Atta cephalotes leafcutter ant P450s

 

59 sequences

40 complete sequences, 5 partial sequences and 14 pseudogenes

 

D. Nelson

 

May 16, 2011

 

Very similar to Honeybee

 

The leafcutter ant appears to have 45 genes and honeybee has 46 genes.

 

Differences: bee does not have CYP6ES found in leafcutter and Linepithema.

Bee has expanded CYP6AS 16 genes in bee vs. 4 in leafcutter

CYP6BD seems to be a pseudogene in leafcutter but functional in bee and Linepithema

CYP9s in bee are sorted into CYP9P CYP9Q CYP9R AND CYP9S (7 genes).

In leafcutter they are currently lumped into CYP9R (6 genes).

This may be a nomenclature issue.

The bee does not have CYP4BW, CYP4CX or CYP4CY subfamilies.

The leafcuter has CYP12K not seen in bee

Leafcutter is currently missing CYP301B1 and CYP314A1 (may be in gaps)

 

CYP2 clan (8 complete sequences)

 

>CYP15A1 ADTU01005771.1 Atta cephalotes contig05771

73% to CYP15A1 Linepithema humile

C-term seems too long

AC03408-PA ACEP_00003408-RA

      MLCLTIIFLFIFVCLYCIYDCIKPRNYPP ()

3663  GPLWIPLFGCFLKFAWLRSKHGYIHLAMQDLERMYGSIIGLKLGVQKIVVISTYDLVKKV  3484

3483  LLQDEFNSRPDGFFFRLRSFGKRK  3412

      GIVFTEGTQWVQTRRFTMRHLR  3170

3169  TFGIGQSVMKEQLVLEAQNLIDYLQQMSESGAVTMHTAFDIAVINSLWFMIAGHKFKYGD  2990

      QKTQEALMLVHDSFK

      LLDTMGGVISQ  2810

2809  MPFLRFVIPELSGYKEMKEIIENLWRFLDEEVKIHERELSNDPPRDLIDAFLLEICKYD  2633

2632  ENEDTIFDR  2606

      ENLLVLCLDLFL

2185  AGLKTTSDTLANIFLFLSLNPEWLKVLQAELDSVVGRSRAPTEDDLSSLPITEAFLAE  2012

1394  AQRYLVLAPLGVPHTTAKDVFLNGYRIPK  1305

998   DTIILFDFHSAHYDKTYWEQPNEFRPQRFLDEQGQFRRNNHGLAFGL  858

616   GKRRCPGEQLARSTLFLFFTYVVHYFDIEVSAEHSKPNLGGYDGFTMSPKPYYLKLMKR  440

      SSDDDVTRANTHNGTFGLLRRGSISLNS*

 

>CYP18A1 ADTU01012323.1a Atta cephalotes contig12323 (+) strand

60% to CYP18A1 Apis mellifera

AC06542-PA ACEP_00006542-RA

10103  MLVKQFGRWLWHIMGGSETQVCFSLLIFVSVTLVTYFLYLKYNHTLRYKLPPGPWGLPF  10279

10280  CGYIPFIKGAVHLHFSELAKKYGGIFSVNIGSELTVVISDYLIIRDSFRREEFTGRPRND  10459

10460  FMNIIDGY  10483

11033  GVVNTEGALWKDQRKFVHNNLKKFGMNFYSPSNMESKIMh  11149

11512  EVEIFLKRLVMRRGAPTTLTSSLAVSISNVICSVIMGIRFYHGDPKFERFMNLINEGFKL  11691

11692  FGKVTLANHIPILRHCPWINNIQHKIERNRSEMAEFFQEVINEHKATYNNNNINDILDAY  11871

11872  LYEIQKAEEENREDQLFEGKDNV  11940

12084  RQMQQVLGDLFSAGMETVKNTLEWSIIFMLHYPEAAKAVQDELDQIVGRSRLPSLDDRQF  12263

12264  LPITEATILEVLRRSNLVPLGTMHATTR  12347

13510  DVMLNDYMIPAGTSVVSLLYAVHMDPELWDEPEAFRPSRFLSAEGKVSQPQFFMPF  13677

13678  GVGRRKCLGEVLARMEIFLFFSSLMHMFNLSLPEGAPLPSLEGNIGVTISPTSFKVCLLQ  13857

13858  RDLLLADCDNNEVSVNGPLRNIGSH*  13935

 

>CYP303A1 ADTU01025472.1  Atta cephalotes contig25472

77% to CYP303A1 Linepithema humile

missing N-and C-terms

scaffold00067:1126869..1136946 (+ strand) covers whole gene

AC14698-PA ACEP_00014698-RA revised

MLLAIIVLLLLYLSCQKPKGYPP

GPRWWPILGCALEIARIRQETGYLFKTCSTLCKKYGPVVGLKIGQDRIVIMNDLESIRAM

LTNKDCDGRPNGPFYKARTWGVIL

GLLVVDDKLWVEQRRFVIRHLRDFGFGRTSMLTIIEDEALKL

KVSQSAGMIISMHDAFGVTVLNTLWRMMAGRR

YDAGDKELTHLQRILTKLLNEIDMIGAPFGHFPLLRFIAPEMSGYKAFVETHQELWAFLK

3925  EELYNHKNTFLSNAPRDLMDVYLTVLNSKNCSDTFS  4032

4115  ESQLLAICVDLFIAGSETTSKALGFGFLNLILNPQIQRKAHEEIDKVTGRNRFPTLADKPK  4297

4399  MPYVEAIVLESIRVFVGRTLSVPHRALKDTFIVGHKIPK

      DTMLVANFNRILMDESWNDPEDFRPERFLDNNGNIITPEKYFPFGM  4758

GKHHCMGETLARSNIFIIIATLLQAFSFSVVPGEPRPTTQDFVDGVTAGPKPYRALVSLRM*

 

