKWRRIRPAASPAFSTGKLRKMNFLIADCARKTAEHL

KVAAEKEGELDIKQRPIPFFLFLLYPHNLFHSLAFPSFLFRALTASPFGFFFQKQTFPRTYTMILFPGVFKLFKLKVFNA

DIFLYFKNVCLRIIESRKEKKS

RQEDFLQLMMDAQDGSIATTVETVQSTEEKLFNLDSEIKTDTSFLGGVKALTEDEAMA

QCLLFFIGGQDTTSFVISYTVYLLALHPEIQAKLREEADECFKQHGPDPSLDVVSKLKYLHGVVSESLRMFPPQVRIERS

ALNDYVLGDTGIKVPKGCVVVVPVYSMHHDPEYFPDPTTFDPNRFVDENIDSIRPYTYLPFGAGPRNCIGMRFALEAVKL

SLLHSVHSVEFVPTKNTK

VPLEFVRGSAVLSAKHITIGIRKRTA

 

>&P450_Is219, 23013.m000009

CFPELTFLWKCVFWFKRHFMKLPINKINELLMPIINIRRSQPLSVDQDFLQLLLNAEAEDDRATNTHTKKGDNDNTRYLE

NKTSLRKTRLLTNVEIQCNVISFLVDGVETASTAMTFMAYLLAKHPDIQDKVRSEASATLEKDGEFNSGNITSLRYMDQV

ISEALRVYPPITGFVTRTCEKDYDWNGLKIPAGMSIKIPVYQLHHDRNLWHEPEKFDPERFSDDNKGNIVPMAYQAYGNG

PHNCIGMRFAQLELKLMLAKLLANYKLLLDEKRMKENPFELDSSSIFCYPRKGVWLKLQKISSVL

 

>P450_Is031, VBpre_P010176

Same as P450_Is219

MMGVNLIATELINHLNFLVNGWESYLVE

CFPELTFLWKCVFWFKRHFMKLPINKINELLMPIINIRRSQPLSVDQDFLQL

LLNAEAEDDRATNTHTKKGDNDNTRYLENKTSLRKTRLLTNVEIQCNVISFLVDGVETASTAMTFMAYLLAKHPDIQDKV

RSEASATLEKDGEFNSGNITSLRYMDQVISEALRVYPPITGFVTRTCEKDYDWNGLKIPAGMSIKIPVYQLHHDRNLWHE

PEKFDPERFSDDNKGNIVPMAYQAYGNGPHNCIGMRFAQLELKLMLAKLLANYKLLLDEKRMKENPFELDSSSIFCYPRK

GVWLKLQKISSVL

 

>&P450_Is006, VBpre_P012112

40% to P450_Is219

TLSFCFFRVAKHQEIQENVREEVISVLAKHGALNYEAISELQYTSQVLNETLRVHGPVTAFTSRMTNQDYKYQDVLLRRG

FSVIACSHLVHKDPNLWPEPDKFDPERFSPEQSSSRDPLCFQGYGMGPRICVGSKLAQLEMALVLAKVLLHFRLELGQRG

ISEGRLETAGYSIMEAPRDGVWLKLHELEQPFSKCSG

 

>&P450_Is285, 33104.m000013

AE

WKKTRRVLNPIFTAAKIKMMSQIMTGCSEEMLGIVDRKFDGGEAVDMLQIAQGLSLDVISKCALAWKVNCQTNTTDPL

LRAMHSVVDDAENTLIQYAIALPILRKIAEWIYPYASYYKITTKILDNVREVIEYRRSGQGSRTTDMLQLMLDAQAGKEA

KATTSSKGDMLIEDRHLLSNSFLFLAAGFDTTALTLAFGAFLLAKYPEEQERVFNEIVSVFSEPDTELTYDGIQKLKRLD

MLIAETMRLYPPVVLFVSRCCRQDTTIMGQFIPAGVNVLVPTWHVHHDPNLWPDPYRFDPERFADGRNTHHPAAYLPFGL

GPRGCIGKRFALLEIKMAM

 

>P450_Is016, VBpre_P008946

Same as P450_Is285

MAKSVLRALFLLPLTVHRSLKVFENWIQKYGKVFGYYQGEIPFIVLTDVDMIRDCFIKETNTFHDRPTLVLNVEPYISSL

LGVEGKA

WKKTRRVLNPIFTAAKIKMMSQIMTGCSEEMLGIVDRKFDGGEAVDMLQIAQGLSLDVISKCALAWKVNCQTN

TTDPLLRAMHSVVDDAENTLIQYAIALPILRKIAEWIYPYASYYKITTKILDNVREVIEYRRSGQGSRTTDMLQLMLDAQ

AGKEAKATTSSKGDMLIEDRHLLSNSFLFLAAGFDTTALTLAFGAFLLAKYPEEQERVFNEIVSVFSEPDTELTYDGIQK

LKRLDMLIAETMRLYPPVVLFVSRCCRQDTTIMGQFIPAGVNVLVPTWHVHHDPNLWPDPYRFDPERFADGRNTHHPAAY

LPFGLGPRGCIGKRFALLEIKMAM

CKIIRKYTFIPCDGTPEDVELVVNNIMISPKGGLKVRLQRR

 

>&P450_Is322, 18622.m000014

MAASALSTSLPPPPPCPTIVQIF

RKVLLDLESVLVDGLVCFPPLRQAIEWVYPYSSYHDVTKQITDNLSKVIDLRRKKQG

SRPTDMLQLMLNAQEDHENVTSADLGENTFSIKDRHLMANSFIFLVAGFETTATALAFVMHTLAKYSDEQDRVFRELTKV

FPKKNQTLTYDGVQQLKRLDMVIREVLRLYPPVVLFVSRVCREDRSVMGQFLPAGVNVLVPTWHIHHNPDFWQDPNTFNP

ERFSEGKSAHHPAAYLPFGMGPRMCIGERFALLELKLVTCHVLRRYRVTTSNRTHDLMKITVSSVVIRPKECIEVNLELR

 

>P450_Is069, VBpre_P002809

Same as P450_Is322

KISAMVFPLWITVTSLILVVATGIFLSLLHRRRQHGFFRKYGIPGPEPDLLSGNYMQLKKDRIEVMEGWIKRYGKVFGFY

LGERPYMVVTDLDVIKECFIKETNNFYNRPNIFLDFEPFRSSLIGLSGFEWKKVRSALNPSFSASKMKMMTHTMSQCVEE

MLEVLREHADRGEAVNMLDVSQGLTLDVIAKCGLAWQVECQRNVTDPMLQAV

RKVLLDLESVLVDGLVCFPPLRQAIEWV

YPYSSYHDVTKQITDNLSKVIDLRRKKQGSRPTDMLQLMLNAQEDHENVTSADLGENTFSIKDRHLMANSFIFLVAGFET

TATALAFVMHTLAKYSDEQDRVFRELTKVFPKKNQTLTYDGVQQLKRLDMVIREVLRLYPPVVLFVSRVCREDRSVMGQF

LPAGVNVLVPTWHIHHNPDFWQDPNTFNPERFSEGKSAHHPAAYLPFGMGPRMCIGERFALLELKLVTCHVLRRYRVTTS

NRTHDLMKITVSSVVIRPKECIEVNLELR

 

>&P450_Is330, 34947.m000048

SYQGFVPTLVVGDPLLVRDICVKNFKSFTHKIKPNV

MGNSMWDKVMLNTPDEEWKAARSIMSTALTTSRLKAMITEIISA

ADKFCTRLLLEGENKSAVEVSKMFEGCAINAMAALVYSVDLDPHETPDHPLVKCGNEFSASLNGWKMILLSSMPTVYKLL

PMKFSSNKGTEYFKEFTRHMAQQRCASNQRFDDVLQLCLDDLAHGRSHDNFKISEPTIEDLAAQCMQFLVAGSDIVALTL

MWTAYSLASHPECQEKVLREIDIAVKQNGVTYEALKEMPYLEAVINEALRMYTPDSFLIRRCTQEISVAGIEVRPGMCIE

IPIEGIHHDPEFFPEPECFKPERFLPENKDALVPYTFLAFGAGPRNCVAQRMGIIQTKATLACLLRNIKFQRCTETPVPL

KLQTASWLLQSLKPVKLGCISRIQ

 

>P450_Is034, VBpre_P005958

Same as P450_Is330

MGNSMWDKVMLNTPDEEWKAARSIMSTALTTSRLKAMITEIISAADKFCTRLLLEGENKSAVEVSKMFEGCAINAMAALV

YSVDLDPHETPDHPLVKCGNEFSASLNGWKMILLSSMPTVYKLLPMKFSSNKGTEYFKEFTRHMAQQRCASNQRFDDVLQ

LCLDDLAHGRSHDNFKISEPTIEDLAAQCMQFLVAGSDIVALTLMWTAYSLASHPECQEKVLREIDIAVKQNGVTYEALK

EMPYLEAVINEALRMYTPDSFLIRRCTQEISVAGIEVRPGMCIEIPIEGIHHDPEFFPEPECFKPERFLPENKDALVPYT

FLAFGAGPRNCVAQRMGIIQTKATLACLLRNIKFQRCTETPVPLKLQTASWLLQSLKPVKLGCISRIQ

 

>&P450_Is194, VBpre_P001089

49% to P450_Is330

MLFAMPKVLKILKRIVEFPSRKSTDYMIQFTRFLVDQRIEEKKKFDDVLQILLEATLEAKDKDSVEITDAEIDEIASQCM

LCIVAGTDAVKHTLTCAVYNLVMHPQYQERLIQEVDDTLKETDVTYDALKAMPFLEAVIYETLRMYTPDSFLTRVCTKET

VVSGIRLKPGMGIEFPLRGVHYDSEFFPDPYLFNPERFLPENKPNMIPYTFLAFGEGPRNCVGTRMATVVIKAMLATIYR

VMKFERCSDTPDQLKFVPRSLLLEFQEPIKVQIIPRSTKKAQRAAANDKPQ

 

>&P450_Is035, VBpre_P005959

75% to P450_Is330 C-term

MSIEIPIHGMHHDPEFFPEPDCFKPERFLPENKHALVPYTYQAFGVGPRNCVGQRMGMLQTKATLACLLRKIKFQRCSET

QVPFKLQARSLILQPTETVKLRCVPRA

 

>&P450_Is192, VBpre_P001087

42% to P450_Is330

MNAMTVVVVAFLALVGFFVWKLQQIFTFWSDKGVPYLTLWQYLRVVYDMYTKPLHEVIRKNYERYGRLYGSYQGIVPTLV

VGDPDILADVFVKNFKSFSDRTEAQTIGTDIWKKSILNLSGEEWKHARGILSPAFTANQLRKAVVKIHKISERMTTRLAE

YAKDKKPVAINE

 

>&P450_Is193, VBpre_P001088

74% to P450_Is330

MHLFVQRSTHDIDESTCEACLLICRWTIRTFTYWNDKGVPHLSFMEYMRTAYDIFTKPLYEVVQRNYERHGRVYGTYQGF

VPTLVVGDPNLLRDICVRDFKSFADRSVSLN

 

>&P450_Is276, 20903.m000027

LTEDEAMAQCIVFFVAGQDTTSSVISQTLYLLALHPEIQVKLREEVDDCFERHGPEPSLDVVSKLKYLHGVVSESMRMFP

PGPRLERSALNDYVLGETGITVPKGCLVALPVYSMHHDPDNFPNPATFDPNRFSDENMGSIRPYTYLPFGAGPRNCIGMR

FALQAVKLSLLHSVHNVQFVRTENTQVSI TSRSF

 

>P450_Is126, VBpre_P006894

Same as P450_Is276

TTVG

LTEDEAMAQCIVFFVAGQDTTSSVISQTLYLLALHPEIQVKLREEVDDCFERHGPEPSLDVVSKLKYLHGVVSESM

RMFPPGPRLERSALNDYVLGETGITVPKGCLVALPVYSMHHDPDNFPNPATFDPNRPVDENMGSIRPYTYLPFGAGPRNC

IGMRFALQAVKLSLLHSVHNVQFVRTENTQVSI

 

>&P450_Is038, VBpre_P007210

58% to P450_Is276

IKFGDPVLDNMMTAASLDRWRVIRAVASPAFSASRLSSIIADCARITAEHLRTCEGDLEVKTFYANFGLDVIARCSFGIK

LKPHSDVTNKFVIEAKRAFSRNMTLPLIAIYLFPGLIQWFNIKLLNFDIIRCFKDLAGKAIRERDKGGHKSEDYLKLLMD

AREERHDTNGYPNRRETPERSGEVLHRVKRTMATFFSALSEVEVLAQCVVMFLGGQDSISSLIAHTVYLLALHPDKQTKL

RGEVDRCFSSHGEEISPKVISKLDYLHGVVSEALRLFPPATRIDRSTTEDYALGDTGITLPKGCTITVPIYAMHRDPLNF

IDPDSFIPERFSEDNASTISPYTYLPFGAGPKGCLGTHLALLAVKLCLLYSLRDVEFFRTSKTKVPLKFYNGFGLLHSAP

FSVGIKKRSTAPMSTSTHNAN

 

>&P450_Is267, 26818.m000011

MYPRINDSIGATVTFLKEAAEKDTEVDIRTLFSNYALDAIARCAFGTKMESHLKEVDDFAAKNKSFFAAPQALSGVIS

P

LTKSEALAQCIMFFLAGRDTSATLLAHAIYMLALHPEAQAKLRKEADECFEKHGEELTMDVVAKLKYVRGVVSETLRMLPP

ATRLERLAAEDYVLGDTGIRVPKGCIIAIPIYSMHHDPE

YFPDPFTFKPER

FIGENIESIRPYTYLPFGAGPRNCIGDRFALEAIKIALLHVVRSVEFY

 

>P450_Is106, VBpre_P008230

Same as P450_Is267

VFEGSQPVLVVADPELVKLVLVKDFTSLPDRRPIPFVQPLLEEMMAFVTLKKWRKLRPSASPAFASGKLRK

MYPRINDSIGATVTFLKEAAEKDTEVDIRTLFSNYALDAIARCAFGTKMESHLKEVDDFAAKNKSFFAAPQALSGVIS

LLLPSLAKLLRLDALKSDRLPYFMALSESIIRERKHQENRQ

EDFLQLMMDVQEETSSSGADSQTDDRLFNPESGSKAFSMGRRRA

LTKSEALAQCIMFFLAGRDTSATLLAHAIYMLALHPEAQAKLRKEADECFEKHGEELTMD

VVAKLKYVRGVVSETLRMLPPATRLERLAAEDYVLGDTGIRVPKGCIIAIPIYSMHHDPE

FIGENIESIRPYTYLPFGAGPRNCIGDRFALEAIKIALLHVVRSVEFY

RSQNTR

 

>&P450_Is002, VBpre_P000827

91% to P450_Is267

SFCRIERLAAEDYVLGDTGIKVRKGCLIAIPVYSMHHDPEYFPDPFSFKPERFIGENIESIRPYTYLPFGAGPRNCIGNR

FALEAVKIALLHVVRSVEFYRTQNTAVRKNIFL

 

>&P450_Is056, VBpre_P003764

92% to P450_Is267

LSLSFCRLERLAAEDYVLGDTGIKVRKGCLIAIPVYSMHQDPEYFPDPFTFKPERFIGENIESIRPYTYLPFGAGPRNCI

GNRFALEAIKIALLHGVRSVEFYRTQTRGA

 