>CYP305D1 scaffold00006 from ant genome portal

62% to CYP305D1 Linepithema humile, 51% to CYP305D1 Apis mellifera

AC03409-PA ACEP_00003409-RA

3946707 MFVTVILAILTVFLIIFVLRKRAKYPP 3946787

3949365 PFPWPIFGNRYYLEKLTRKFGGQYLAFLELSKIYNSNIISLRLGTDDVIVVTNSKFVHEV 3949544

3949545 CFSEIYDGRPWNEFTKLRNMGMKK 3949616

3951018 GITLNDGAEWKELRSWSVRTLRSVGFAKQTMMELIVEEMTLIIEKLAT 3951161

3951162 GGVQQIQSAFAPAVINVLWMLITGQKPSENLPR 3951260

3951412 lqKFLNLMERRAEKFDLTGGILTAFPWLRYIAPEMSGYNFLVKLNNELKNFLM 3951564

3951635 DTINEHKEQYIKGNETDFIDLFLKEMYNNVEEQRDKVS 3951748

3951955 vfSDDNLLITLLDFFIAGISTTTATLDNLFLQMANHQDVQRKLYEEINDVIGSHKLPKLEDRIK 3952143

3952434 MPFTEAIITECQRLFHVTPVIGPRRVLKDTILDNYKIPKNTTVLMNVYSNNMDPNFFPDP 3952613

3952614 TSFKPERHINENGVYQQHENIILFGK 3952691

3953063 GKRRCPGEALAKSATFLFFVGVMQKFQLLPEPGKGFIQTELKSGLILAPKPYKMLIVPRS* 3953293

 

>CYP306A1 ADTU01012323.1b Atta cephalotes contig12323 (-) strand

62% to CYP306A1 Apis mellifera (missing N-term)

AC06541-PA ACEP_00006541-RA revised

CYP306A AC06540-PA ACEP_00006540-RA

75% to CYP306A1   Linepithema humile N-term

       MIILLIFLGVFLIFLVYIFRKNRKTHRLPPGPSGIPLFGYLPWINSKRPHVSFTELARKYGPICGLQMGS

       VYTVLLSDPQLVRQAFSKDTFAGRAPLYLTHGIMQGY

28865  GLICAEGNLWKDQRRFVAGCLKNFGMTKLPGIKRDRLEERILAIVNEYTS (0) 28716

27766  KLKKLTMEDGIDPCETLHHYLGNVMNDIVFGKVYKEDDEVWKWLRHLQEEGVKHVGIAGPLNFRPFFL (2) 27563

24644  FLPRYGKVMELLIDGKLKTHQHYQTIIDEHRARPEKMDNFLAAFDDAMNTDTNNEHFTQQQFYH  24453

24452  LLADLYGAGVDTTFATFRWFLLFMAAYPDEQ (0) 24360

24229  KKIQDEMDELLGQKVPTLEDRLILIRLEAAIAETQRLRSVTPVGIPHGTTE  24077

21218  DTQIGDYDIPKGTMIVPLQWAIHTDPSFWHDPLSFKPERFIAEDGSLIKPKAFLPYQA  21045

       GKRMCVGDELSRMTLFLFGARILHSFVLSVPSG  20865

20864  MRLDLEGECGITLVPKPHRLIFTPRE*  20784

 

>CYP307B1 ADTU01025351.1  Atta cephalotes contig25351,

ADTU01025350.1

70% to CYP307B1 Apis mellifera

AC14345-PA ACEP_00014345-RA

12543 MIFIGVTTYFLLAIVLVALILIVMDHIRLKKKPKKLYDGDEPSDLPDPPGPKPWPILGSL  12722

12723 HILGRYDVPYKAFGDLVKAYNSQIIKLKMGSVSCVVINGLENIKEVLIVKGHHFDSRPNF  12902

12903 IRYHLLFCGNKEN  12941

955   SLAFCNWSDLQKMRREMLRGHTFPRAFTTRYNQLNGIIGDEMEWLINHLTGISGISVHAK  1134

1135  PLILHMCANIFFKYFCSRGFEYSHDSFSQIIKNFDKVFYEVNQGYAADFMPFLMPLHQRN  1314

1315  MTRMATWTHKIREFMEKNVIEDRATSWKSVIPEIDYIDCLINHIKTDAEPKMTWNMTMFA  1494

1495  LEDIVGGHSAVGNFLIKILGFLATRPHIQKTAQMEIDEIETTSKFIGLENRENMPYTEAI  1674

1675  ILEGIRLIASPIVPHVANQDSSIA

2357  GYKIEKDTFIFLNNYELNMSEELWTSPEDFMPQRFIQNGKLLKPEHFLPFGGGRRSCM  2530

2531  GYKMVQYISFSTIATLLKNFNILPVEKEIYKVPIGNLALPMNTFKVRFEKR*  2686

 

>CYP343A1 ADTU01010091.1 Atta cephalotes contig10091

58% to CYP343A1 Apis mellifera

AC06190-PA ACEP_00006190-RA

1516  MWFIIVCLVILTKILYDWRRPSTFPP 1439

4015  GPRGLPIVGNILDVKRLVDETKFYSHAWCRLADIYGPIVGLKLGIAEPMIIVSGKDAVIE  3836

3835  MMSRPQFDGRPNGFIHKLRTGGKRRGVLFTDGDIWRDQRR

3434  FVLKTLKEFGFGNVTMEDIILNDAISLTSTIESLTKLGPITNLYNITSIAVLNNLWTLV  3258

3257  AGTQ (2) 3234

3159  FDLDNSKLTEILSVVNEITRNTNVTGGILTHLPFLRYITPGLTGFTALNQKWTRMWQFIR  2989

2887  TEIMKHKQTRTHGEFRDFIDVYLAEMDKQSNSSissf 2789

2129  dEEQLISVVKDLFTAGVETTKNTIGFIITYLVVKQDVQRKVHEEIDRVLGTEILPRIVYK  1950

1949  NR  1944

      LPYLNATIAEVTR  1802

1801  LANVGPTSIPHRAMTDSTLLGYEIKKNYTLLANLRSVHMDEQHWGDPKEFRPERFINDKG  1622

1621  EYIEDPWLIPFGL  1583

1521  GHRKCLGEILAKNNIFLFTACLLQKFQFVLPLGHPNPILEGVDGFTIAPPHLSVVAIKRK*  1339

 

>CYP369A1 ADTU01017036.1  Atta cephalotes

73% to CYP369A1 Linepithema humile

missing the N-term (found on scaffold scaffold00027 at ant genome portal)

AC09496-PA ACEP_00009496-RA this model is fused to an upstream gene

2537074 MSPFLIVIFTLLVIYKLYKFVYDKPPNTPP 2537163

2537881 GIIRIPIGGSYWMLLWGNYKFPYLTIDYYVKKLKSKVISCYMGDSFTIIVNDYKSIKEVL

        SREEFDGRVTTAQHIKDRAFGKEL 2538132

121   GIFFIEGPQWHEQRRFTLRHMRDFGFGRRQDKLESEIMDEMTLFLDILKNGPIYDGEK  294

365   EILKGNLALFPDILYASAANNIWNIMFGRRFDRSEHDISRLLCRMSILFQRSNDPTGGAI  544

545   SQRSIFRYFGNMFSYTNHMKGSTTISNIIK 634

853   KYLDYQKTIINENDNQGFVDRYLKKLNGDDKLDNFTEEQLIILLNDVMFPAFSAIPSVIT  1032

1033  HVIKYLMHHPRIMEKVQNEIDNVVGTGRLATWDDRK  1140

1856  SLPYLEATIRETMRIETLTPLSITHKCLKKTTLQGYEIPANTFIFTNLAAMHHDPDLWGD  2035

2036  PKIFRPERFLKEDGQLAKDFTLPFGF (1)

      GHRLCAGETYTRYNLFGTVVLLVQNFNFFFVEGEPSSLEDKVPGIIVSPKELWIRLESR*  2353

 

CYP3 clan (25 sequences, 18 complete sequences, 7 pseudogenes)

 

>CYP6AQaP Pseudogene AC18167-PA ACEP_00018167-RA

55% to CYP6AQ10 Linepithema humile

scaffold00079

339249 GLDGMIVLMILIITVRLYMTHKFNYWKKRNVLHALPI*VLGNFKDSLLLKRS

LLKDFYDQGKRMPYIGFYILDKSSLLIRDVELIKNILIKDFDYFIDRY

TPNMTDRLNYSNLFFIKNPAWKIIRTKLSPIFTSGKLKKMFELMLECDDNLDTYLESLKLE

KDIELDMKDLPSKFFMNIVSTTAYGLSVN

MMNSPDIEFPK*YGKQSFKISILRAFEFLAILFLQYAILLSLVHFINAKLFNKKVTIF 7599

LRNVF*QTITQRIKSEEK

KRNDLINTLIELKGTYRDQD

DGDDLLAQAAVFFIA*L*NLFTTMAFILYERETSRSIKLKKEIKT*KRNSALDEMNGK 8052

ITYNMICKP

HLDMVEILKMYPVLPFLDRIEENLQGT*FRLVLEKGIPIFISLLGVHYDPE

YPTPDQFDPERFTEENKRN

VIDCVYLPFGDGLCMCI 340952

 

>CYP6AQb AC15555-PA ACEP_00015555-RA protein

two P450s fused on scaffold00079

gene 1 74% to CYP6AQ14 Linepithema humile

347978 MGLVTAYWGLDGMIILMTLIISAYLYMTRKFKYWKKRGILEITPIPFFGNFKECLFQK

KAPAYFLKDIYDEMKDLPYVGFYVLDKPFLLVRDRELVKNILVKDFNYFSDRYNTADPID

RIGYANLFFIKNPAWKVVRTKLTPFFTSGKMKKMFDLMLICVKNLDEYLDTLELK (1)

GNGKTIEVRELTAKFATDIIGSTAYGLDVNSFKDPNAEFRKYGKMIFYYNTYRSFEMLAIFFLPTIVR

LTRIKMFGKEPTDFMRKVFWETLTERMKSGLKRNDLIDILLELKNNNNNDQDLKDF (1)

TFDGDDLLAQAASFFSAGFETSSTTTTFALYELAIQPEIQKTLRKEIFEALKKSNGKITYDMVWSL

PYLDMVMSETLRMYPPLGYLNRKPNQTYKVPEFNLVIEKDTPVYISMLGLH 4946

YDPEYFPNPNKFDPERFNEENKRNRPSCVYFPFGEGPHACI (1)

GNRFGLLQTKLTLLKILSKCEVTLCKETLVPVVIDPKGAMTVPLNGILHLNFRKINTCAI*

 

>CYP6AQc AC15555-PA ACEP_00015555-RA protein

Gene 2 on scaffold00079

63% to CYP6AQ14 Linepithema humile

356886  MALMTDCWALDGIIILTILIITAYLYMTRNFKYWKKRGVLEITPSSFMECLFRKKAPAYFLKEL

YDRAKGEPYIGFHILDKPILLVCDREIIKSILIKDFNIFYDRYATGNPKDR

IGYTSLFLINNPAWKILRTKLSPFFTSGKMKNMFDLMLECTNHLDEYLDSLKLD (1)

GKGQIIEAKDISSRLTIDIISNTIYGLDVNTFKNPNLDFLKCGKKIFTNNYLRALEILAM

FFLPNISRIARLKLFGTEATAFLRKFFWET

LTRRMESGEKRHDLINILIELKKNNHDHKIEDF (1)

EFDEDVLMAQAISFFAAGFDTTAQPIVFTLYELALQPDIQNTLRKEIHQALNNFDGKITYDM (0)

IISLPYMDMVVSETLRKYPPLGFLNRNTMETYQIPNFNLVLEKDTPIYIPMLALHYDPEYF

PNPEKFDPERFNEENKRNIPSCVYFPFGDGPHSCI (1)

GNRFALLMIKLILFKMLNKYEVTPCEKTIIPVIIDSAVALTGPLNGVIYLNMRKANTVTD*

 

>CYP6ASa AC14489-PA ACEP_00014489-RA protein

71% to CYP6AS52 Linepithema humile

MESFEILCGIAVVILFLYYFLTSTFDFWKSRGVPGPQPIPGFGNFKDVMFNKISSGDYLTKIYNTYKDEP

LVGIFSIKTPILIIKDPNLIKDVLIKDFTKFADRGLPIFEKTEPLSQHLFSLEPKRWRPLRTNLSPIFTS

GKLKEMFSLMSECADHLIQYIEKISSKNEPIECRELSAKYTTDVIGNCAFGIDMNALSNEESEFRRMGRK

VFALTWTRILRIRIRQISPWLYNMLGYVLPHTDVTRFFTRVITENMDYRETNNIIRNDFIDILRELKKHP

DKFGDFDLTDNLITSQAFVFFIAGFETSSTTISNALYELALNQNIQNSLRKEINEVYVKYDGDLIYDNIK

KMSYLDKVFKETLRKYPVVTFLMRQSITSYTFDGTKVNIPEGQKVWIPVYAIHRDPSIYPKPDVFDPERF

NDDTMQSRHPMSYLPFGDGPRNCIGSRFAIYQSKVGLLKILRNYKIETCEKTPIPYVNDPRSFILAPKDG

LYLKIIKINQI

 