>&IS039, VBpre_P007066

MLLVSVTSNAQNTQKKNAVYVILQTYALMFQGNLNIIEEWSSIYGDIFGYFHGFRPILVIRDPELIKQIFIRNFDSFPKR

QLIQEASGVVPVNTVKLSRISGDKWRLIRALISTAFKSNKLKQAFPMIEECTDEFLRIMEKDKAAQERGGIDISPAFCRL

SLEILLRFTMGARLNVQAASKETEAILNAGRNAARRFPLGLLMVCNLIPTWDIVKTVMVFLQGCLREAPTEMFNKYLFEL

VRQRRERGWTETEDLFQLLFNAEEKCGPDRKPDGTTQSTEKGHSGNSDTTRTERTITPFETAANVEFFVIAG

 

>&P450_Is315, 21960.m000014

DEWKKMRTLLNPAFSAAKMRLMMQTINKSADVFVDILTESSQKGAVLEMYKVAQGLSLDVIAKCALAWQVDCQRNPDDPL

LKELQNIFRNTSNVGARISFWFPALKHVIEILHKKWQFMVTQENIIANLRNVISLRRRGQAPSVPDLLQLMLNCQSDASN

AKDHTDQKNLLLEDRMLIANCFIFILGGLETTSLALAYTLFLLAKHPEEQDRLFQELTDMFPGNQELSSDDLRKLKRLDI

VFKESLRLYPPTVAFVSRTCRRDITVMGQFIPSGTSVTVPVWHLHHDADYWPDPFKFDPERFSEGQERHPPEAYAPFGLG

PRACIGSRLAMLELKATLVKVVRRFKILLCEETQDPPKIRIPLSLTLPENGIRLKLERRVP

 

>P450_Is046, VBpre_P008473

same as P450_Is315

IKKKTLSEYQGSTHTDSSAGSKLQTIMLAG

DEWKKMRTLLNPAFSAAKMRLMMQTINKSADVFVDILTESSQKGAVLEMY

KVAQGLSLDVIAKCALAWQVDCQRNPDDPLLKELQNIFRNTSNVGARISFWFPALKHVIEILHKKWQFMVTQENIIANLR

NVISLRRRGQAPSVPDLLQLMLNCQSDASNAKDHTDQKNLLLEDRMLIANCFIFILGGLETTSLALAYTLFLLAKHPEEQ

DRLFQELTDMFPGNQELSSDDLRKLKRLDIVFKESLRLYPPTVAFVSRTCRRDITVMGQFIPSGTSVTVPVWHLHHDADY

WPDPFKFDPERFSEGQERHPPEAYAPFGLGPRACIGSRLAMLELKATLVKVVRRFKILLCEETQDPPKIRIPLSLTLPEN

GIRLKLERRVP

 

>&P450_Is036, VBpre_P006026

73% to P450_Is315 C-term

DRAVLANCFNLMFAGFDMTSLALAYTMFLLPKHPEEQERLLQELTDAYPNNQELSSDDLQNLKRLDMAKESLRMYPPNVG

FISRACQRDITVMGQFIPSGTTVTVPVWQHHHDADYWPDPFKFDPERFCEGKGHIPEAFVPFGLGPRACIGSRFATLELK

ATLCKVVRGFKIVLCEEAQDLPNMYVPNLVVLPENGIRLKLERRDL

 

>&P450_Is297, 35255.m000038

QRGVVGCKMNFLGVPDWVILVVTALVLLYLYAARYRNYWKEQNVVHENFSLIFAAGKRMLFKPFHR

MDQDRYLQFGKLFG

VYEGGNPMLFVGDPELVKLVLVKDFPSLPNRRMINFFDPLLDNMMSMVPAEKWRRIRPAASPAFSTGKLRK

MNNLIADCA

RKTAQHLEETAEKEGELDLKQ

FYGNYALDVIAGCAFGTRLDSHTEETNEFVAKARQAFSGKITPRLVFFFLLPGLAKLLR

MKSFDSDSFLYFKNLSLQIIENRKKSQS

RQDDFLQLMMDARDGSIAATDEISTSTDEKLFNLDSEMKTDTSFVGGVKA

LTEDEAMAQCVLFFLAGQDTTSSVISFTLYLLAIHPEIQAKLREEVDDCFKKH

GPEPS

LDVVSKLRYLHGVVSESLR

MFPPATRLERSALSDYVLGDTGIKVPKGCVVAVPVYSMHYDPDNFPDPTTFDPE

 

>P450_Is190 VBpre_P006457

Same as P450_Is297

MDQDRYLQFGKLFGVYEGGNPMLFVGDPELVKLVLVKDFPSLPNRRMINFFDPLLDNMMSMVPAEKWRRIRPAASPAFST

GKLRK VCAVTQYTLYKINTISKKMNDLLLGVKSKNRQTTLWPSVYYFCSLLTVNNFQVKDCDFK

FYGNYALDVIAGCAFG

TRLDSHTEETNEFVAKARQAFSGKITPRLVFFFLLPGLAKLLRMKSFDSDSFLYFKNLSLQIIENRKKSQS

VSISSSFT

LTEDEAMAQCVLFFLAGQDTTSSVISFTLYLLAIHPEIQAKLREEVDDCFKKH

VRRLMHLQNKD

LDVVSKLRYLHGVVSES

LRMFPPATRLERSALSDYVLGDTGIKVPKGCVVAVPVYSMHYDPDNFPDPTTFDPE

SMSKLLLYSFAIFGPRNCIGMRFA

LEAVKLSILHSLHSVEFVRTKNTKVS

 

>&P450_Is166, VBpre_P003853

75% to P450_Is297 C-term

MFPPAPRLERSPMEDYVLGETGIKVPKDCVIAIPVYSMHHDPEFFPDPHTFNPE RFIGENASSIRPYTYLPFGAGPRNCI

GMRFALQTVKTCILHAVHNIEFIRTPRTKVPLEFHPGFGILNPKDLTVGLRLRKL

 

>&P450_Is167, VBpre_P003854

41% to P450_Is297

MMTVVPPKEWKKIRSATTPAFTTGKLRKMHDLMEQSAQHLSCKLKNAAEKELDVDMKRFYGHFTLDVTASCAFGSKLGND

SEDTSNFVSSAKNAFFAKITFFVAIQVFFQRFMKTLRRNIFNMDAFEFYKDATISIIQERKKGKQVHDDFLQMMLNAQDE

AASTASEITESSNQEIF

 

>&P450_Is001, VBpre_P000543

60% to P450_Is297

MNALIEDCAKVTAEHLKKAAKNNEDVDIKQFYGHYSLDVIARCAFGTRLDSHTDVTNEFVTRARKAFSGVITLPMILLVL

FPALFNWLKIKPINSDTFVYFKNVCQNIIKNRQQESNRQEDFLQLMMDAQQNGIATAAAENVQETNTQIFNLDSEVKPDS

SFSAKALTEDEAMAQCVLFFLAGQETTSSVIAHAMYMLALNPKIQAKLREERMSVLLHM

 

>&P450_Is284, 26269.m000016

38% to CYP3A7 human

EEWKRIRATLNPIFTSAKMKMVTQIIQNCADEMVEVLADLVQKGEIVDMATVTRGFSMDVITKSALAWQ

VDCQKNPTDPL

LMGVQKVFEDVDNAVIVNAIRFPVLRKILEWLYPYASYYKIINKITENVLNVVKLRRSGQSPRTTDMLQLMLDAQTSGEE

SSVGSGSNATIFEDRHLLSNCF LFLIAGFDTTASSLAFIMHVLAKYPEEQERVFNEISKAFPDGAELTYDGVQHLKRLDM

VVCETLRLYPPVVLFVSRHCTQDTTVSGQFFPAGVNVLVPTWHVHHDPEFWPEPLKFDPERFSEGEKVQSAYFPFGLGPR

VCIGKRFALLEVKLATCNIIRRYRVSKCEQTQDPLRFVVPSVVLNPENGIRLRLQKR

 

>P450_Is182, VBpre_P005167

Same as P450_Is284

VDCQKNPTDPLLMGVQKVFEDVDNAVIVNAIRFPVLRKILEWLYPYASYYKIINKITENVLNVVKLRRSGQSPRTTDMLQ

LMLDAQTSGEESSVGSGSNATIFEDRHLLSNCFLFLIAGFDTTASSLAFIMHVLAKYPEEQERVFNEISKAFPDGAELTY

DGVQHLKRLDMVVCETLRLYPPVVLFVSRHCTQDTTVSGQFFPAGVNVLVPTWHVHHDPEFWPEPLKFDPERFSEGEKVQ

SAYFPFGLGPRVCIGKRFALLEVKLATCNIIRRYRVSKCEQTQDPLRFVVPSVVLNPENGIRLRLQKR

 

>&P450_Is143, VBpre_P003012

66% to P450_Is284

MRIEDRHILASSFSFLVAGFDTTASALAFIIHLLAKYPEEQDRIFSEMQQTFSEEAELTYDGVQQLKRLDMVISETLRLY

PPVVFFISRLCRATTTLMGHLIPAGVNVVVPTWHIHHDPELWHEPFKFLPERFAEGEKHHPAAYLPFGLGPRQCIGRRFA

LLELKFAVCRIVGKYKIYQCERTQDPLKLVVPSVNINPEQGVYVRLKER

 

>&P450_Is174, VBpre_P004812

58% to P450_Is284

LITEKHLLANSFVFLAGGFETTATSLAFLLYELAKNQEEQEKVYKELKRIQRLKEELAYEDIQELKRLDMVISECLRMYP

PLVLFTTRVCTQDITLMGEFFPAGVNVLVPTWNIHHDPELWPEPSQFNPERFGEGEAKHLHHPAAYLPFGMGPRECIGRR

FALLELKIAVCKILAKYRIVPCIETEDPVKLVVPSVVLNPAQGIITQV

 

>&P450_Is123, VBpre_P001957

58% to P450_Is284

VFLAGGFETTATSLAFLLYELAKNQEEQEKVYKELKRIQRLKEELAYEDIQELKRLDMVISECLRMYPPLVLFTTRVCTQ

DITLMGEFFPARVNVLVPTWNIHHDPELWPEPSQFNPERFGEGEAKHLHHPAAYLPFGLGPRECIGRRFALLELKIAVCK

ILAKYRIVPCSETEDPVKLVVPSVVMNPAQGIKLRFKYR

 

>&P450_Is203, 17600.m000007

GPEPTLDVVSKLDYLNCVISESLRLYPPAIRLERSPVEDYVMTDTGIKLPKNCVIVIPIYAMHYDPSNFEDPYKFDPERY

PTTCSHFTLGNHMF

 

>P450_Is137, VBpre_P002111

same as P450_Is203

91% to P450_Is197

MDAQKEALSDGSDPGDAENDVYSLGLDEKSSVAIQRKTLTEMEAMAQCVIFLLAGQDTTSWVIAYTVYLLALHPDVQEKL

RREVDECFEQY GPEPTLDVVSKLDYLNCVISESLRLYPPAVRLERSPVEDYVMTDTGIKLPKNCVIVIPIYAMHYDPSNF

EDPYKFDPER FSEENRGCIRPYSYLPFGAGPRNCVGMRFALQTIKLCLLHAIHSVQFVRTPRTKVPLEFSRNLGLLTAKE

IIVGVKPR

 

>&P450_Is197, 17917.m000019

GPEPTLDVVSKLEYLNCVISESMRLYPPVNRLERSPVEDYVMTDTGIKLPKNHVIAIPVYAMHHDPSNFEDPYKFDPERF

SEENRGCIRPYSYLPFGAGPRNCVGMRFALQTIKLCLLHAIHSVEFVRTPRTKVPLEFSRKFGLLAAKEIVVGVKPR

 

>P450_Is196, VBpre_P007727

same as P450_Is197

FIFQ

GPEPTLDVVSKLEYLNCVISESMRLYPPVNRLERSPVEDYVMTDTGIKLPKNHVIAIPVYAMHHDPSNFEDPYKFDPERF

SEENRGCIRPYSYLPFGAGPRNCVGMRFALQTIKLCLLHAIHSVEFVRTPRTKVPLEFSRKFGLLAAKEIVVGVKPR

 

>&P450_Is032, VBpre_P010192

53% to P450_Is203

YASRYRNYWKSQGVPYEKLSLFFGLTLQRYIKPFHLVDQELYRKHGRLFGVFEDGRPALYVSDPDLLKLVLVANYEDSER

KTGVSCDDSLFDNMVAIAPSEKWRRIRAAITPLFTASKLRKMHNLVQELVIVPTEALINAAREGADVDPTRLYFPTASNV

LSRCTLGKETDCGNDASIDIIHALYVPISFSLIGMYSISVSVRTFMKKVRSKFIRNKAFYFYKELCLNIVKKKQLDTTVS

YHFTLNVGAMYCIVDIALSKHAMNLNFQKALDILKPPFNIKEDSASHKEKSITPQYILFHVAGVEAISGIAALVSYYLAV

HPDVQAKLRDEADDCFAKH GRFPSYDVVSKLEYLDAVVLETLRICPPFTRLERTFNKDYVIGNTDIKVPKDCVITVPIYA

MHHDSDFYPNPESFMPERF LEGNASEINPYTYFPFGYGPRNCVAQTFGLQVIKTILLHAVHEIQFVKTQRTKV

 

>&P450_Is329, 33952.m000042

MMDHIAEGGDVFMGVLGEIADQGKEINMLKPFQGLTMDYIGRAAFGIDTSFQKDLNNPFLIAAQRTLREIMIGPFHMLAH

WLSSSPNGETMAYCKVCKTELRPHIQDLKLHKSRLKHQNNVLLLSKPAAERMDSFVTARPRDTDPVIMYAKEIKAAELRL

AAHVAVHGSFFAADYLAPLQAPYSEVYFQFTSFSKCATVGFDTSATALSFITYALGKYPDVQEKVRQEVNEVLNEGARED

FEYQGIKYKAGTCIMSPVAVIHMDERFFPDPTKFDPDRYY

 

>&P450_Is242, 25404.m000016

WRQKTFSYFKDIGIPGPKPNLLWGNLWEYHEKDLYQAVKKWCKQYGDIFGFYNGDVPMLVVRDLEFLKYVFVKNFSNFTD

RGVTIRTDE

MHPVVGRGLIHVKGSEWKNMRACITSGFSALKLKLMMDHFAKVGDVFMDVLGEIADQGKEVNMLEPFQGLT

MDYIGRAAFGIDNSFQRDLKNPFLITAQRAIREIMTGPFHVLAQCTTSFGVLAAPIFWLSRIFGTFSYKDFGEETAKVIE

LRKKHPELRRNDMLQNLIDAEYEELASTRASSGVSKTRALSSEEVIMNTTILFLGGFETSATALSFITYALGKHPDVQER

VRQEVKEALNEG

GSLDYETVTKRLKYVTQVIDEAMRIWPPGLT

FTTRQAKEDFEYQGIKYKAGTCIMSPVFVIHMDERFFPDPTKFDPD

 

>P450_Is111, VBpre_P006290

Same as P450_Is242

MHPVVGRGLIHVKGSEWKNMRACITSGFSALKLKLMMDHFAKVGDVFMDVLGEIADQGKEVNMLEPFQGLTMDYIGRAAF

GIDNSFQRDLKNPFLITAQRAIREIMTGPFHVLAQCTTSFGVLAAPIFWLSRIFGTFSYKDFGEETAKVIELRKKHPELR

RNDMLQNLIDAEYEELASTRASSGVSKTRALSSEEVIMNTTILFLGGFETSATALSFITYALGKHPDVQERVRQEVKEAL

NEG

VSFI

 