>CYP6ASb AC08157-PA ACEP_00008157-RA

63% to CYP6AS7 Apis mellifera

missing the C-term

AC08156-PA ACEP_00008156-RA

74% to CYP6AS55 Linepithema humile

missing N-term

joined seq 71% to CYP6AS52 Linepithema humile

MESFEILCGIAAVVLAIYYFLTSTFDFWKSRGVPGPRPIPGLGNFKDVMLTKKFAGDFVKEIYNTYKNEP

LIGIFARKTPILIVKDLDLIKNILIKDFSNFADRGLPSFKKAEPLSQHLFTLESKRWRPLRMRLSPVFTS

GKLKEMFSLISECADHLILYMEKIASRNEPVECRELMAKYATDVIGTCAFGIEMNALSNEDSEFRKMGRK

IFIPTWTNVLRLRMRESFPRLYEMLGYILPQTEITKFFTRIIMETMNYREMNNITRNDFIDMLRELKKHPDKLGDNF (1)

DLTDGLITAQAFVFFVAGFETSSSTISHALYELALNEKIQSNLRKEINEVYAKHGEDLTYDNVKKMDYLDK

VFKETLRKYPPVTFLVRRSLSNYTFDGTKVSIPKNQQIWIPIYAIQRDSDIFPKPDIFDPERFCDDAVQS

RHSMTYLPFGDGPRNCIGARFGVYQSKIGLIKVLRNYKFETCEKTPIPYVNNPKTILLAPKDGLHLKIIK

INRT

 

>CYP6AScP pseudogene (exons 2,3,4,5)

AC15874-PA ACEP_00015874-RA

40% to CYP6AS58 Linepithema humile

scaffold00088, no more P450 sequence in a 20 kb region

AC15878-PA ACEP_00015878-RA

45% to CYP6AS40 Linepithema humile

aa 380-485

joined seq = 51% to CYP6AS58 Linepithema humile

beginning of exon 2 is broken and no exon 1 can be found

scaffold00088

CYP6 AC15877-PA ACEP_00015877-RA

48% to CYP6AS45P Linepithema humile

aa 291-360

454167 IKAKLSPLFTPSKLKSMLSLLIQRSEVFKNWLDNSL

LLRNKYINCSELTEKLTADYSSVCLLNYEIKTFQDKEIEICKYAKKFNKGSWKYILKQLLPDKVTHNKLY

DLISYYLFDAELMQFCFRFATDIVNYRKKHNISKYDAFNVLKELKKNQKLTEK  453691

442993 EMSDQRFVCELFMLFLAGFDTSATTICNTLYELALNHTIQNRLREEIRNMYIKSNGEITLDDINTMFYLDTICK

433816 ETMRKYPVIDIITRQASSDYTFRNSQLTIPKGQVIHIPVYSIHFDPDIYPKPEIYDPKRFDEVARFRRSMHY

       MPFGFGPRNCI (1)

       GERFGLLQLKMGLITFLRNYKFDVCEKTPRKLKYISTVLIQHPKDIYLKITKI

 

>CYP6ASd AC07339-PA ACEP_00007339-RA

46% to CYP6AS30 Nasonia vitripennis

69% to CYP6AS42 Linepithema humile

scaffold00016

MATGMFEILCAFVVILYLLYYYLTSDFDYWTSCGINGPKPIPFFGNIVDFLMGKKNMGDFYKEIYDRYPK

ESMVGVFLRGNPVLVIKDPEYIKQVLIKDFTTFADRHSIVYEK (0)

AEPMSMHLFRLDAVRWRSLRMRLSSVF

TSGKLKDMFHLLLKCSDHFEKYLDEIVSKDSIVECRHLTSKFTIDVIGSCAFGLEMNALKEENNQFQRMG

YKIFRFGPKVMIRNVLKDIPWFYKNFGYFFNDHDVTKFMIDITRETIDYRKRNNVRRNDFIDTLIDLKDNPDKLGVN (1)

SVTDEFIAAQSFVFFAAGFETSSITMSLAMYELAKNQSIQEKVRKEIKEVLDNVDGVISYDSIKKINYLEKIFQ ()

ETLRKYPPVTFLIRKPIKNYTFEGTKITLRKGQDVIIPNYAIQHDPNIYPDPEVFDPE 6396

RFSAENIKQRNPMYYLPFGDGPRNCI (1)

GARFAINQIKIGLIKVLMNYKIDVCEMTQIPLIRAPWTNFMFQTTHGIYVKLTKLV*

 

>CYP6ASe AC14518-PA ACEP_00014518-RA

67% to CYP6AS53 Linepithema humile

CYP6AS AC14517-PA ACEP_00014517-RA

77% to CYP6AS52 Linepithema humile

Joined seq 72% to CYP6AS52 Linepithema humile

CYP6AS AC14519-PA ACEP_00014519-RA

67% to CYP6AS52 Linepithema humile N-term

scaffold00063

78199 MGPFEILCGIAAAVLALYYFLTSTFDFWKSRGVPGPRPIPGLGNFKDIMLNNISAGDYLAEMYNTYKNEP

      LIGIFARKTPILIIKDLDLIKDILIKDFTKFADRGFPVLEK (0) 78531

83386 ADPLSQHLFFLEPKRWRPLRMKLSPAFTSGKLKEMFALMSECADHLIQYMDKITNTGNPIECRELTAKYTT

      DVIGNCVFGIEMNALSDENSEFRKMGREAFNPSWLNILRIRIRQIFPWFYNILFGYFLPQTNVTKFFTRVI

      VENMDYRETNNINRNDFIDILRELRNHPDKLDGI (1) 83913

88379 DPTDSLIASQAFVFFLAGFETSSTTISNVLYELALNPEIQDKLREEIDEVYAKHGGNLIYDNIKKMNYLDMVFK (1) 88600

88771 EILRKYPPGTIVMRQSTSSYTFDGTKVSIPKDQKVWIPIYAIHRDPNIYPKPDVFDPERFNDE

      VVQSRHSMSYLPFGDGPRNCI (1) 89022

      GARFAIYQSKLGLTKILRNYKIETCEETPIPYVNDPKAFILAPKGGLHLKMVKINRI*

 