>P450_Is112, VBpre_P006291

Same as P450_Is242

VSARACLFRFGTWANVIFIHR

FTTRQAKEDFEYQGIKYKAGTCIMSPVFVIHMDERFFPDPTKFDPD

RFSEGERRSYPEVCFP

 

>&P450_Is221, 31822.m000008

cyan region does not match ESTs

FETSATALSFITYALGKHPDVQEKVRQEVKEALNEGVSFINTEFTKKLKYVTQVIDEAMRIWPPALT

 

>EW850156 same as P450_Is221

92% to P450_Is242

SFGVLAAPNFRLSQIFGSFSHQDFGEETAKVIELRKKHPELRRNDILQNLIDAEYEELAS

TQTSSGVSKTRALSSKEVIMNTNILFLGGFETSATALSFITYALGKHPDVQEKVRQEVKE

ALNEGGSLDYETVTKKLKYVTQVIDEAMRIWPPALTFTTRQAKEDFEYQGIKYKAGTSIM

SPPFVIHMDERFFPDPTKFDPDRFSEENEGRIPKLAFQPFGMGPRNCVGTRLAYVELAYT

VARMTQHFYWELGESQKGEMPLGTVRHGIDAGKKDLG

 

>&P450_Is067, VBpre_P001528

60% to P450_Is242

FISDCTTSFGPLAAPILWLSRIFGNFSFKTFGEQTAKVIEIRKKHPELRRNDLLQNLIDAEYEDLAPTQTSSGEATSGII

MNSTVLFVGGFDTSATALSFITYALGKYPDVQEKVRQEVNEVLNEGVSLIYSECVCALVFYENIVALDYRVRPLYVQLRY

RAGTSSMHYNFLCTLSMFSLRHLTDCTLGHRAVSYIRVLSLSAFSEENEGSIPKLAFQPFGMGPRNCLGLRLAYLDLAYT

VARMAQNFRWELGESQKAKMPLGQYGMVATPGRGPWIVFHRL

 

>P450_Is171, VBpre_P004272

Same as P450_Is299

MYEAVRKHYKRHGRFYGSYQGLAPSLYVAEPEVLADVFVKKFKSFADRTIGQKLGNSLRQKSIFNLSGDEWKHARYILSP

AFTGNKLKAVXRIVKVTERLTARLIEHAKNGTPAAANE

LLHSCARDTTAAVVFSFDMDSHVDKKHPLMVCFEKLFAEVVPSWKVLLL

FTMPTIFRHLRPKIEAKGDTDDLIHFVGLMADDRRSKQKREDDILQMFLDSGYVDSNGNVVPAVKPPPDGEKP

LTIVDITAQCRLFFVAGTDTVMAAMMALAYLLALNPECQEKAIREIDAAVE

 

>&P450_Is299, 35776.m000023

MPR

LLHSCARDTTAAVVFSFDMDSHVDKKHPLMVCFEKLFAEVVPSWKVLLL

S

LTIVDITAQCRLFFVAGTDTVMAAMMALAYLLALNPECQEKLINEIDAAV

KKDGVTYESIQSMVYLEACAKEAMRMYPAAMFLMRTCTEETTLAGINFKPGMNVDIP

IAGIHYDPEFYPDPESFKPERFLPENKDSHTPYTYLPFGSGPRNCVGIRMGYLIVKVVFACLLQHVKFGTCPETMIPLKL

KPRCLLPLPRRSVMLQVYSRT

 

>&P450_Is300, 35776.m000024

MDSHVDKKHPLMVCFEKLFAEVVPSWKVLLLSLTIVDITAQCRLFFVAGTDTVMAAMMALAYLLALNPECQEKAIREIDA

AVEKDGVTYESIQSMVYLEACAKEAMRMYPAAML

 

>P450_Is172, VBpre_P004273

Same as P450_Is299

MAAMMALAYLLALNPECQEKLINEIDAAVKKDGVTYESIQSMVYLEACAKEAMRMYPAAMFLMRTCTEETTLAGINFKPG

MNVDIPIAGIHYDPEFYPDPESFKPERFLPENKDSHTPYTYLPFGSGPRNCVGIRMGYLIVKVVFACLLQHVKFGTCPET

MIPLKLKPRCLLPLPRRSVMLQVYSRT

 

>&P450_Is187, VBpre_P012044

85% to P450_Is299

LTIVDIAAQCRLFFAAGTDTAMAAMMAMAHLLALHPECQEKLISEIDATVEKDGVTYESIQSMHYLHACVKETMRLYPGA

MFLMRTCTQETTLAGINFKPGMNVDIPVVGIHYDPEFYPDPESFKPERFLPENKDSHTPYTFLPFGSGPRSCVGMRLGYL

TVKVVMVCLLQHVKFGTCPETMV

 

>&P450_Is306, 35326.m000027

MADLIWKVLASPLLLLVPSILLFWAFRRRRAHGLFRRNGIPGPEPELFWGNWKQLKKNRIQVLQQWIEEYGQVFGFFMAE

KPWMVVTDLDLVRQIFVTEANTFTDRPQYVIDVEPFTSALPFLPGDEWKKVRPVLNTSLTAGKMNLLSGIVSECAREFLE

VLRKHHERKDVVNFVEAAEGYALDVITRVGLTWNTKCQQKSDDPLLLGLRWIFEDLDKTAVENTLAQPGIRTILRHLYPL

TSFSKVLSRIAKNVRDTAHKRRQGQAPREKDILQAMLDAQDGVEDKECDS

CLPLEHGAWRKNGIHKNGLLIED

RHLTSNS

IMVLIANFETTSATIGFTLHLLATHPEEQDKLFLEIDAMLPQTSETSLNNLQNMTRLDMVVKESLRLYPPIPILVTRVCP

RDTTVMKQFIPAGTMVVAPAWHIHRSPQFWNNPSRFLPDRFAQDQPERHPFAYFPFGLGPRSCFGKRLAVLQVKTAIVEI

LRNYRVLPCGETVDPIRVTVPNVLLRPVGGIKLRLASRR

 

>P450_Is064, VBpre_P011804

Same as P450_Is306

MADLIWKVLASPLLLLVPSILLFWAFRRRRAHGLFRRNGIPGPEPELFWGNWKQLKKNRIQVLQQWIEEYGQVFGFFMAE

KPWMVVTDLDLVRQIFVTEANTFTDRPQYVIDVEPFTSALPFLPGDEWKKVRPVLNTSLTAGKMNLLSGIVSECAREFLE

VLRKHHERKDVVNFVEAAEGYALDVITRVGLTWNVSACQQKSDDPLLLGLRWIFEDLDKTAVENTLAQPGIRTILRHLYP

LTSFSKVLSRIAKNVRDTAHKRRQGQAPREKDILQAMLDAQDGVEDKECDS

Y

RHLTSNSIMVLIANFETTSATIGFTLHL

LATHPEEQDKLFLEIDAMLPQTSETSLNNLQNMTRLDMVVKESLRLYPPIPILVTRVCPRDTTVMKQFIPAGTMVVAPAW

HIHRSPQFWNNPSRFLPDRFAQDQPERHPFAYFPFGLGPRSCFGKRLAVLQVKTAIVEILRNYRVLPCGETVDPIRVTVP

NVLLRPVGGIKLRLASRR

 

>&P450_Is159, VBpre_P007985

57% to P450_Is306

VMGQFIPAGTTLIAPAWHIHRNPEYWPEPSRFPPERFAEGHPERHPMAYFPFGIGPRTCIGRRLALIELKMSICKILRDF

KLVPCEESQYPVPLVVPNLTLRPGVGLRVRLEMR

 

>&P450_Is070, VBpre_P008383

58% to P450_Is306

TLRLYPPVPLLVARTCLLDKTVMGQFIPAGTTLIAPAWHIHRNPEYWPEPSRFLPERFAEGHPERHPMAYFPFGIGPRTC

IGRRLALIELKMSICKILRDFKLVPCEESQYPVPLVVPNLTLRPGVGLRVRLEMRRKCKD

 

>&P450_Is050, VBpre_P005615

64% to P450_Is306

LIEDRHVIANSIVLLIAGFETTAMVIGFTLYLLATYPEEQEKVHSEIDTVLPYDDEISLDSIQNLKRLDMVINETLRLYP

VLPIMIARLCPRDMTVRDQFIPAGTSVFAPAWHIHRDPESWPEPSRFLPDRFAEEHPERHSLAFIPFGLVPRYCFGKRLA

LLEVKMALCAILRKYRVIPSEETVNPISVTVPSVTLRPVGDIKLKFENKAER

 

>&P450_Is145, VBpre_P003017

45% to P450_Is306

MRVKAVAKFSLCSSFQFGMETALWMIWIFASTLLATCGVIWVLKRRYRHGFFKRLGIPGPEPELLFGNWQQLRKDRINVM

EDWIQKYGKTFGYFKGAVPFFIISDVEMIKQCVVKEAQTFYDRPEPSISIQPYIQTLLFLK

 

>&P450_Is251, 28718.m000008

NLSKYLCWMLYLLAKHQDVQKKVKAEVQKILVTEGAINYGTVTKMQYLEQALKEGLRMHSSPS

GFVTRLAEKDIDTGSVVIPKGVSILIPTYILHKDSELWEDPERFDPE

RFAPGNNKPVEVDSIAFQPFGAGPRNCFAMMFSKVILMLLLAKVLSEYRL

VLNDDHHKVSA

 

>P450_Is148, VBpre_P013768

Same as P450_Is251

MMTMLSSNHPVRKLHMFNATGRKWKTIRSVCTRAYNSVYIKKMSHLLELCTDEFLEALEATADKGEQFDTVSMCRAFAAS

AMLRTAFSFKMDEQDKTGRDISKCVDKLTLRNIALFDGGLLHWLSNCFPEFTRLIQLALRIAEYIKPPGMCEVLDAIAPI

IYTRKLNQSEIRSTDLLQFMVDAAAPNSGCPGPSDPLTTSSRDKTTGDSMEGNAELPSEWLLSDAEILSNASLVLSV

GFVTRLAEKDIDTGSVVIPKGVSILIPTYILHKDSELWEDPERFDPE

 

>&P450_Is158, VBpre_P013243

47% to P450_Is251

MDNWRLIFGVEDALWRRRASIHLEHLDYVFRHNPPKHKRFSATRGERRVQVGGESGNGPIAAFKDWTDKYGDIVGFYNGA

VPTLLVRNLDLIKEIQISKFKSCNPRGMSTVIEKSADSYLKVLESVVAPGKAIDVFPIHRLMAADVILRTMFSFNVDGQG

RSLKCLQDAVIKPVANIRVFKDGWLHWLSSTSVSRFVEEDIEWKGLTIPKGISVAIPSHMLHHDLDLWQEPDVFDPDRFS

PERKASVNYTAFQPFGAGPRKCFAEEFSKRAVTFLVAKTLEHYRVDLSTDHHKRGVSETHCPRGQGFAVEHASFASLRLT

ADDHAYFRITASGISLSRDQFCVLPTAP

 

>&P450_Is272, 34530.m000468

MWVLVCTALTAVTFTLFYLRRRQRFSLFKNTGIPGPAPSLFTGNISELIEKGAVRLFEEWVNKYGDIVGFYNGVTPMLIV

KDLDLIMKIQIKDFGNFHGRGVTAKILREHQKSKLKLIYVDGDRWKEMRSLLTPAFTSSNMKKISSVMDTCTDEFMEVVD

SLSDQDKAFEMWRVYRKLSMDVIVRSAFGVESTFRKIRALPV

 

>P450_Is183, VBpre_P011188

Same as P450_Is272

MWVLVCTALTAVTFTLFYLRRRQRFSLFKNTGIPGPAPSLFTGNISELIEKGAVRLFEEWVNKYGDIVGFYNGVTPMLIV

KDLDLIMKIQIKDFGNFHGRGVTAKILREHQKSKLKLIYVDGDRWKEMRSLLTPAFTSSNMKKISSVMDTCTDEFMEVVD

SLSDQDKAFEMWRVYRKLSMDVIVRSAFGVESTFRKIRALPV

 

>&P450_Is080, VBpre_P009104

54% to P450_Is272

MAAPVWVAFLAVLVVWYFFWRKRKLAVFKTLGIPGPAPSFFTGNMSEILKKGSVVTFSEWIKQYGDLVGFFNGGTPVLIV

KNVDLLKKIQIKDFGNFTCRGVVSAVSKNHNLSRRALTNVPGERWKEVRSLLKPAFKASNMKQVKPF

 

>&P450_Is331, 18819.m000045

FTTRRALEDYAYGDLVIRKGTSVLASTYQIHHDPMLWPEPDKFDPERF

 

>P450_Is022, VBpre_P001233

same as P450_Is331

42% to P450_Is225

TLFISSRTLLYSSTHAQMMPAMHHAVDCFLNILDGYAERGQELDMSAVSAQLTFDVIGKTAFGIDTKVQDSMDNPLYRAA

IDAHPYLMSGAIYNLARKSKALSSSEEPIPWLVFSITPSKMEKMSQQLLTLVTLRRSLFQIKKVDLLQNLLEAVLPSGGE

SEVEQNGKTKNNGLYHIVSGVHRYDTTRLTLSYWAFLMGKHPDVQEKMRTEVMQAAQNGPLAYEDITGLVYTQQVLNETM

RLHPAVVAFTTRRALEDYAYGDLVIRKGTSVLASTYQIHHDPMLWPEPDKFDPERFSPENKASIPANAFLPFGVGPKHCL

GQRLAQLELAFITAMLLRRFRITLGPSQKPDVEYVTYAMLAAPKNGVWIKLQKLEA

 

>&P450_Is275, 20832.m000013

LRRSGISPDVPDMLQL

MLDAQTEKGSSADDHDENEPLIEDRLLIANCFIFLLGGFDTTAVALAYIMHNLAKYPEEQDNIL

REITEAFPDKKELGYDELHRLKRLEMVISESLRLYPVIVTFVSRNCQQDITVMGQFIPAGANVTLPVWHLHHSAEHWPDP

LKFDPERFSEDKGKPHVGAYLPFGLGPRACIGKRFAMLELKATVCKVLRSFRVVQCEETQDPLKVVVPNATAYPKDGVKL

KLELRNP

 

>P450_Is173, VBpre_P004745

Same as P450_Is275

MLDAQTEKGSSADDHDENEPLIEDRLLIANCFIFLLGGFDTTAVALAYIMHNLAKYPEEQDNILREITEAFPDKKELGYD

ELHRLKRLEMVISESLRLYPVIVTFVSRNCQQDITVMGQFIPAGANVTLPVWHLHHSAEHWPDPLKFDPERFSEDKGKPH

VGAYLPFGLGPRACIGKRFAMLELKATVCKVLRSFRVVQCEETQDPLKVVVPNATAYPKDGVKLKLELRNP

 

>&P450_Is258, 30497.m000022 (fusion of two P450s)

MLQLLLDAQAGKDSDTVDADKTECDGGFVISDDKLLANSFILLIAGFETTATSLGFIMHLLSQHPDEQETLHAELVAASP

NERLDYERLMRLQRLDMVVQECLRLYPPVVLLLSRACRADTTILGQFFPKGVNIMVPVWHIHHDAELWPDPFKFDPESFT

TAKMKMMTQIMQKSADEMLEVLDDHVKSGHMVDMVKISQAFALDVIAKCALAWE

 