>CYP6ASfP PSEUDOGENE

AC14492-PA ACEP_00014492-RA

61% to CYP6AS52 Linepithema humile

CYP6AS AC14491-PA ACEP_00014491-RA

scaffold00063

610184 MELFEILCSIVATVLAFYYFLTSTFDFWKSRGIPGPRPIPGLDNFKDIMLNKISA 610348

       GDYSTEIYNTYKNESLIGIFARKTLILIIKDL

610462 DILIKDFTTFIDRGFTSSEKG 610524 KNKTK

611897 TDPQNLFFLEPKRFWSRSLRMKLSPVFTFSKVKKMFGLISKYADHLIQYIDKVI 612058

       NTGNAVECHELTAKYATDVIGNCS

612135 FSIEMNALSDENSEFRKMGRELFR 612206

612244 KISQTDFSWFYNILFGYFMP 612303

       CRNVTKFFIYIIMKNINYRETNNIIRNDFINILKNHRELKNHPDK 612433

618171 DLTDGLIASQAIAFFVGSFD 618230

618229 TSSTTISAFYELVLNQEVQDKLREEIDQIYAKHDEDLIYDIKKYMILKNKLFR

618580 ETLRKYPPGTIIMRQSTSSYTFDGTKVSIPKDQKVWIPIYAIHQDSNIYPKLDVFDPERF

       NNEVVQSRHSMSYLSFGDGPRNCI 618831

618969 SSFGIYQSKLGLTKIFRNYKIETCEKTPIPYVNDPRAFILAPKDGLHLKMIKLTR 619133

 

>CYP6BC AC01935-PA ACEP_00001935-RA protein

81% to CYP6BC3 Linepithema humile

scaffold00003

2747063 MLDVVAILLDPFLLIGFVLGSLYFYLTATFDFWKCRGVPFKKPTVLVGNFGPLLLFRTSQPEGVKEMYQW

FKNERFFGAFRVRSPVLILRDPDLVRSVCVKDFACFVNRGIPINNDQ (0) 2746713

DPLSGHLFNLEGRKWKGLRSKLTPAFSSGKLKRMFYLLVECCEELQRLINEASNFADQTVEVRELAAKFIID

VIGSCAFGIQINALTDEESEFHRAVKKLSKPSYKATLWRMLRTAMPRLYRLMGVQLVDPSVTQFFTHVVSQM

ISQRENNGTTRYDFMDLLIELKNKGTLESEATNSRICSDEDAQAAKEI (1)

ELDENTIAAQAFGFFAAGYETSSNTIAFCLYELALNQEIQDKTRREVHNAIGTRDGKLTYDAVQ

EMKYLDMVIL (1)

2744778 ETLRKYPPAPLFARRCEYKYRIPDSNVELPAGLRVVIPIYGLHHDPNYYPDPARFDPERFT 2744596

2744595 EKNKRTRHPYTYLPFGEGPRNCI (1) 2744527

2743232 GMRFALLQIKMGIIAFLKDHRVEICEKSPVPIKFSRRSLVTASETGYWLTITSSS* 2743065

 

>CYP6BD Pseudogene

AC08247-PA ACEP_00008247-RA

CYP6BD AC17730-PA ACEP_00017730-RA

54% to CYP6BD7 Linepithema humile

scaffold00020

MAILYEYVLLDALVIFSSLFATLYLWMKWKHTYWQRHGVPTLSAH*FFGHFKDAMLFRR

SAEVILRELHKLRMKMS*GSTSYISHSYIIPFLILRNPELIK*IMIKDFNIFLNHYFK

GANNSDTISKWNLFSIYPE

RSKMTLVFTSGKLKSLFQLMQESGEKRDHLHDQIKDNSKIVSIKVKDTFYKYITDVISSVAF

GIWTNCFDTPSPEFYV

TVSKIINISNEFKHAIHYISLFFV

XXXXXXXXXX

MLGKYTVLPQNLLGL*MDNRSVTKIKREDL

Xxxxxxxxxxxxxxx

FEGDALLAQAAIFFVAGRETSIVIMICALFELVKQPEMQRRVREEI

IKDTNDVTYEALHNMKYLHQVINETLR

PPAPIIDRFPLSDYTXXXX

112802 SFLAQKYVTVKKDVPIYVLHGIQTDPRYYLNPMHFDLEQFSDERKDEIVLCTFLSFGESPRNCI

LQTIMGLITILHDYEVALH

PLWKNSIDPRNVFISSSAGF

 

>CYP6BE AC11515-PA ACEP_00011515-RA

69% to CYP6BE6 Linepithema humile

GC boundary at KISL

scaffold00035

557200 MVLAELIGVFILALSILYVYYKFVIFNFWHKRGVFYVKPVVPIGNLTELVTGKISL (1)

       GEFFQNAYMKYKDHRAFG

553351 MYTFFRPNLVITDPDLIRTVLTKEFGSFHDRGMYFNEKVDPLSGHLFLMPGKK

       WRNLRVKLTPTFTSGKIKQMFPIMKEYSEKLAKYLKEKAQMKDPIEMKEMLAR () 553034

551515 YTTDVIMSTAFGIESDCIENPNNQYRSYQKKILEINPIWIALSVFTPKIMD

       FFSIPFTDRTVISFYMNMFQETVEYRQSHNIVRYDFVNLLLQLMKRDYVDPDENKITNHVS ()

551007 STVNKLTMTEATAQSYVFFIAGFETSSTTGSYALYELAQHQDIQDKVRKEIDEILEKH 550834

       GELTYDAVNEMTYLHKVVN

548207 ETMRKYPPVPILNRICTKEITLPTTNIRVPEGTLITIPVLGLHRDPSLFPNPDKFD

       PERFNADKIEERHAYTYLPFGEGPRNCI (1) 547947

       GSRFGYTQTKIGLVSLLSRYIFKLHSQTPIPLTFSKNSFILTAKNGMHFIIEPRK* 547294

 

>CYP6ES AC00187-PA ACEP_00000187-RA

64% to CYP6ES1 Linepithema humile

scaffold00001

12932630 MDCLIYYTSALIISFSLFYAYAKYKLSYWNRRGVKSPPTHLFFGNFKDCIMLKKSPGDKIREIYNSADPD

DPYIGFYIFHKPLLILRDHDLIKQIMIKDFDNFPNRRFGSGSQMDPIGLDSILSMPQPRWKYVRNKLTPV

LTGQKLKNMIPLMIENGKSMLNFIENLPTNEDGWSEYEVKDISSRYITDVLASLTFGININSFDDNETAFCKT (1) 12931992

12931425 GVTVFRGFMRGIIFIIQFFLPDWDFLVVPFIKKPANYFRNIFWDSMNTRERLGFKRGDMIDSMLALKNGKQNPIY (1) 12931198

KFEGDNLVAQPSSLYLAGFETTAIAIAYVLHDLGHHPEHQDTIYNEIQTQLSGKELTMDLIN

GLSFLDSVVIESLRLHPPLPITDRITTRDYE (0)