VDCQRNPSDPLLLAVQRIFNDSDNFL

ILSAVRFPALRKAMERIFLYSSYFKMITHISDKILKVLELRQSGQSPRANDMLQLMLDAQTGSEDANVDFKKRAKAIEDR

HLLANCFIFLAAGFDTTASSLSFVMHLLAKYPEEQELVFDEIQKTFPGDAELTYDGLQQLKYLDMVICETLRMYPPVVMF

TSRHCKEDTMVMGQLFPAGVNVLVPVWHIHHDPELWPDPQRFDPKRFDGEKSRNSAAYLPFGIGPRMCIGKRFALLELKL

AICKIVRKYKVFPCEQTQDPLKFSVPTVVLHPKSPICVKLQQR

 

>&P450_Is202, 17643.m000035

MQVTSAVNR

QHQVSKFNLINVDGERWKDMRSLLTPAFTSSNMKKMLPLLDICTDEFLEVLDSLHEQEKAFEIREVFQKLS

LDVIVRSAFGVQSNVQKNPGTTGMNAIVK

VILDGSTNSARAGWSFLLVTRTIFETTSTALTFTTYLLAKFQDVQDRLRSE

ISDVLERDGKFNYDNVFSMRYLDQVITESLRFYPPLTG

 

>P450_Is146, VBpre_P013737

Same as P450_Is202

YIDMYPFKSHIGTLFINHEYQFKDGWLMTCKPYYEDAKTYIAVQVDFFPKVATTMNIKSELKDQKLVNIELHDGVHYSKS

DIPIEPSPMLLVKDLDLIKKIQIKDFGNFHGRG

QHQVSKFNLINVDGERWKDMRSLLTPAFTSSNMKKMLPLLDICTDEF

LEVLDSLHEQEKAFEIREVFQKLSLDVIVRSAFGVQSNVQKNPGTTGMNAIVK

ARRQDLLHLMLNAEVQEGEAVNVHQFT

AGNDGEAPKSAESSMSARKHRCLSNAEVQANAVLFLVAG

 

>&P450_Is186, VBpre_P009505

33% to P450_Is202 C-helix to mid region

47% to P450_Is146

MTSIILRTHKITKMNLQHASGDHWKNMRKVITRQFTPSRLKKQATLMDQCCSEFMEILESLHAQDEAIEVHSAFQRLSLD

VMLLSLFGGEGRTAIGREEAGPEIIKRELKNFMASLGNGWQRFIIDCFPEFSLLMRGLLFLRGYFMKYAVDKIQDEMSKM

ISQRLSSSTGGQDDLLQLLITAQTDVGAAATNQRLAMSNGTERSDHAQLNRGGERRGTLSVSEVQANVHSELVDR

 

>&P450_Is236, 18704.m000251

MDSTAALMYGIDLDSFGDLDHPLLHCCEKLFSSVASWQLVMLFTMPSVYKLLLPGYPPKESTEALRKFVSLMIEEKQ KKQ

SKDDDILQMLLDTDCGEGDRKESGAKGDILGKG AMTLDEITAQALLFFVAGTDTVMSSMTYATYFLALNPQCQERVLAEI

DAAVEKRGVMYESLQDMPYLEACIKETMRLYSPDSVTMRMCTNETTVAGVRFKPGMNIDVPIAGVHYDPEFFPDPEKFQP

ER

 

>P450_Is179, VBpre_P007692

Same as P450_Is236

LCLFKTSTLIIFRFRCRKIRRTFTFWNDKGVPYQTFWQYLRVVYDLYTKPLHEVVRKNYETYGRVYGSYQGIVPTLVVGD

PDLLSDVLVKDFKSFSDRTEAQKVGNEVWKKLIMNLSGEEWRRARNILSPAFTSTKLKTIFFKLYHIAGRAVTRMENAAM

GEQPLAVNEVFENCA

MDSTAALMYGIDLDSFGDLDHPLLHCCEKLFSSVASWQLVMLFTMPSVYKLLLPGYPPKESTEALRKFVSLMIEEKQ

 

>P450_Is178, VBpre_P007691

Same as P450_Is236

PVSTWFIQPSVSRLNA

AMTLDEITAQALLFFVAGTDTVMSSMTYATYFLALNPQCQERVLAEIDAAVEKRGVMYESLQDM

PYLEACIKETMRLYSPDSVTMRMCTNETTVAGVRFKPGMNIDVPIAGVHYDPEFFPDPEKFQPER

FLPENKGNLKPLTFL

AFGAGPRNCVGMRLGILQVKVALACILEHVRFETCKET

 

>&P450_Is244, 25498.m000014

MTDE

QVMERWIKQYGKVFGYYLGEIPYIVITDVDLIKEIFLKRASVFCDRPQQLVNVEPFKSCIIGLEGQEWKKVRSVLN

PIFTG

SKMKLMTQIMASSADVMLEILDNAVSKAESVDMFRVARGYSMDVITKCAFAWQ

 

>P450_Is162, VBpre_P009238

Same as P450_Is244

MTTVLADVSFWTTLGLGALVLIATGLCFWVLHRRRLHDVLRRNGIPGPEPSLLIGNWTELKKDPV

QVMERWIKQYGKVFG

YYLGEIPYIVITDVDLIKEIFLKRASVFCDRPQQLVNVEPFKSCIIGLEGQEWKKVRSVLNPIFTG

 

>&P450_Is110, VBpre_P005342

61% to P450_Is244

MEHWIKEYGKVFGYYVGGVPHMVLTDVEMIKQCFVRNASTFHDRPPLPICTGPFASCIIALEGDEWKKIRAVLNPCFSAS

KMKLMTQIMGSCADAMIEVVEDHVKKGETVEMYRVSQGLSLDVIAKCAFAWQVDCQKNPNDPLLLSIRKMFVEADDGILR

HAIRFPILCKIITSLISFTSYIKTLTRIFDTSSVIELREK

 

>&P450_Is324, 33403.m000007

FISRTCKKDYDYNGLTIPAGISVIIPASSLHRDPELWSEPKKFDPERFSSDNKGSLNPITYQAFGNGPRSCMGMRFGQTA

LKLALGKILAKYKLHLDDRHLK

 

>&P450_Is198, 17843.m000016

MALTHPLHLQQYVELSSGIPTNDEKLSRLYGARWRELRTLISPAFNSSKLKRVPHTPRRVPKMTPFATVANAELFMISGL

ETVSSALSFTAHLLAKHQDVQDKLRAEVKLLLEKDGNFSYDNIFSLQYLKQVIAESSRFYPAQPGNVTRRCVKDFEFNGF

RIPKDTHVLVPVHLMHHDPRYWVEPEKFNPDRFSPENKSTIEPMAYIPFGIGTRNCPASRLAEFELSLVIAKTVAKFKLH

LCDEPEKASRF

 

>&P450_Is260, 19432.m000017

LDRTTPSEYVLGDTGIKVSKDCVISVPVYAMHYDPEYFPDPTTFDPRRFSDENIDKIRPYTYLPFGAGPRNCVGMRFALE

AVKLSLLHSVHSVQFVRTENTQV

PLEFVAGFAAFKAKHITIGIRKRIE

 

>P450_Is040, VBpre_P007140

Same as P450_Is260

MWITSVFFAYFMFSFR

LDRTTPSEYVLGDTGIKVSKDCVISVPVYAMHYDPEYFPDPTTFDPRRFSDENIDKIRPYTYLP

FGAGPRNCVGMRFALEAVKLSLLHSVHSVQFVRTENTQV

NLASRYDFSFSTRCPQGEQTTCVF

 

>&P450_Is199, 25876.m000009

EEWKKVRTVLNATITASKVNRCSRIVSRCAEELLRVLKRHHERDELVDIMDMAEGYSLDVITKCALAWKVNCQQKSDDTL

LLGLRRIFEDLDSTVIESTLALPGIRSILKLIYPFTSVSKMLRRIAENVREISTSGVKDKAP

 

>&P450_Is246, 25548.m000013

45% to CYP3A7 HUMAN

LDAVSKLKYLHGVVSESLRMFPPGARLERTASNDYVLGDTGIKVPKGCVIAVPVYAMHHEPDYFPDPATFDPSRFSDENI

DSIRPYTYLPFGAGPRNCLGMRFALEAVKLSLLHSVHSVQFVRTENTQVPLEFVAGFGSLNAKHITLGIRKRTA

 

>P450_Is141, VBpre_P007330

same as P450_Is246

LNYFKNICLKIIENRKENKSRQEDFLQLMMDAQDGKVTATVENASSTDEKLFNLDSEIKTDTSFAAGVKDEHQLARSTFI

FLDKIYNANHNSGLHVLLLILFIATEVMCYFTEIISVRSIDLHHPS LDAVSKLKYLHGVVSESLRMFPPGARLERTASND

YVLGDTGIKVPKGCVIAVPVYAMHHEPDYFPDPATFDPSRFSDENIDSIRPYTYLPFGAGPRNCLGMRFALEAVKLSLLH

SVHSVQFVRTENTQVPLEFVAGFGSLNAKHITLGIRKRTA

 

>&P450_Is086, VBpre_P010989

74% to P450_Is246

MFPPASRIERSAIEDYVLGDTKIKIPKGCKIAVPVFAMHYDPEYFPDPHAFVPERFSAENVTSIRPYTYLPFGAGPRNCI

GMRFALQAVKLCLLHSVHSVEFVRTEKTKVPLEFSKGFGILSAKDVTVGIRERPQ

 

>&P450_Is321, 27092.m000009

EEWKKVRTVLNATVTASRVNRCSGIVSGCAKELVRVLEGHHERDELVDIMDVAEGYSLDVITKCALAWKV

 

>P450_Is125, VBpre_P006892

Same as P450_Is321

EEWKKVRTVLNATVTASRVNRCSGIVSGCAKELVRVLEGHHERDELVDIMDVAEGYSLDVITKCALAWKV

NCQLKSDDPL

LFGLRRIFEDLDSTAIESTLALPGIRGILKLIYPLTSLSKMLHRIAENVRDTVEKRRLGQSPREDDMLQMLLDAQAGVED

KTYNVQKSGLLIEDRHVIGNSLVLLVAGFETTATAIGFTLYVLATNPEEQEKVHSEIDAVLPFDDEISLDSI

 

>&P450_Is319, 28303.m000005

FSNENMGSIRPYTYLPFGAGPRNCVGMRFAIQMVKLCLAHAVHNVRFVRTAKTQ

 

>&P450_Is250, 19037.m000009

LKLINVDGDRWKHLRSLLTPAFTSSNMKKISSVMDACTNDVMEVLDSFSNQDKAFEMGEVYRRFSLDVMLRSAFGVESNI

QKNQGITG

 

>&P450_Is327, 33924.m000009

FCSRSFQTTSVTLSFMSLLLAMHSEVQEKVRQEVKAAIGSSGCLDYDTTIHKLKYTTQVMNETLRLYPPSLT

FHTRIAKESFEYNGTTFKAGTCILAPVSQIHRDPQYWPEPNKFDPDR

FSPENKGSYRKNAFQPFGVGPRCCVGYKLALVQALYITARMVADFKIELGEAQK

VFFV

 

>P450_Is037, VBpre_P003489

gray = same as P450_Is327

SPSKV

FCSRSFQTTSVTLSFMSLLLAMHSEVQEKVRQEVKAAIGSSGCLDYDTTIHKLKYTTQVMNETLRLYPPSLT

VSPLRSPSTCIHSSISYPAYCLAFAICTYFITPSYLFLSNSANIFFG

FSPENKGSYRKNAFQPFGVGPRCCVGYKLALVQALYITARMVADFKIELGEAQK

GVIEMRSSGMMAAPGNGPWIKFTRL

 

>&P450_Is292, 34813.m000011

LETIASALSFTAHLLAKHQDVQEKVRAEVKSLLEKDGSVHYDNISRLQYLSQVISESLRVYPPIPGQVNRKCVKDFEFNG

FRIPKDTLIQVPVRLIHHDPRYWANPEDFNPD

 

>&P450_Is286, 33194.m000007

GNLNYDNIFSLQYLKQIIAESARFYPVQPGNITRRCVKDFEFNGFRIPKDTNVVVPVRVMHHDPRYWEDPEKFDPE

 

>&P450_Is270, 18906.m000014

LSEVEVLAQCVVMFLSGQDSTSSVIAHTVYLLALHPDKQMKLREEVDRCFSSHV

 

>&P450_Is268, 26838.m000018

MVPVLNACAWDTVQSFCDVAAKGVPYDVKQ

DQILAQAVLFFLAGVDTSANTLAMSAYHLALNQDVQARLVEEIDQVLLTH

KDITLDVVMGLPYLDAFVMEVLRISGPVTM

FLGDNRKLIQPFTYLPFGEGPRQCVGMKFALFKVKFCLFHVLSKISFQVCPETD

IPPTHQPVILVMIPETVTLKVTRRKPAAVHCALLSE

 

>P450_Is073, VBpre_P008435

same as P450_Is268

VLSR

DQILAQAVLFFLAGVDTSANTLAMSAYHLALNQDVQARLVEEIDQVLLTH

VSARTAHETANLETKNWRIVNVSSAHTLSTSVHRFPER

HHARRCHGPAIPGCVRDGSAAHQRACHDYLFFAFYVCR

FLGDNRKLIQPFTYLPFGEGPRQCVGMKFALFKVKFCLFHVLSKISFQVCPETD

VSYLFDTHLVLSSQNVITYVKKKKSTQK

 

>P450_Is014, VBpre_P006205

same as P450_Is268

LHHDQRYFPDPEVFDPGS

MFLGDNRKLIQPFTYLPFGEGPRQCVGMKFALFKVKFCLFHVLSKISFQVCPET

EVSYHFATAFQRRIASLITARHIISLS

 

>&P450_Is195, VBpre_P001090

40% to P450_Is330

VSNATGNPLWDRMMLNSPEEEWKATRTMMSPAFTTSRLKAVSNQFEPPSVSNIFTSFHKKKKKKRQKRNRMMFESFAMDT

TAALVYSLDLNTHENLDHPLVKCCKGFFGNLGGWKMILL

 

>&P450_Is252, 28873.m000008

IEDIAAQCMLFFVAGSDSVTLALTWTAYSLALHPECQEKVIEEIDNAVKQVSSQLV

 

>P450_Is151, VBpre_P013808

same as P450_Is252

76% to P450_Is330

SYEGFVPTLVVGDPVLLRDIYVKDFKSFSDRIRFEDVLQLCLDAVMSGRSPDNFKISE

IEDIAAQCMLFFVAGSDSVTLALTWTAYSLALHPECQEKVIEEIDNAVKQ

NGVTYESLKDMPYLEAAINETLRLYTADSL

 

>&P450_Is234, 31356.m000015

FETIS

AAMTFMAYILAKHQDVQDKLRTTIIKALDKNMESYVETILRIEYLDQVTLEALRLYPPVAGFITRTCEKDYHYKG

LKIPSGMTILIPVHQLHYDLNLWNQPEAFDPDRFSACNKSILNSVQYQAFGNGPRRCMGMRFAQLELKIAFAKILANYSL

FLDERHIGEDQLKLKTSFIFANPRDGVWIKLKKVSRQSCDNKAS

 

>P450_Is005, VBpre_P001192

Same as P450_Is234

AAMTFMAYILAKHQDVQDKLRTTIIKALDKNMESYVETILRIEYLDQVTLEALRLYPPVAGFITRTCEKDYHYKGLKIPS

GMTILIPVHQLHYDLNLWNQPEAFDPDRFSACNKSILNSVQYQAFGNGPRRCMGMRFAQLELKIAFAKILANYSLFLDER

HIGEDQLKLKTSFIFANPRDGVWIKLKKVSRQSCDNKAS

 