LNSGLIIEKNVPVYVSINGTNQDPKYFSNPQDFIPSRTEMKEKKFYESLAFGIGPRSCI (1)

AQRFALLIIKVAIIIIISNYTIFYKTNKEYDNKVIHVFTYTPDLYVKFKKRN*

 

>CYP9Ra Pseudogene AC17380-PA ACEP_00017380-RA

two genes fused 57% to CYP9R10 Linepithema humile

scaffold00019 (-) strand

1628694 YWSILLFIDRCEYSLSFRNFNFFKRHDIIHILPIPIFGTIIPPIFFRISFIIISLFID 1628521

YFLNIYIIQ*HIYNFNPNTKYYGFYLMITPVIFLLRNPELIKNILVKNFESFPNRFDFSG

NDPLRKNNLFSLCGEK*RNVRNLLI

PSFTSSKMKMIY

DFTKFITTLPADERN

INTKDAFSK*TNDVIALCAFGIKINSMKDPTNEFYINSKKIVFNFKEIRALKFLLLRTF

LNLKIVDDYLSDLFKDIDLKTTIATRDAEHITRDMLQLIMNIRDKGDHKELN

IDDMITQAFIFFLGGFKTSSTAMCFAHEIAANPEIQLKLQQEIDKGLKESNREVFYEII

NRLKYLDAIINEILRLYRDYIEILHFLS*KEYAKKNEPYKLPHCLTKNLLS

*KSMTIWLPAFAIQRDEKYYDNLKKFDPERFLDNKMHTSSC

FMLPFRLGPRMCIANRFAMLKKIKSFLF

1627285 HLLARCELKSSAKTASPIKFCKGLMIMLKNRF*LNIQCKKD*HPAL 1627148

 

>CYP9Rb Pseudogene AC17380-PA ACEP_00017380-RA

68% to CYP9R8 Linepithema humile

scaffold00019 (-) strand

1622357 MEYWSILLSIVISVMSIHYLFRNFNFFK 1622274

RHGIIHIPVPRFGAMTSVIFHRISIVDFLLKIYNFN

PNAKYIGFYLATTLIFLLRDPELIKNILVKNFESFPNRNGFSDLNDSLFEKNLFSLQGEK

WRNVRALLSPSFTSSKMKMMLMSECAMDFVKFMPTSLADEESINTKDVFSKYTNDVIA

TCAFGIKVNSMKDPTNKFYVYGKEASNFR

VIRGI

1621674 KFLFLGTFPRFSRILNIKILNDYVSNFFKDIIKTTIMTRDAEHITRSDML 1621525

1620729 DNKMHSSSWYMPFGCEPRMCIANRF 1620655

1620659 GLLEIKVLLFHILARYDLKSCIKTMSPIKFCKDFTIMPENGFWLNIRRRKDKHSAL 1620492

 

>CYP9R ADTU01013320.1b Atta cephalotes contig13320

74% to CYP9R10 Linepithema humile, 51% to CYP9R1 Apis mellifera

8072  MEFYWSMLLSIVIGVISIHYLFKNFNFFKRNGIIHLPPLPLFGSTISMVFRRISFFDFML  7893

7892  KIYNCYPNAKYFGFYFTTTPVFLLRDLELIKSVLVKNFDAFPDRRGFADFNDPLFEKNLF  7713

7712  SLHGEKWRNVRNLLSPSFTSSKMKMMFTLMSECAVDFAKFLSTSADKGGINMKDVCS  7542

7541  KYTTDVIATCAFGIKVNSMKDPTNKFYIYGKEASNFTGVLRGIKFFFLETFPKLGRILNL  7362

7361  KIMKDYVSDFFKDIIRTTIATRDAEHITRPDMLQLMMDIRGKEGRRELDIDDMTAQ  7194

7193  AFIFFLGGFETTSTAMCFAAHEIAANPEVQTKLQQEIDKVLEESNGKVSYEVINRLEYLD  7014

7013  AVISEALRLYPPITNLERLCEKTFELPPALPDEKPFMMKKGMLVWIPVLAIHHDEKYYDN  6834

6833  PKKFDPERFLNNKMNNSSNYMPFGLGPRMCIANRFAMLEVKVLLFHLLAQCELKPS  6666

6665  VKTMSPIKFCKDLITMPENG  6606 FWLNIQRRKKYSFCTGINNG*

 

>CYP9R ADTU01013320.1a Atta cephalotes contig13320

50% to CYP9R1 Apis mellifera

3504  MEYWSILLSIVIGVISIHYLFKNFNFFKRNDIIHLPPVPLFGSTMSVVFRRISIFDFIL  3328

3327  KKYNFTPNAKYFGFYMMTTPVFLLRDLELIKTVLVKNFEAFPNHRGFVDFNEPLFENNLF  3148

3147  SLRGEKWRNVRNLLSPSFTSSKMKMMFTLMSECAVDFAKFLSTSPADKGSIDMKDICT  2974

2973  KYTNDVIATCAFGIKINSIKDPTNKFYIYGKEATNFRGIIRGIKFFFLSIFPRLGRILNL  2794

2793  KIINNYVSDFFKDIVRNTIATRDAEHITRLDMLQLMMDIRGKGGHRELDIDDMTAQ  2626

2625  AFIFFLGGFETSSTTMCYAAHEIAANPEIQTKLQQEIDKVLEESNGEVSYEVINRLEYLD  2446

2445  AVICEALRLYPPVAALERICEKTFELPFII &

2332  KKGMLVWIPVLAIHRDEKYYDNPEKFDPERFLNNKMRNSSCYMPFGLGPRMCIAYRFA  2159

2158  MLEVKVLLFHLLARCELKPSVKTTSPMKFCKDVIVMIPEDG  2036

      FWLNIQRRRNMHSVLESTIIEASEIFSNTK*

 

>CYP9R ADTU01002258.1a  Atta cephalotes contig02258

50% to CYP9R1 Apis mellifera

533   MEYWSILLSIVIGVISIYYLFRNFNFFKRHGVIHVPPVPIFGSMASVIFGRTSFFDFIF  709

710   KIYNFNQDAKYFGIYVTTNPIFLLRDPELIKTILVKNFDVFPNRRGFNELNEPLLAKNLF  889

890   SLRGEKWRNVRTLLSPSFTSSKMKMMFTLMSECAVDFVKFLSTLPANKSDMNIKDAFS  1063

1064  KYTNDVIATCAFGIKVDSMKDPTNKFYVYGKEATSFLGSRSLKFIFLRTFPSLGRILNIK  1243

1244  LINDYVLNFFKDIIKTTIVTRDAEHITRPDMLQLMMDIRGEESRRELDIDDMVAQA  1411

1412  FVFFFGGFDTSSTAMSFVAHEIAANPEVQNKLQQEIDKVLEESNGKVSYEVINRLEYLDA  1591

1592  VINETLRLYPPVTFLERMCEKTFELPPALPDEKPFIMKKGMTFWIPIFAIHRDKKYYDNP  1771

1772  EKFDPERFLNNKMHNSLCYMPFGLGPRMCIANRFALLEVKILLFHLLARCELKPSTKT  1945

1946  TSPIKFSKTLSMIPENGL 1999 WLNIQRRKNMYPVLESV*

 

>CYP9R ADTU01002258.1b  Atta cephalotes contig02258

pseudogene, last frag inverted on opp strand

47% to CYP9R1 Apis mellifera

8415  MIYIIVLLIAGILSLYYLLFKDLNYFKKHGIPYMKPFPIVGSMKSTFLRRESIPDFIKSVYNL  8227

8226  YPNAKYIGLYNVKNPIIMLRDPELIKSVTLKHFDMFMDHVSFVDENQDPVFGS*KEKTSV  8047

8046  LRGERWREIRSILSPTFTSSKMKSMYKLMFDCGVDFGSYLAQLPSEERIMEIKDVFTR  7873

7872  FTNDVIATCAFGVK*IL*EIEKIISMCMARKQPILQEI*FF*RCTYLELCP  7720

7719  GLHEYLN*HSFVKR*RIFFESL*KPL*KLDENGIVRPDMLQLMIESRGKDGKTELTI  7549

7548  DDMVSQAFIFFFRGFENTSTLMCFAAHEIAINQNIHKRLQNEIDQVLEDTNGQATYEAVNSM & 7363

7360  IDAIINETLRMYPVAVMLDRLCLKDFELSPPLPGIKPFTIKKGHGIWIPVYGLHHDSKYF  7181

7180  EKPKKFDPERFLGERKKDNLNCGAYLPFGLGPRMC  7076

      VGNRFALLETKVLLFQLLVCCDLKPCEKTSVPIKITKNSLFMKPEDGF*

 

>CYP9R ADTU01013321.1  Atta cephalotes contig13321

50% to CYP9R1 Apis mellifera

1652  MEYWSILLSIVIGVISIHYLFKNFNFFKRNGIIHIPSVPLFGSATFLFRRMSFFDFML  1479

1478  KIYNFNPNAKYFGLYFTTTPVFLLRDLELIKTVLVKNFEAFPDRRGFADFNDSLFKKNLF  1299

1298  SLRGEKWRNVRNLLSPSFTSSKMKMMFTLMSECAVDFAKFLSTSPADKGDIDMKDICS  1125

1124  KYTNDVIATCAFGIKVDSIKDPTNKFYTYGKEASNFRGVIRGIKLFLIGTFPILVQILNM  945

944   KFLDDYLSNFFKDIVRTTIATRDAEHITRPDMLQLMMDVRGKEGRRELDIDDMTAQ  777

776   AFIFFLGGFETSSTAMCFATHEIAANPEIQTKLQQEIDKVLEESNGEVSYEVINRLEYLD  597

596   AVISETLRLYPPITNLERLCEKTFELPPALPDEKPFMMKKGMLVWIPVLAIHHDEKYYDN  417

416   PKKFDPERFLNNKMNNSSNYMPFGLGPRMCIANRFAMLGIKILLFHLLARCELKPSAK  243

242   TTSPIQFGKGFMIMPKNG 189 FWLNIQRRKNMHPVMESISVVMNS*

 

>CYP9R ADTU01013322.1  Atta cephalotes contig13322

51% to CYP9R1 Apis mellifera

1679  MEYWSILLSIVIGVISIHYLFKNFNFFKRNDIIHLSPIPLFGSTMSIVFRRMSFFDFML  1503

1502  KIYNFNPNAKYLGLYFTTTPVFLLRDLELIKTVLVKNFEAFPDRRGFADFNDSLFKKNLF  1323

1322  SLRGEKWRNVRNLLSPSFTSSKMKMMFTLMSECAVDFAKFLSTSPVNKGDIDMKDICS  1149

1148  KYTNDVIATCAFGIKVNSMKDPTNKFYTYGKEASNFRGVIHSIKFFFIGTFPTLVRIFNM  969

968   KFLDDYISNFFKDIIKTTIATRDAEHIKRPDMLQLMMDIRGKEGRRELDIDDMTAQ  801

800   AFIFFLGGFETSSTAMCFATHEIAANPEIQLKLQQEIDKVLEESNGEVSYEVINRLEYLD  621

620   AVICEALRLYPPVAALERICEKTFELPPALPDEKPFIMKKGMLVWIPVLAIHRDEKYYDN  441

440   PKKFDPERFLNNKMNNSSNYMPFGLGPRMCIANRFAMLEVKILLFHLLAQCELKPSPK  267

266   TTSPIQFCKDFMIMPKNG 213 FWLNIQRRKNMHPVLESTPVVDS*

 

>CYP9R ADTU01013319.1  Atta cephalotes contig13319

48% to CYP9R1 Apis mellifera

1721  MEYWSILLSIIIGVISIHYLFKNFNFFKRHDIVHIPPVPIFGSAISVIFRRISLIDFIL  1545

1544  KVYYFNPNSKYLGFYFMTNPILVIRDLEVIKNILVKNFEAFPDRQGFSNTNDFLFKNNLF  1365

1364  SLHGEKWRNVRNLLSPSFTSSKMKMMFTLMSECAVDFVKFMPTSLADEESINTKDVFS  1191

1190  KYTNDVIATCAFGIKVNSMKDPTNKFYVYGKEASNFRGVIRGIKFLFLGTFPRFSRILNI  1011

1010  KILNDYVSNFFKDIIKTTIMTRDAEHITRPDMLQLMMDIRGKEGHRELDIDDMTAQ  843

842   AFIFFLGGFETSSTEMCFAAHEIAANPDIQTKLQQEIDNLLEKSNGEVSYEVINRLEYLD  663

662   AVINETLRLYPPIGFLDRMCKKTYELPSALPDKKPFIIKKDMLVWIPIFAIQRDEKYYDN  483

482   PEKFDPERFLDNKMHNSSCYMPFGLGPRMCIANRFAMLEVKILLFHLLARYELKPSMK  309

308   TVSPI 294 KFCKDGLLMPESGFWLNIQRRKDVHPVLTSYNCE*

 