>&P450_Is232, 24295.m000013

FVTRLVE

NELDVGCVKIPEGVSIIIPTYLLHHDPELWQDPTSFNPERFCPEHFEHEDAGAFQPFGAGPRNCFAMAFSKNV

IMLLTAKVIAKYRLVLTQSDHE

VSFALF

 

>P450_Is155, VBpre_P013170

Same as P450_Is232

MPVRSQPVTERTLKTSSSSDKWRQSTSDTRDDGTRCRVVPRSGCRTTETGVSRGSASHWPSDGEMVDFDRRYGRRVEQLS

HGAAVGCCSLAGMAADGETRAMQKPGLATLRCEVAREKIPKPRSQEKDPEHLWPLRPRNGWTARRREEQRQ

NELDVGCVKIPEGVSIII

PTYLLHHDPELWQDPTSFNPERFCPEHFEHEDAGAFQPFGAGPRNCFAMAFSKNVIMLLTAKVIAKYRLVLTQSDHE

 

>&P450_Is105, VBpre_P008177

82% to P450_Is232

HGVSSSRHLCIFRFVTRLVEKELDAGCVKIPEGVSIVIPTYLLHHDPELWQDPGSFDPERFRSETFEPGDAGAYQPFGAG

PRNCFAMAFSKKAIMLLAAKVVAKYRLLLTRADHEADLTDDDMEDLLVLGHVKRGLYAKFEKY

 

>&P450_Is230, 18866.m000097

AEKSTKINQKRRMTTEEIQANASTFLIAGFETTGTTLAFSAYLLAKHPDIQDKTREEVKSIIEKE NGLTYDGVFSMRLLD

QVISEVLRLYPPVVGFITRRCDNEYEYEGLKIPSGITVVVPAYQLHHDPEYWENPEEFDPERFSPENKDKIEPMAYQPFG

NGPRNCVAMRFGQLTLKMTLAKLLSKYKFTLDEERHKNGLKIGSSFTLAYPEGGVWIYINEL

 

>P450_Is079, VBpre_P009103

same as P450_Is230

MQ NGLTYDGVFSMRLLDQVISEVLRLYPPVVGFITRRCDNEYEYEGLKIPSGITVVVPAYQLHHDPEYWENPEEFDPERF

SPENKDKIEPMAYQPFGNGPRNCVAMRFGQLTLKMTLAKLLSKYKFTLDEERHKNGLKIGSSFTLAYPEGGVWIYINEL

 

>&P450_Is228, 29385.m000008

SWPEPSRFLPDRFAEDHPERHPLAFIPFGLGPRSCFGKRLALLEVKMALCEILRKYRVIPSEETVDPIPVTVPNLLLRPV

GGIKLKFESKAER

 

>&P450_Is222, 31953.m000007

LTEDEALAQCVLFFTAGLETTSTTIAFAVYQLAVCPDIQDRLRQEVDDCFAKHGPEPSLDAVSKLKYLHCVVSETLRMYP

PAL

 

>&P450_Is012, VBpre_P009903

84% to P450_Is222

MVDAQESGITEVGSDGVQDMENSLYNLGSEQKSETSFITKS

LTQDEALSQCVLFFTAGFETTSTTIAFAVYQLALCPDIQ

DRLRQEVDDCFEKHVSLPNTS

 

>P450_Is188, VBpre_P012068

Same as P450_Is213

IMLPFSMEISTLTVVVALIVVTAMSALLWVLNRRHRHGLLRRYGIPGPRPDLLDGNYAQLKENRIEVMERWIKEYGKVFG

YYVGDIPYIVLTDVEMIKQCFVKEASTFHDRPPFPVVVEPFLSSIVGLEGDEWKKVRTVLNPSFSASKMKLMTQIMSSCA

DATLEVVEDHVKKGEVVEMLRVRITMSAEDRTMLPFEDV

VDCQKNPNDPLLLSVQTVFHDVENSSFQQVIRFPILSKIIS

RLFSFTSFGKMTTRVCDNIRHVIELRRTRQSARTTDMLQMLLDAQAGVEDSTKVTGQVKKLVEDRHLIANCFVFLIAGFE

TTASSLAFTIHLLAK

YPEEQDRILDELNEVFPEENQELTYDGIQQLKRLDMVLCESLRMYPPVILFVSRVCLEDTTVMGQ

FFPAGTNIVVPTWHIHYDPDLWPEPFKFDPERFAEGKNTGHSAAYLPFGLGPRVCIGKKFALLEIKMALCKLIRKYKIRQ

CEETQD

 

>&P450_Is213, 22759.m000029

MCKCWIGLNS

VDCQKNPNDPLLLSVQTVFHDVENSSFQQVIRFPILSKIISRLFSFTSFGKMTTRVCDNIRHVIELRRTR

QSARTTDMLQMLLDAQAGVEDSTKVTGQVKKLVEDRHLIANCFVFLIAGFETTASSLAFTIHLLAK

TFQV

 

>&P450_Is214, 22759.m000030

MERWIKEYGKVFGYYVGDIPYIVLTDVEMIKQCFVKEASTFHDRPPFPVVVEPFLSSIVGLEGE

 

>&P450_Is109, VBpre_P005340

75% to P450_Is214

MDISTLAVVMALFAVMVVTAVWWVLKRRHQHGLFRRHGIPGPRPDLLDGNWAQLKEDRIEV

MERWIMEYGKVFGCYVGGVPHMILTDVEMIKQCFVRNASTFHDRPPFPICTGPFASSIVALEGD

EWKKVRAVLNPCFSASKMKLMTQIMGSCADVMIEV

VEDHVEKGETVEMYRVSQGLSLDVIAKCALAWQVDCQKNPNDPLLQSVRKMFQEIDDSVLRQAIRFPILCKIISSFLFFT

SYNKTLTGIYDNVRHVVEL

 

>&P450_Is029, VBpre_P005781

73% to P450_Is214

MDISTFTVVAALIAVTAVTAVLWVLNRRHQQGLFKRHGIPGPRPDLLNGNWAQLKEDRIEV

MERWIKEYGKVFGYYIGEVPYMVVSDAEMIKQCFVKEAYTFHDRPRFLISVEPFASCIIMLQGEEWKKVRTVLNPSFSA

 

>&P450_Is212, 18444.m000030

GLPEFSVVWKMLHSLVLSLGLHPLARLRKIYRRLMTENDFPADPEKSDLVTLMLHAAAEAKAQPGSQPANDAPNQEKFRY

DTE

MESNALIILIAGSVPICKALSSCAFFLAKYQDIQKKARAEVEAALAQDGKLTFDNISAMRYLKQVLLESLRYTSSAF

GFNTRITGQEHSYKGLTIPKGVTVVVPSFDLHNDPDLFSKPELFDPERFDGKGKSAEDTAALQVFNNGLGTCVGMKLAQV

EIVLALASLLAEYRLVLDETRHTGGRQESHMIARNFKNPEIWIKFENIVKPSASSNGTAFN

 

>P450_Is025, VBpre_P011039

Same as P450_Is212

MESNALIILIAGSVPICKALSSCAFFLAKYQDIQKKARAEVEAALAQDGKLTFDNISAMRYLKQVLLESLRYTSSAFGFN

TRITGQEHSYKGLTIPKGVTVVVPSFDLHNDPDLFSKPELFDPERFDGKGKSAEDTAALQVFNNGLGTCVGMKLAQVEIV

LALASLLAEYRLVLDETRHTGGRQESHMIARNFKNPEIWIKFENIVKPSASSNGTAFN

 

>&P450_Is207, 29693.m000013

IKVQKKLTPTEVYVNTGVLLIAGFGTTSVALSNLSFVLAKYPEVQDKVREEVNAAMRKHGRINYAAVTEDLKYLSNVVDE

TLRIYPVVVA

FNTRSALNDFEYEGVKYKAGLSIMSPTIEIQKDPRFWPEPEKFDPDR

 

>P450_Is121, VBpre_P013900

Same as P450_Is207

MTGTFYNGDVPTLVVKDLDFLSYVFIKNFSNFMNRGPRSMDILQIMLEAETDESFEETEVKNGE

IKVQKKLTPTEVYVNT

GVLLIAGFGTTSVALSNLSFVLAKYPEVQDKVREEVNAAMRKHGRINYAAVTEDLKYLSNVVDETLRIYPVVVA

 

>&P450_Is206, 21755.m000024

ENIRRLSEEEVVLLTTVLFLGGFQTTSITLSFMSLLLAMHPEVQEKVRQEVKAAIESS

GRLDYDTTMHKLKYTTQVMNETLRLYPPSLT

 

>&P450_Is115, VBpre_P006308

77% to P450_Is206

MNDAFQALSLDFVCRAAFGMDTDFQHNLACPFYVKAKNIVPGMMKGFFHAVAQSSTTLGKVMKPFFWLNRMLGNFSMEIF

AREMKKVVKLKTQNEVTRQRDMLQNFLEAEVHAIQPKNGMTLKNNNISETGNKL

EDVGHLSEEEVVLLTTVVLVGGFQTTSVTLGFISLLLAMHPNIQEKVRGEVKAAIESS

VTIFLFNSKYSAIDNIQAP

 

>&P450_Is318, 28153.m000007

GCLDYDTTIHKLKYTTQVMNETLRLYPPSLTFHTRTAKNSFEYKGTTFKAGTCIMAPVMQLHRDPQYWTDPNKFDPD

 

>&P450_Is323, 32914.m000009

DKKRSLDNAEIQANAIVFLMAGFETTSTALTFTTFLLAKFQGVQNRVRSKITAEVERD

 

>&P450_Is253, 22885.m000008

LERYGPSDYGLGDTGIKIPKDCVIAVPVYAMHHDPDYFPDPSKFDPDRS

 

>&P450_Is245, 25532.m000011

MIPYMSQVADIFVEILGEKADEGKEYPMLCLFQGLTMDYVGRAAFGFDCTFQRDLKHPFLRTAQSVLPGVMTGPFHFLA

 

>&P450_Is241, 27427.m000011

MKFLGVPDWIILVVTALVLLYLVYEGGKPVLFVADPELVKLVLVKDFPSLPNRRVVNLFDPILDNMMLITPVEKWRRIRP

AVSPAFSTGKLRKVCVQLYVLFPGIFKLLGMRAFNSDILDYFKNICLKIIENRKENKS

 

>&P450_Is240, 24024.m000011

LIRRCTQETSVAGIKVHPGMSIEIPIRGVHRDPEFFPEPECFKPE

 

>&P450_Is237, 24514.m000011

CTQETSVAGIKVYPGMSIEIPIRGMHRDPEFFPEPECFKPERL

 

>&P450_Is210, 25064.m000003

SHAQIINFFDPLLDNMLTIAPAEKWRRIRPAASPAFSTGKLRKV

 

CYP4 clan (56 sequence pieces, 39 different non-overlaping sequences, some will join)

 

>&P450_Is301, 35785.m000085 heme region

MIYFLQRHQKLYDDPNSFVPERFQENNGRHQYAFIPFFGGQRNCIGQRFAVLKAKVLVAQVMRRFKIESKLPESELQLEI

GIVLRPSQNLDVKLTRRNRTL

 

>&P450_Is302, 35785.m000087

47% to CYP319 tick, (46% to human CYP4V2), 45% to CYP4W1 tick

SVLTSQKTTRKSFNYTFLHSWLGTGLLTSFGAKWKQRRRMLTPAFHFRILEDLVPTINEHARKMVKRLNQCSGNAATDIV

SFSTECTMEILLETIMGVTTANHHEDIGSYVEAIKNLTLKFMLRFQNPWLYLDSIFYRTSLGRECAHTLSVVHSFSKKVI

KKRREELVKERSTVTAVPTSDNELRGKKLPTFIDILLQHSLDFDALLTDDDIREEVDTFMFEGHDTTAVAIAWCIYLIGL

HPEVQKGVHEELDAIVGDEPEKNITLEDLKKLTYLDRVIKECQRLYPSVPLIGRTASEDFEMGGHLIPAGANIGVFIYAL

HRDPDVFPKPEEFDPDRFLPENSEKRHPLSYLPFSAGPRNCIGQKFASMEVKIIVGHIMRSFIVQSMDPRDKLLVSLEIV

LRVANGLRIKVVPRASSKGTSS

 

>P450_Is093, VBpre_P010592

Same as P450_Is302

MLQPTLFRFRQSVLWKSYW

ETIMGVTTANHHEDIGSYVEAIKNLTLKFMLRFQNPWLYLDSIFYRTSLGRECAHTLSVVH

SFSKKVIKKRREELVKERSTVTAVPTSDNELRGKKLPTFIDILLQHSLDFDALLTDDDIREEVDTFMFEGHDTTAVAIAW

CIYLIGLHPEVQKGVHEELDAIVGDEPEKNITLEDLKKLTYLDRVIKECQRLYPSVPLIGRTASEDFEMGGHLIPAGANI

GVFIYALHRDPDVFPKPEEFDPDRFLPENSEKRHPLSYLPFSAGPRNCIGQKFASMEVKIIVGHIMRSFIVQSMDPRDKL

LVSLEIVLRVANGLRIKVVPRASSKGTSS

 

>&P450_Is303, 35785.m000088

SGNKWRRRRKMLTPAFHFRILEDFIPVFNEQAVIFVRNLKEHVHKKYIDIVPLVTLCTLDIICETAMGVKVDAQLNSNSH

YVRSLYEVGETFMARVMRPWLWPNYVFYMSSFGKKFKDNLAQLHNFTRK GHDTTAMGISWAMYLIGLHADVQQKIHEELD

GIFGEDRERPISPDDLKEMKYLECALKESQRLFPSVPFIGRELMEDVVVNGYTVPRGTTCFLFTFMLHRDKEIFPNPEVF

DPERFRPENCVGRHPFAYVPFSAGPRNCIGQKFAMMEEKVVLCSVLRNFCIHAVDFRDKIHLVAELVTRSKHGLRIRLKP

R

 

>P450_Is101, VBpre_P010603

Same as P450_Is303

LQVILSSNTVLDKSFDYTLLHPWLGTGLLTS

SGNKWRRRRKMLTPAFHFRILEDFIPVFNEQAVIFVRNLKEHVHKKYID

IVPLVTLCTLDIICETAMGVKVDAQLNSNSHYVRSLYEVGETFMARVMRPWLWPNYVFYMSSFGKKFKDNLAQLHNFTRK

VIRERKAELLEQKVIDGLTIGDQVIGQKRRQAFLDLLLSHHIQDSSLTEEDIREEVDTFMFE

 

>&P450_Is096, VBpre_P010596

63% to P450_Is303

GHDTTAVGISWALYMIGLHHHVQERIQTELENIFGTDTERNATMNDIRSMKYLECVLKESQRLFPSVPLIARLLQQDWKY

DKYIMPKGTVCLVSIYSLHRDPDAFPNPEEFIPERFLPENCTGRHPFAYVPFSAGPRNCIGQRFAMMEMKTLVSRILRNF

TLHSMDQRDKVQLAAELVLRPRDGLRIKLKCRKKT

 

>&P450_Is152, VBpre_P002000

58% to P450_Is303

VPRGCTCIILSQMVHKDPRYFPNPSVFNPDRFLPENCKGRHPYAFIPFSAGPRNCVGQKFAMMEEKVLVSAVLRQFRIKS

LDHRDRLILVPLPLLHPRSTQGGIRVRFTPRERRQPPA

 

>P450_Is091, VBpre_P010590

Same as P450_Is301

MDSAKVSDTLKTVLRPTVATTVVAWLVVGTVSLGLLLPVVRLLARWIRMYWILRHMKRPTRVCPGYWFVPELFVVRYWID

THLSMAARFFNFLKASTATYRENDLVVFFNGPQAIVVTVTPAAVEALVKSSNNINKPFIYHFMEPAMGTGLIVSEKNVWK

PRRKTINPAFHARNLDSYVPIMSRRLERFARKLEEINDSASGYFNIMAPVRAATFGVLMETVFGISDIEDEEFEKKGHIK

RMQIFCDGFVSRICNVAYWWDFIYELSSEGKNHHRVSRILRDYCRQVITARKEELMDKGHVRNSMRSFLDILLQMHMQDG

TLTESDILDETVTIIGAGFDTTASAAAFCLYLLGNHLEVQEKLREELDRVFGDDVDRPVTLDDLRDLPYLDCVIKETLRL

YPSVPVVARYIDEDMKIGEQLIPKGTTVTT

MIYFLQRHQKLYDDPNSFVPERFQENNGRHQYAFIPFFGGQRNCIG EL

 

>&P450_Is100, VBpre_P010601

55% to P450_Is302

TLEIRVAHSVEYQSHGLYRFYIGHVPTVVVYRADLIEIVLTNTLSKSIDYSLLHSWLGTGLLTSSGSKWKTRRRMLTPAF

HFRILDDFVLPINEHTKHLVTRIRQLSEQDDWVDVVPLAASTTLDVLLETIMGITTSQQQPECQSYVKAANFLADQMVFR

AQTPWLLLDFIYYRTEYGHRYKAATNLVHTFSTQVIQKRRKELIKERSTAQAPLADLTKPQRKRLRTFLDILLCYSLDSD

DSFTDEDIREEVDTFMFEGHDTTALAIAWALYMIALHPEIQQKIQQELDAVLGNDLEKNISMNDMKEFKYLDCVTKECQR

LYPSVPFIGRAVTKELRLGDYLLPEGTTVDIFIYALHRDPKIFPDPEVFDPERFSSENSASRHPFAFIPFSAGSRNCI

 

>&P450_Is098, VBpre_P010599

47% to P450_Is303

LKWSAGISISLALLLGVCVSVARWIQLKTLRQLQHLPGRREVLPFLNDYALFRACSQQESPAAFNTLFFNAISGFHARFQ

RYGMHRIYTGLSPLIIVYRADYVEEVLKSNTLLKKGAVYDMLHSWLGTGLLTGTGNKWRTRRRLFTPAFHFRILDDFTPT

INAQSMILADILGKMSLEHNGVDVVPRVTLCTLDIVCETIMGRVINAQSNQDSEYVKAVNRLGELFLERILTPFARVERI

YKMTSNG

 

>&P450_Is027 VBpre_P005914

70% to P450_Is302

MLPAIQALLSFGCLFLGGAAFLLLSVLGAFHAARRATWKHVKTLPGPDGSIPLLWIVRQHFRIARVKHMVPYNASAMETH

LGICSQYRKKGLYRFYVGNQLHVMIFKPELIESVLTSQKTMSKSFNYSLLHSWLGTGLLTSSGAKWKQRRRMLTPAFHFR

ILEDFVAPMNEHARNMGKRISQFSESDETDVVPFLATCTLAILL

 

>&P450_Is094, VBpre_P010593

54% to P450_Is302

MYRFYVGPLPNVMIFKAELVEAVLTSQSTMSKSFDYSLLHSWLGEGLLTSSGAKWKQRRRLLTPSFHFRILDEYVAPMNE

HARHMVQEIGRHAGTEEINLIPLSTSCTLGILLETIMGVEADKQDVSTRSYVGALKILSDQITLRSQTPWLLVDPIYYRT

EYGKLYRRNVEVVHDFTRKVITERRKQLMSEKSASIPTKIENNEFQKKKLLTFIDILIQQSMNSDAHLTDDDIREEVDTF

MFEGHDTTQMAISWCLYLLGLHPKVQEKVHEELEEVLQGDLEKDVTM

 

>P450_Is004, VBpre_P000914

same as P450_Is317

LFVCLFFSHSTGNKWRSRRRLFTPAFHFRILEDFSSAINSHSMVLADILGKKSLDHNGVDVVPKVTLCTLDIVCETIMGK

VLNAQSNEDLAYVKALLRYSALVMQKFEQEKRSEIKAAQVSKYRSCARVICTVLKLLELCYCVDISFVTNQSTLVSQIPM

EEGITPLNTIAASLIFFTICLQ

GHDTTAVGISWALFLIGLSPLEQQKIHDELDFIFGDDTERHVTIEDMKEMRYLECVIK

ESQRLYPSVPFYSRLCEEPFELGGTMLPKGTVVQVSNYFLHRDPKVFPKPEEFRPDRFLPENSKGRHPFAYVPFSAGSRN

CIGQKFAMSEEKIVIANILRRYKLRSLDQRDQVGLIADMVLRPKSGIRIKFIPRTSSKGA

 

>P450_Is011, VBpre_P003620

1 aa diff to P450_Is317

SK

GGTMLPKGTVVQVSNYFLHRDPKVFPKPEEFRPDRFLPENSKGRHPFAYVPFSAGPRNCIG

KVVTLFRVMSEHFSK

 

>&P450_Is099, VBpre_P010600

79% to P450_Is317

GTSLPKGTAVQVAAYFLHRDPKVFPKPEEFQPERFLPENAKGRHPFAYVPFSAGPRNCIGQKFAMSEEKIVLANILRKYK

LKSLSHRDEVGLVAEIVLRPKNGLRITFTPRATP

 

>&P450_Is013, VBpre_P009931

90% to P450_Is317

YVRFQGHDTTAMGISWALFLIGHSPEAQQKIHDELDSIFGDDTERHVSHEDMKEMRYLECVIKESQRIYPSVPFYSRLCE

EPFELGELPHDIQAILPLVGRQRSR

 

>&P450_Is008, VBpre_P012203

78% to P450_Is317

MFFSSGSTGEKWRSRRRLFTPAFHFRILEDFTSTINNQSTILASVLGKTSLEQNGVDVVPKVTLCTLDIICETIMGKTLN

AQSNEDSVYVKAVHRLSELFMERMATPLARSESLYRMTAKGKEYTHWLNKLHTFTREVVAERKKDMKATISSGSLLDDEE

DNGCNYMKRKRPFLDTLLVEHFKDPQNITEEDMREEVDTFMLAASLLIGLNFFWALLLIGLSPVEQQKIHDELDSIFGDD

TERHVNHEDMKEMRYLECALKEAQRIYPSVPFYSRLCEEPFELGGTILPKGTVIKIAGYFLHRDPEVFPKPEEFHPERFL

PENSKGRHPFAYIPFSAGPRNCIGQKFALPVVKIVVANILRRYKLQSLDHRDQVLFFSEMVLRPKNGLRIKFIPRISSKR

A

 

>&P450_Is283, 34698.m000033

51% to CYP4CF2, 58% to CYP4V2 human (probable ortholog)

VIRERKEVKLAEQRLIEPSSDIKKRPMFLDVLLDHHITEDSISEEDIREEVDTFMFE

GHDTTSAAISWCIYLLGRNPEMQ

KKVQDEMDAIFANDVDRYATVADLKEMKFLECCIKETLRLFPSVPIIGREVHKEFSVNGNVVPQGAIVVVFSYMLHRDPQ

SFPRPEEFFPERFLPENSLGRHPFAYVPFSAGPRNCIG

QRFALMEEKIVLSNLFRRFSVTSLVPRHNLKLAGELVLRNQN

GIEVELTPRQPHAPAAIAQDKP

 

>P450_Is051, VBpre_P007473

Same as P450_Is283

ERIGKIYCPTGKANCLFQ

GHDTTSAAISWCIYLLGRNPEMQKKVQDEMDAIFANDVDRYATVADLKEMKFLECCIKETLR

LFPSVPIIGREVHKEFSVNGNVVPQGAIVVVFSYMLHRDPQSFPRPEEFFPERFLPENSLGRHPFAYVPFSAGPRNCIG

EFSNLASFSFVCLFVCSCVRVCLCVLRYQL

 

>&P450_Is281, 25312.m000009

37% to CYP4C3 Drosoph. 39% to CYP4V2 human

AVLSSTSNLNKSFIYRMMTPWMGNGILT

SDKDVWRTRRKILTPAFHFRILEDYTPIINRRTTELLQKLRKMEGEFFDMLP

VLRMAAFGMLFETAMGVQIDEAEVERRGLLRVTDELAASVIGRIINIFHWPDFVFNLTKKGQRFYNNVEYIRSYNEQIVK

KRKAEYKVGLEDSNKRKSFLDILLRMHLEDGTLTEDQVRDEVATVFIGGFDTTATAASYTLYLLGHYPEIQAKVHRELDE

VFGDDWDRPVTLEDMKNLKYLECVIKESMRLYPPVPVVARNIDEDMKVGEYTIPRGTVAFAVIFALHRHPRVYENPNDFI

PERFLEKKERHPYAYVPFSGGSRNCI

 

>P450_Is140, VBpre_P003290

Same as P450_Is281

LPY

SDKDVWRTRRKILTPAFHFRILEDYTPIINRRTTELLQKLRKMEGEFFDMLPVLRMAAFGMLFETAMGVQIDEAEVE

RRGLLRVTDELAASVIGRIINIFHWPDFVFNLTKKGQRFYNNVEYIRSYNEQIVKKRKAEYKVGLEDSNKRKSFLDILLR

MHLEDGTLTEDQVRDEVATVFIGGFDTTATAASYTLYLLGHYPEIQAKVHRELDEVFGDDWDRPVTLEDMKNLKYLECVI

KESMRLYPPVPVVARNIDEDMKVGEYTIPRGTVAFAVIFALHRHPRVYENPNDFIPERFLEKKERHPYAYVPFSGGSRNCI

GQRFAQIEDKIMLAQILRRFKVESKVPIEELQLQIEIVLRPVEGIELKLTKRERSA

 

>&P450_Is095, VBpre_P010594

60% to P450_Is281

NKYVKKHPQGFDTTATAAAFAVHLLGNHPEAQAKIHDEIDSVFGNDRGRPVTTDDIRNLKYLDCVLKETLRLYPPIPAIA

RKIDEDVVIGKHTIPKGTVSIVMLYFLHRHPRFFEKPDAFFPERFLDYADRHPFLYIPFSGGARNCIGQKFAQLEDKILL

THIMRHFKVESELSMEQLQMSLELVLRPTQGLHLKVTPRVAGVEKTTN

 

>&P450_Is092, VBpre_P010591

62% to P450_Is281

MYVHVLFKVIKTRKQTYKAGLEDNFKRSSFMDIILRMHIEEGMFTEDEIREEVNTFMIGGFDTTATTAAFAVHLLGNHPE

VQAKVHEELDIVFGSDRERPVTDEDMKQLTYLECVIKEALRLYPPTPIIARNIDQDIKAAGYLIPRGSVAVIPLIFLQRH

PKYFDRPEDFVPERFMEAQERHPFVYVPFSAGPRNCIGFKFAQLEDKILLAHIMRSFKVVSKIPMEDVQLSL

 

>&P450_Is259, 19547.m000015 no ESTs

55% to P450_Is281

NILLQKSMRVYPAVLLLARMIDKGIKIGEQTIPKGTVALAFIFYMHRHPKHFENPD  IFMPERFLETKYSHTFQFLPLSAG

PRNCIRKTL

 

>&P450_Is103, VBpre_P010605

40% to P450_Is281

MERLNKPWLWWNVAYSLSHQNRNFKTTALQINQFVREVIQERKKVLCSGEQSNGPNCAKAFLDLLIKHHIEDKSFTEKDI

NEEVNTFLFAGHETTAIGMTYVLYLLGLHPDIQEKVARELDSIFMGDTEREITREDISAMKYLECVIKECQRLYTIVPIY

GRRIEEDMSI

 

>&P450_Is215, 29063.m000022 (two genes)

35% to CYP4V2 human, 37% to CYP4CF2 mite

MTPAFHVRVLDNYMSVFNESADLLVKHMCKVADEAPDEPIRLFKSMQKCAMDIIGEVTMETKFQLQENKNISFMNAFNRV

MFLVSVRAFRPWLWIQKLYDNTLEGKSYEADVQEMITLSNSIMYKQKDKLQSTEVLPTTGSEDDELNIKRETILMNILLR

RHMQDSSYTLDDVRNDNDTIVSAGTDTITTCMCFTLHYLGLYPEAQARAHQELDEIFGDDTDCEITATHIRQMKYIECCL

KESLRLYPSFPVIGRVLDEDVTMEGHVIPKGVMCFISIYSLHRNPKYFKDPEEFIPERFLSEEIKTRHPFSYIPFSGGSK

NCLGQKFAMLEMKLLLAKILLKCKIVSAEPLDRLNVA TDEIWRLKRKL MTPAFHFRVLDNYLRIFNENGDRLVRTIGEAI

DEAPEDPVRLFKTTQKCAMDIIGEVTMGEKLGLQDDKNLNFMSSFNRVMFLVSVRFFRPWFWNQKIYDSSSEGKLYNRDL

EEMMEFIHSIIQRR SQASQSEKSLPKYSPDDQHDDETDCSENKNTLMNLLLKKHREDHRYTLDDVRRDIDTIIAAGNDTL

TTSTCWTLNLLAHNRDAQRKVHAELDEIFGGNLDGEITADDLRKMKYLECCLKESLRLYPAFPLIGRVLDEDLILGGYKV

PEGVMCFISLYSLHRNPKYFKDPESFIPERFMSEEIKARHPFSYIPFSGGSKNCIGQKFAMMEMKLILAKVLRKYQVECK

IPMDQLNVA

YEVIVKDKGGNKVWFRRRPELCLTLQ

 

>P450_Is062, VBpre_P011782

Same as P450_Is215 (first gene)

MGAPSLSASSYLVSLFVRNATWILGVLLCAGLTVPFIRWFRVWKALRPLPGPSDIVPFWFSLSCIKSFLQERRENKYATT

RIFSIIRDLGKQYTGKLFKVYVGMTPIVVLHTPDAVEALLTSNTNQKKPFLYHFIAPWLGNFNILLSTGETWRNRRKL

MTPAFHVRVLDNYMSVFNESADLLVKHMCKVADEAPDEPIRLFKSMQKCAMDIIGEVTMETKFQLQENKNISFMNAFNRVMFLVSVRAFRPWLWIQKLYDNTLEGKSYEADVQEMITLSNSIMYKQKDKLQSTEVLPTTGSEDDELNIKRETILMNILLRRH

MQDSSYTLDDVRNDNDTIVSAGTDTITTCMCFTLHYLGLYPEAQARAHQELDEIFGDDTDCEITATHIRQMKYIECCLKE

SLRLYPSFPVIGRVLDEDVTMEGHVIPKGVMCFISIYSLHRNPKYFKDPEEFIPERFLSEEIKTRHPFSYIPFSGGSKNC

LGQKFAMLEMKLLLAKILLKCKIVSAEPLDRLNVA

YEVIVKDKRGNRVWIRRRTELDSAER

 

>&P450_Is175, VBpre_P013495

C-term part 92% to P450_Is062, N-term part 72% to P450_Is062, missing the middle

MGVHVLSTSSYFVSLFIGNVTWILGLLLCAGFVVPTVRWFRVWKALRPLPGPWDAVPFWFILGCFKSVIQEKKANKHATA

WIFSKICSMCQQYTGRLFKVYVGMTPIVVLQTPDAVEALLTSSVNHKKPFLYDFITPWLGPLNILVATGEAWRFKRKLMT

PAFHFRVLDNYMRIFNENGDLLVKHLCSVVDKSPDEPIRLFKSTQRCAMDIIGE

 

GHVIPKGVTCFISIYSLHRNPKYFKDPEEFIPERFLSEEIKTRHPFSYIPFSGGSKNCIGTQTLL

 

 

>&P450_Is122, VBpre_P010314

74% to P450_Is062

DRDGEITASHLAQLKYLECCLKEALRLYPPFPLVGRVLDEELEIEGQVIPKGVNCFIALYSLHRNPEYFKDPEKFMPERF

LSDEIRTRHPFSYIPFGGGPKNCIGTETLLSICFVRA

 

>P450_Is063, VBpre_P011783

Same as P450_Is215

SQASQSEKSLPKYSPDDQHDDETDCSENKNTLMNLLLKKHREDHRYTLDDVRRDIDTIIAAGNDTLTTSTCWTLNLLAHN

RDAQRKVHAELDEIFGGNLDGEITADDLRKMKYLECCLKESLRLYPAFPLIGRVLDEDLILGGYKVPEGVMCFISLYSLH

RNPKYFKDPESFIPERFMSEEIKARHPFSYIPFSGGSKNCIGQKFAMMEMKLILAKVLRKYQVECKIPMDQLNVAYEVIV

KDKGGNKVWFRRRPELCLTLQ

 

>&P450_Is020, VBpre_P002206

58% to P450_Is215

MDIIAEVTMGKKLGLQENKNPRLVASFNRAMMLVPVRCLSPWFWVQAIYDITSQGKGYKGAVEEMVNLTRSVMRQHLETS

NGTKMTSQFSQHDTEADSSKKASLIDRLMKTQSEDEKYTLDDVVGDINTILGGGNDTAALAVCWALNLLGHNADAQRKAH

EELDEIFGSNRDGEITADDLKKMKYLECCLKEALRLYPSFPVIGRTLEEDLVI

 

>P450_Is054, VBpre_P011725

Same as P450_Is256

MAWTLYLLGLYPQKQRKVQRELDEIFKDNPDREVTMDDLRRMKYLEACLKEAMRLFPPIPYIGRVLVEDIELDGVVIPKG

VTCWISIFTLHRNEKYFHKPEEYIPERFLTEEFTSRHPFCYIPFSAGSKNCIG RF

 

>&P450_Is256, 34608.m000037

36% to CYP4W1 tick

MFKNRTFKAYIAAVPIVVIQTAEHAEVLLSSAVNLNKPFFYTFTIPWLGPRNLLYVAGDIWRAKRKVQTPGFHFKILEKF

MDIFNEHADAMSETLHDMSVKNEQVRINDVTKRCSLDVIGEALLGINLNTQKNENGTYGEYIGGITFLMTIRAFRPWMWL

TSVYNWSLEGQWFKKMIHGVDTFSLKVMKERKETFHLFKNQSNPDGPEDEDDAKPERRVAIVDILLDKHLKDQSYTLHEI

RKDLDLLLFAGHDTISNA MAWTLYLLGLYPQKQRKVQRELDEIFKDNPDREVTMDDLRRMKYLEACLKEAMRLFPPIPYI

GRVLVEDIELDGVVIPKGVTCWISIFTLHRNEKYFHKPEEYIPERFLTEEFTSRHPFCYIPFSAGSKNCIG

 

>&P450_Is257, 34608.m000038

MGLKLHERGVSAIADEYEKDVELVLKLYMKRIMQPWMWADFVYAATTSGRQYAKLVKRLHSFTKK GHDTVTQSLTWTLFV

LGIYPDVQSKVHEELDLIFAHDMTRGITRADIADLSYLDRVIKV ILNRQSGFAAGRRKLDDDAFHEAETNEKRLAFLDLL

SKHYRKEMITIEDVRQEVDTFMFAVRNYQIPKGTTCFVFTYGLHRDPDHYRDPETFDPDRFLPENCS QKFALMELKVTLA

KLLRRYQVKSCHQRDDLLLMADMLLRTRNPIKFQLTERLAPQ

 

>P450_Is055, VBpre_P011728

Same as P450_Is257

GHDTVTQSLTWTLFVLGIYPDVQSKVHEELDLIFAHDMTRGITRADIADLSYLDRVIKVSRAFFYHITVSNASRVRIFRN

YQIPKGTTCFVFTYGLHRDPDHYRDPETFDPDRFLPENCSGRHPFAFVPFSAGPRNCVG QKFALMELKVTLAKLLRRYQV

KSCHQRDDLLLMADMLLRTRNPIKFQLTERLAPQ

 

>&P450_Is273, 23435.m000009

35% to CYP4W1
TLLSSTGNHGKTFEYSFLTSWLGPRNILTA

TGDIWRFKRRLLTPAFHFRALENYMQIFNENGDQLTKRIGALLDEAPNEAIPLFQN

TMVYFAE

VTMGTKLCLQENKNENFMIWFNRLMFLISVRCFRPWTWLQTIYEMTTEGRVFKETLHNMEAFSYS

VRTYICLKN

DLEVISKLEPEDNINHASERDSILLDALLKRHLQENRYELEEVKKDIDTILFAGNDTTTSAISWNLYMLGLHP

EIQAKVHHELDQIFDGDIDRHITTDDLKQMKYLECCLKESMRLFPPFPLIGRILDHELVIDGHTIPTGVRCFVNIFSLHR

NPDYYKDPDSFIPERFMSQEIMNRHPFSYIPFSGGPKNCL

 

>P450_Is088, VBpre_P008297

Same as P450_Is273

LRR

TGDIWRFKRRLLTPAFHFRALENYMQIFNENGDQLTKRIGALLDEAPNEAIPLFQN

VQKCALDIIGQ

VTMGTKLCLQENKNENFMIWFNRLMFLISVRCFRPWTWLQTIYEMTTEGRVFKETLHNMEAFSYS

AMRNRLDTVK

DLEVISKLEPEDNIN

HASERDSILLDALLKRHLQENRYELEEVKKDIDTILFAGNDTTTSAISWNLYMLGLHPEIQAKVHHELDQIFDGDIDRHI

TTDDLKQMKYLECCLKESMRLFPPFPLIGRILDHELVIDGHTIPTGVRCFVNIFSLHRNPDYYKDPDSFIPERFMSQEIM

NRHPFSYIPFSGGPKNCL

GQRFAMLEAKLLLAKVLLKYAIEPTWPLEKLKITFEVILKARGGLRTHIRSRRGLNAP

 

>&P450_Is204, 32461.m000036 I-helix

85% to P450_Is317, 64% to Is303, 45% to Is302

MAISWALLLIGLSPVEQQKIHDELDSIFGDDTERHVNHEDMKEMRYLECAAIALKIWF

 

>&P450_Is317, 20997.m000010 63% to CYP4W1 tick I-helix to end

57% to Is302

GHDTTAVGISWALFLIGLSPLEQQKIHDELDFIFGDDTERHVTIEDMKEMRYLECVIKESQRLYPSVPFYSRLCEEPFEL

GGTMLPKGTVVQVSNYFLHRDPKVFPKPEEFRPDRFLPENSKGRHPFAYVPFSAGSRNCIG

QKFAMSEEKIVIANILRRYKLRSLDQRDQVGLIADMVLRPKSGIRIKFIPRTSSKGA

 

>&P450_Is113, VBpre_P006304

62% to Is302

EVDTFMFAGHDTTAMAIAWNCYLIALHPEVQKKVQEELDMVLGEHKTEDISTENLKDLKYLECVVKESQRLCPSVPVIGR

TVTKPFTLGNYVLPEGTSVEIFIYGLHRDPEVFPDPEVFDPDRFLLENCASRHPFAFIPFSAGSRNCIGKYDR

 

>&P450_Is097, VBpre_P010598

43% to Is302

LFQELLTSNVILDKGKEYDIIRPWLASGLLTSAGSKWKLRRKLLTPAFHFRILEDFLPIVNTQSRVFVENLRSQGKERSY

NIVPLVTMCTLDIICETIMGYVINAQKNKCSDYVQAIQVVGEAFTLRLESPAFWIEPIFRLSQSGRQFYDSVKELHEFTT

KVIQERKKELQNEPREAFDNADDDDVYGMKSSHKRTFLDILLREHLKDPHNFTEEDVREEVDTFMFEGHDTTAMGISWLY

LIGLYREQQDLIHQELDSIFGDDKVRQITSNDLKEMKYLECCLKESQRLYPSVPFIARTCSEDLIIGDYIDLPLFT

 

>&P450_Is298, 35258.m000099

32% to CYP4C2 human

MYNFIDSWVGQFNILVT

TDEVWRFKRKLMTPAFHFRVLKNYMRIFNEHGDGLLKNICAAIDKAPKDPVRLFETTQKCAMD

IIGVPSEYIENELYVCYNYRTGSVFRCLFFSAMFLLSTRSFSPWFWNQTIYDNSSDGKHYNGDIREMMEFTHSVSKFDSD

LFYNERIISKCLPHDNEFDFSVKNNTLMDLLMKKHRDDKRYTLNDVRMDIDSIIGAGNDSTTTAICWTLNLLGHNTDAQA

KVHEELDEIFGSINDGEISADDLRRMKYLECCLKEALRLYPSFCVIGRLLDEDLIMDGHRVPKGVTCFVNIYSLHRNPKY

FKDPEQFLPERFLSDENKSRHRFSYIPFSGGPKNCIGQKFAMIEMKLILAKVLRKCEVKSKIPLDRLKVAYEVITKDK

GA

SAAKRAEGADSKRLVLLAEDSWVPLDRLAAQSSSFRHNYNPFLHMPSYPAYPGRNAALGLEEDLLTEAEAEPTLKVYKAD

AEYPPLNLKNRKKLYAVGYIYMLDFLEDTYLRRRRRR

 

>P450_Is082, VBpre_P009117

Same as P450_Is298

TDEVWRFKRKLMTPAFHFRVLKNYMRIFNEHGDGLLKNICAAIDKAPKDPVRLFETTQKCAMDIIGVPSEYIENELYVCY

NYRTGSVFRCLFFSAMFLLSTRSFSPWFWNQTIYDNSSDGKHYNGDIREMMEFTHSIMQQNSKLSDERIISKCLPHDNEF

DFSVKNNTLMDLLMKKHRDDKRYTLNDVRMDIDSIIGAGNDSTTTAICWTLNLLGHNTDAQAKVHEELDEIFGSINDGEI

SADDLRRMKYLECCLKEALRLYPSFCVIGRLLDEDLIMDGHRVPKGVTCFVNIYSLHRNPKYFKDPEQFLPERFLSDENK

SRHRFSYIPFSGGPKNCIGQKFAMIEMKLILAKVLRKCEVKSKIPLDRLKVAYEVITKDK

GGNKIWIRRRTAFCSTLQ

 

>&P450_Is304, 35433.m000007

ERVISDWMYFCLAGKRMCPGETLTTVEIFLYLTSLLQRFDILPEEGKAINLTPVS

 

>&P450_Is201, 20358.m000017

green = 81% to CYP4D23

YIPFSGGSKNCIGQKFAMLEMK

EPRLWLKIPSFANTFLLSPPPLFSFSYAIKIDWWKTSPEVQTGKETQHRVRMADVGLLIYFDSCLL

 

>P450_Is156, VBpre_P013193

Same as P450_Is261

MTPVVVIDTPGAVEVR

TGHAWRSKRKLLEQSFHSSRALEHYVHIFNENGDLLVGNICSIIDRSPNEPIRLFKMVQKCALDIIA

DGHRIPKGVMVTVDIFSLHRNPTCFEDPEKFIPERFMAEENKTLRPFSYIPFSGGQKFAMLEMKLLMAKVLRECKIV

SSEPLENLDVAYEVIVKDIG

 

>&P450_Is261, 19455.m000047

MTPVVVIDTPGAVETLLTSSVNHRKPFIYDFINSWLGQQNILVA

TGHAWRSKRKLLEQSFHSSRALEHYVHIFNENGDLLVGNICSIIDRSPNEPIRLFKMVQKCALDIIA

ECWIKN

 

>&P450_Is262, 19455.m000048

42% to CYP4V2 human

MTPAFHFRILENYMAIFNQNADLLVRRLCSFVDKAPSEPIRLFENTQKCALDIIGDTTLMNLLLRAHLQDNKYTEEDVKK

DIDTVFGAGNDTTTSATCWTLYLLGLNSKIQAKVHHELDEILGRDTDREFTTDDLRRMKYLECCLKEGLRLYPSFPYIGR

VLDHDLEIDGYKIPKGVSCFVNIYSLHRNPEHFKNPEEFVPDRFMGHETTRRHPFSYIPFSGGPKNCLGQRFATVESKLL

LAKVLSKFTIESTRPLEQIKVTFEVIIRARGGHQVWLRRRTQMDSFQQLN

 

>P450_Is059, VBpre_P004563

Same as P450_Is262 for part of seq, rest does not match. Hybrid?

WRFKRKL

MTPAFHFRILENYMAIFNQNADLLVRRLCSFVDKAPSEPIRLFENTQKCALDIIG

EVTMGAKLHVQEGKNLNF

MSSFNSASLLVGLRALRPWLWLQFIYDHTSEGKLFKKNMKEIESFTHFVMLERKEKLEKIEAMRESDFQDDEIKMSRT

DTTLMNLLLRAHLQDNKYTEEDVKKDIDT

SLLQGSDATLSVVTWSIYMLGLHPKTQAKVHRELDAIFGTDTNRCVTSDDLKR

MKYLECCLKETMRLYPPVPIVGRVLEHDQVIDNQTVPKGVQFFINVFRLHRNPKYFSDPERYLPERFMREETTFRPPFVY

IPFSRGARKCL

 

>&P450_Is170, VBpre_P001425

66% to P450_Is262

TDGHVVPKGVTCMVNIYTLQRNPKAFHKPEEFIPERFGSEEYSNRHPYSYIPFSGGPKNCLGKLMWLVYFSPTYTH

 

>&P450_Is269, 26843.m000012

LFHLLVGMTHYFERERIFKAYLGFQPVVVLFKPESVEAVLNCSTNLKKPILYSLLHAWLGKGLLT

 

>P450_Is147, VBpre_P013765

same as P450_Is269

MFAIVTSTFSAVFSATSALSLRYVMVMTITVATQRLLLCALLAVACAYA

VQVVARFYRMWKAVRPMAGPSDWFPPLFNIHCLITGAAMKNVFSTSTG

LFHLLVGMTHYFERERIFKAYLGFQPVVVLFKPESVEAVLNCSTNLKKPILYSLLHAWLGKGLLT

SSGSKWRSRRKMLTPAFHFRILEDFLPIMNEQGEIFARALQGHTHAVFDITKFVTACTLDIIC

 

>&P450_Is255, 21182.m000018

MLAALAQPEERAQKWAIQYAADTLAQQGLDG

AGYQIPPGTTLALFMYTLHRDERWFPEPEEFRPERFFPENSVGRPAYAY

VPFSAGPRNCIGQRFAMMEEKVVISTILRHFRLHSPDERDTVLITWELVLKPLNALNVHFMPKMKL

 

>P450_Is007, VBpre_P012142

Same as P450_Is255

ELDAIFGEDRTRPATEEDLKQMKYLECVIKQLLTVSGPQPVSRHSRRQNT

AGYQIPPGTTLALFMYTLHRDERWFPEPEE

FRPERFFPENSVGRPAYAYVPFSAGPRNCIGQRFAMMEEKVVISTILRHFRLHSPDERDTVLITWELVLKPLNALNVHFM

PKMKL

 

>&P450_Is102, VBpre_P010604 N-term 42% to CYP4C3

SLTLLLSCIVPVAVHIARRRRIAELISKIPGPTAAHPILGNLDQNPDGNQLLRKVFFLQLVR

 

>&P450_Is325 33428.m000008

TLQSTETIQKSGSEEEEFHSGGETSLMNRLLQKHIEDSSYTLSDVRNDIDTIIAAGNDTTTTCMCWTLQYLGLYSEVQAK

VHRELDEVFGNDRDGEITAIHLAQLKYLECCLKEALRLYPSFPMIGRVLDEELQI

 

Mito clan (12 sequence pieces, 6 different non-overlapping sequences, some will join)

 

>&P450_Is311, 35614.m000014

CYP315A1 ortholog, 54% to CYP315A1 mite, 35% to CYP315A1 Aedes

MSTAALAKRLARQLAAGVTSASGGTRRRMRSTEAASACPFHARWAADADKTGGRPVPKAAGGKPYSSIPAPRGLPLLGTA

LDVALAGGAPKIHEYCDRRHRELGPIYKETLGSVEAVFVADSALIQQVYASEGKFPMHMVPEAWLIYNEVKGIQRGLFFM

DGPEWIERRRSLNNVFLKPKTVTDHVPVFNDVIADLLDRWQETRDHSGVLENLERELYNWSIESLGTMIFGRRLGCIASS

SSMENVHEFVHCVQQIFNESAKMSMMSPRVAYKLGLPVWKRFVKAAGRALELARDYVEENVRNIASGTSAGQSHQGILSQ

LLLGERISEEELVRIVTDLFLAAADTTSHATQWAFYLLAKNPERQERLLEEVQSVVPHNQHVDEDCLARLPYVKAVIREA

LRLYPVAPFLTRILSEDIVLNGYTVPAGKLILMSLYTTGRDERQFTEPNEFRPERWLRHGDRASQSSNSWACLPFGLGAR

SCIGRRVAEVQMQSLIARTVQKFHLSPITDRDIPIKMRLITTPEEPVSLRLTPREGTV

 

>P450_Is071, VBpre_P008386

same as P450_Is311

YVLSLKTNR

DGPEWIERRRSLNNVFLKPKTVTDHVPVFNDVIADLLDRWQETRDHSGVLENLERELYNWSIESLGTMIFG

RRLGCIASSSSMENVHEFVHCVQQIFNESAKMSMMSPRVAYKLGLPVWKRFVKAAGRALELARDYVEENVRNIASGTSAG

QSHQGILSQLLLGERISEEELVRIVTDLFLAAADTTSHATQWAFYLLAKNPERQERLLEEVQSVVPHNQHVDEDCLARLP

YVKAVIREALRLYPVAPFLTRILSEDIVLNGYTVPAGKLILMSLYTTGRDERQFTEPNEFRPERWLRHGDRASQSSNSWA

CLPFGLGARSCIGRRVAEVQMQSLIARTVQKFHLSPITDRDIPIKMRLITTPEEPVSLRLTPREGTV

 

>P450_Is072, VBpre_P008387

same as P450_Is311

ADKTGGRPVPKAAGGKPYSSIPAPRGLPLLGTALDVALAGGAPKIHEYCDRRHRELGPIYKETLGSVEAVFVADSALIQQ

VYASEGKFPMHM

SRPLLL

 

>&P450_Is024, VBpre_P011038

90% to P450_Is278

33% to CYP301A1

same as EW788012, EW834609, EW808949

1 aa diff to EW801356, EW876128, EW787696, EW944377, EW961440

red seq from EST EW909080

MKAARVLLQGSRRAAHLGPAAAPAADGTHGESRVAAKPFGQMPRVPSFPLVGSSWIYWPLVGKYHPDRRHEAALDMHR

QYGPIVAEKLPGRYSLVHLFSADDFHALYQHEGKTPFRMGATAFKKYRSSRPKYYKNIGILNMQGQEWYNVRSKTQPYTL

RPRTIMSYVPGMDKIAEDTLQVLARDRDARGETADCYKLLYKWALESVVYASLDTRVGCLSVPLDPHSDGAMILKDMDDV

FACLQIFGYRFPYFRYFRTPSWKRFEFAMDDFTIRLFKHIEAAAERLKTRTEDREYTILEYLLAEKKLEFGEILAFMSDF

ILGGADTTSATATFCLYHLARNPEAQERARQEVFDVVGNKPRALEPEHLSHLPFLKACVKEALRLNPTLSGVFRKLDHDV

TLSGYLVPAGTPLFTENYVASRLEENFTRADQFLPERWLKRDDEGRQDWALHPFASLPFSFGPRMCLGRRMAELEVWIML

VKLLLKYRIEYHYEDIGVQGKLANAPDKPARYRFVDLH*

 

>&P450_Is150, VBpre_P013787

100% to P450_Is024 C-term

86% to P450_Is278, C-term with a fusion to another gene

RLEENFTRADQFLPERWLKRDDEGRQDWALHPFASLPFSFGPRMCLGRRMAELEVWIMLVK

This part is not a P450 sequence

DKQPMWKTYIMAAMFISLF

AVSAFSAPPCSSASASYPELIPVFRMYQDAAQRMSSKHFLDDTSLSQLNNLHRTPQATSTVMEDRTRSWLNAQPVPMQGR

PSCNSSLGILSDTVFSGTASTFTGESLKDNLPAKDKPSEEPGVSFCHPFADKSSFSVGEFYAGKSETAEEASEESLEGQP

WKQDVTRPSWLPNAQERVSISSYFKARSAPIEGLPCAVEEKGTEKKWEVASSLTHAASSQLEANKSNAVAAPAAAEPGFE

TFTAQSLEEMAVQELGLGTPRVAVPDGSVQGPSTSAIYHVLEDISISESPSAMVRKFIHATRSQKPPPRADLQERNEFSG

DATFKQPLTAAPRSKKAAASRDGRAEAEEAPSEPASARQGLAACGPCALRSADGLCRTDPSTSKVWRRMRRRWQTHRRMR

SSRRRGRFKGGGLVELGAVRRRRRQRPLLGAFIWLLRASDAIRFQEVPGVPATA

 

>&EW951253.1 83% to P450_Is024

AFKKYRSSRPEYYKNIGILNMQGQEWYNLRSKTQPYTLRLRTIMSYVPGLDKIAEDTLKVLAHNIDARGETPDCYALLYRWAQESVMFASLDTRIGFLSVPLDPLSDGAMILRDMNDAFACLQIFGYRFPYFRYLRTPTWKRFERAMDDFSVRLFRHIEAAAERLQTRTEDREYTILEYLLAEKKLEFGEILAFMSDFVLGGADTTSSTVTFCLYHLGRNPEAQNRARREVFDVVGSESRTLEPEHLNQLPFLK &

XCVKESLRSPNLS &

GVSKLD &

HDVT

 

>&P450_Is278, 26540.m000014

91% to P450_Is024

TPLFTENYVAS

RLEENFTRAEEFLPERWLKRDDQGRQDWV LHPFASLPFSFGARMCLGRRLAELEIWIVLVK

 

>P450_Is180, VBpre_P005119

Same as P450_Is278 yellow may be wrong frame

GACPFPDGALMPCS

LNPTLSGVFRKLDHDVTLSGYLVPAG

TPLFTENYVASRLEENFTRAEEFLPERWLKRDDQGRQDWV

 

>&EW902122.1, EW900269.1 2 aa diffs to P450_Is163

37% to CYP302A1 Drosophila melanogaster

40% to CYP302A1 honeybee

DMEQVFRNEGRYPARLSHRALLKYRSNRPQQYRGRGLFPSNGEEWSRLRHTFQKPLMQQNSMAVYMPVLQDVT

WDVANLIRKTRHRTSLEMRDFLTELYRWALECTGVLALNTRLGCLEGKLSLDSEQQRLVE

AASETHRIIMLTENG

LPFWKFWDTPAYKRLVKSQDFMAGIVNKYLGQAKEKVRTDIPEEKKTVLEKFLSNPETDIKGVFTMILDMFLAGIDTTAYTTSFILYYLATNPSSQEKLFLELRRLLPEKDSQLDLEQLQNASYLKACIRESLRLSPIAIGVGRILPEDVVLSGYNVPAGTVLITHNQVACRQASNYPEPESFSPERWLKDRSDQGSTAKTHPFCLLPFGYGPRMCIGKRFAETVMCLLVARI

VRNFELEYKYEKIDCFTRLINVPDKPLKMVFVDRSN*

 

>P450_Is163, VBpre_P002865

46% to P450_Is024

2 aa diffs to EST EW902122

WSFDVLVLFFFQTAYTTSFILYYLATNPSSQEKLFLELRRLLPEKDSQLNLEQLQNASYLKACIRESLRLSPIAIGVGRI

LPEDVVLSGYNVPAGTVLITHNQVACRQASNYPEPESFLPERWLKDRSDQGSTAKTHPFCLLPFGYGPRMCIGKRFAETV

MCLLVARIVRNFELEYKYEKIDCFTRLINVPDKPLKMVFVDRSN

 

>&P450_Is289, 35464.m000094

32% to CYP314A1 Apis, 34% to CYP314A1 Aedes, 33% to CYP302A1 mite,

best match to mite CYP302

44% to CYP314A1 mite

seq gap after AAAKV

MKQGARVLARSVGSETPSIIALGHAEATPAAKQAQRRVVTPLADARTYPKPFHQIPGPKPSLPLIGTSWQYFRWGRYSLY

QLHEACADKYRRYGDVMKEEYQWQVPIVHAFNPEDFETIFRHQGRCPIRPANEFVRKYRTEHPHKYSNVGLSNALGEEWH

TLRTALAPVLLQMRSVPGLAAQQSEICEDFVSYVRFVRNSKSQAVDNIQDSLYRLALESIFMLCLDTRLGCLSRTVNYDS

DAAIVITAAKDLFSAYQKLYYGLPLWKFFSTSAYRSYQRAEETLYELTLSYLQKYANHDCKDSAHAPYAKHTSLLHALLN

TEGLSEKDVHLTIMDFIAGGVFTTTNALCFLLHHLACNPSIQEKLHGELQASNGDVSGCSYLRACMKESFRLNPTVPGVM

RILPEDVVLSGYHVPAGVPVFANSLVTCHLEKYFAEPEAFRPERWLGAERTQIHPFSLLPFGHGARMCAGRRFAELELMT

AAAKV

VQNFVVETLLAHAQHELRVCGRP

 

>P450_Is019, VBpre_P000039

Same as P450_Is289

MKQGARVLARSVGSETPSIIALGHAEATPAAKQAQRRVVTPLADARTYPKPFHQIPGPKPSLPLIGTSWQYFRWGRYSLY

QLHEACADKYRRYGDVMKEEYQWQVPIVHAFNPEDFETIFRHQGRCPIRPANEFVRKYRTEHPHKYSNVGLSNALGEEWH

TLRTALAPVLLQMRSVPGLAAQQSEICEDFVSYVRFVRNSKSQAVDNIQDSLYRLALESIFMLCLDTRLGCLSRTVNYDS

DAAIVITAAKDLFSAYQKLYYGLPLWKFFSTSAYRSYQRAEETLYELTLSYLQKYANHDCKDSAHAPYAKHTSLLHALLN

TEGLSEKDVHLTIMDFIAGGVFTTTNALCFLLHHLACNPSIQEKLHGELQASNGDVSGCSYLRACMKESFRLNPTVPGVM

RILPEDVVLSGYHVPAGVPVFANSLVTCHLEKYFAEPEAFRPERWLGAERTQIHPFSLLPFGHGARMCAGRRFAELELMT

AAAKV

CLHTQI

 

CYP20 clan (3 sequence pieces plus 2 ESTs, 1 gene)

 

>CYP20 P450_Is314, 34501.m000073

33% to CYP20A1 human, N-term from EST

MLEFAIFAVCFVVFLLMLVVYLYPGSSKQTTIPGIDPSDPKEGNVGDIVQAGGLKNFLLSLHKDHGPITSFWMGTKLVIS

IGDAELFKTQTHIFDKPADLFELYRDLVGADSILFANGAEARQRRRRLDDVLTGDRINDFVGPLQK

MCAEVVDRWESLPAEEHVPIYQYMYALCMKTCTRLLFGDYFFDDKHVLEFSRAFELCVKELEEMAGGMVPDPDSPRTKKY

EEAAKKLRSLLKQALENSSRSQKGSGPKTLADVLSDGSVSDKVALDDCVTFALKSYSLVSAMTWALYFLATHPDVQDTIA

KEADKLMSKEAPLKLQDFMQL

SNLQKTIKETLRTATVEPWTARCQDVDVEIAGHVIPKK

TPVIQALGVVLHEEDHWKVPH

RFDSSRFNEKFPELAYCPFGFAGMRLCPGKDLSVLHMSVFLVTLCHRLKLRLIQDQVVTPTFALITKTDDEVWLTLERRRP

 

>P450_Is053, VBpre_P011696

gray = same as P450_Is314

MLEFAIFAVCFVVFLLMLVVYLYPGSSKQTTIPGIDPSDPKEGNVGDIVQAGGLKNFLLSLHKDHGPITSFWMGTKLVIS

IGDAELFKTQTHIFDKPADLFELYRDLVGADSILFANGAEARQRRRRLDDVLTGDRINDFVGPLQK

MCAEVVDRWESLPAEEHVPIYQYMYALCMKTCTRLLFGDYFFDDKHVLEFSRAFELCVKELEEMAGGMVPDPDSPRTK

KYEE

GAQNALYL

 

>P450_Is052, VBpre_P011693

gray = same as P450_Is314

red seq is probably wrong

FC

SNLQKTIKETLRTATVEPWTARCQDVDVEIAGHVIPKK

ARLEPRFGIRQQPKVSPHFNPR

RFDSSRFNEKFPELAYCPFGFAGMRLCPGKDLSVLHMSVFLVTLCHRLKLRLIQDQVVTPTFALITKTDDEVWLTLERRRP

 

>CYP20 Ixodes scapularis (blacklegged tick, arthropod, arachnid, ecdysozoa)

       EW872941.1

       EW945756.1

       N and C-term with a gap in the middle

MLEFAIFAVCFVVFLLMLVVYLYPGSSKQT

TIPGIDPSDPKEGNVGDIVQAGGLKNFLLSLHKDHGPITSFWMGTKLVISIGDAELFKTQ

THIFDKPADLFELYRDLVGADSILFANGAEARQRRRRLDDVLTGDRINDFVGPLQKMCAE

VVDRWESLPAEEHVPIYQYMYALCMKTCTRLLFGDYFFDDKHVLSSAGPLSCVSVLQRCC

ACPRPDSLDQSMR

 

MTWALYFLATH

LKLQDFMQLSNLQKTIKETLRTATVEPWTARCQDVDVEIAGHVIPKKTPVIQALGVVLHE

EDHWKVPHRFDSSRFNEKFPELAYCPFGFAGMRLCPGKDLSVLHMSVFLVTLCHRL

KLRLIQDQVVTPTFALITKTDDEVWLTLERRRP*