>CYP336A AC17499-PA ACEP_00017499-RA protein

77% to AC17497-PA, 75% to AC17498-PA, 65% to CYP336A13 Linepithema humile

MTVVLVSLIFGALIAFYFYLTRNYKYWQKRGIPYVDGALPGFGNMLSVILMKTDLSELCRKIYNDNKGHS

MVGIYDFMSPALMILEPELVKTITQTNYSSFAENAIDINPDVDPLLSHNPFVLTGEKWVYNRKRLSYAFS

SMRLKILLESVKQVCTTFENYMNEKLNNNQTEFELKSLFAKYTAQVVAAAGFGVDGFCFDDEKKDMSFRK

LGQTIFEPSLRNSIVFVVTFLVPSLNKIFKLGVIPKHIDNFFRTLVAELMEQRRKDGIPRNDFLHLMVEQ

ERAEDDKFDLEMITAHAMSFIIDGYETTSSVMSFIGFDLARHPEIQNKLREEVLSVINKYNGEITYEGLK

EMTYMDQVLNETLRLLPAGVIMKKRCTEEFELKGSDGIVCRVEPGMEILIPVQGLQRDPQYWENPEEYDP

ERFSSDRKHSIDRFVFLPFGGGPRACVGMRMAQLQIKAVLSVILRKYRMKLSPKTQIPLKIIPGTVLPTP

LGGLWVYFQKL

 

>CYP336A AC17498-PA ACEP_00017498-RA protein AED:1 QI:0|-1|0|0|-1|1|1|0|500

MTVMLVSLILGALIVFYFYLTRNYKYWQKREVPYVDGALPGFGNMLSVICMKTHIADFYCKIYKDNKDHS

MVGIYNFTSPALMIIEPALVKMVLQTHFSSFAENAVHIDKESDSLLSYNPFGLSGEKWLKSRKRLTYAFS

SMRLKILLESVKKVCATMENYMDKKLSNKETEFELKSLFSKYSAQVVAASGFGVDGYCFDDDKKDISFRK

LGQAIFKPSKRSIIAYVLVFLIPSLNKIFKLSLIPKHVDNFFRTLVAELMEQRRKDGIPRNDFLYLMAEL

ERTEGDKFDNEMLTGQAMSFVLDGYETSSSVMSFVGFYLARYPKIQEKLREEVIAVFNKYNSEITYEGLR

EMTYMDQVINETLRLIPAELLMKKRCTQEFELKGSDGVVCRVSPGMEIFIPVQALHKDPQYWENPKEYDP

ERFNSDRKQIDKFTFLPFGEGPRICVGMRMAQLQMKAGLAMIVRKYKLELSPKTQMPLKFIPGTILPTPK

CGVWAYFRQL

 

>CYP336A AC17497-PA ACEP_00017497-RA protein AED:1 QI:0|-1|0|0|-1|1|1|0|501

MIIVLVCLILGALIAFYFYLTRNYKYWQKRGIPCVDGALPGFGNMLSVICMKTHIADFCCKIYKDNKGHS

MVGIYDFTSPALIIIEPALIKMVLQTHFSSFAENAVHIDEESDSLLSYNPFGLSGEKWLNSRKRLTYAFS

SMRLKILLESVKKVCATMENYMDKKLSNKETEFELKSLFSKYSAQVVAAAGFGVDGYCFDDDKKDISFRK

LGQAIFKPSKRSTIMFVLIFLIPSLNKILKQDLIPKHVDNFFRTLVADLMEQRRKDGIPRNDFLHLMVEQ

ERAEGDKFDIEMITGHAMSFIIDGYETSSSIMSFIGFHLAQYPDVQEKLREEVTSVLNRYGGEITYEGLK

DMTYMDQVFNETMRIMPAGALMKKRCTEEFELKGSDGVVCRVQPGMEILIPLQALHTDPQYWENPEEYDP

ERFNSDRKHNIERFTFLPFGEGPRICVGMRMAQLQIKAGLTMILRKYRMELSSRTQIPLKMILGTFLPSP

KGGLWVYFRQL

 

CYP4 clan (20 sequences, 10 complete sequences, 4 partials, 6 pseudogenes)

 

>CYP4Ga AC07562-PA ACEP_00007562-RA revised

87% to CYP4G65 Linepithema humile

GC boundary at VMK

scaffold00016:2650443..2658025 (- strand)

MSAAEPEIIAGSSVTAASNGLSSFTIFLSLLIPALILYYIYFRISRRHMIELAESLPGPEGLPLIGNALLLLGNSD (1)

TIFRTLYRKSFEYDQIIKIWLGPKLLVFLMDPRDVEIILSSHVYIDKSAEYRFFQPWLGNGLLIST (1)

GSKWRAHRKLIAPTFHLNVLKSFIDLFNANSRAVVERMRKEGD KEFDCHDYMSECT

VEILLETAMGVSKSTQDRSGFEYAMAVMK (2)

MCDILHLRHTKVWLRPDWLFNLTKYGKDQIRLLEIIHGLTKKVIARKKQEFKNGKRNIIDESTQNSNGKTTK (0)

STSVEGLSFGQAAGLKDDLDVEDNDVGEKKRQAFLDLLIEAGQNGTVLTDEEVKEQVDTIMFE (0)

GHDTTAAASSFFLSMMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERCLM

ETLRMYPPVPIIARTIKTDLKL (1)

VSGDYTIPAGSTVIVTTFKMHRQPNIYPNPEVFDPDNFLPEKTANRHYYAFVPFSAGPRSCV

GRKYAMLKLKIILSTIMRNYHVKSDIKESDFRLQADIILKRAEGFKIKLMPRKQAATTA*

 

>CYP4Gb AC06182-PA ACEP_00006182-RA revised

71% to CYP4G64 Linepithema humile

frameshift at &

MDADPVTTSHLPIIIYSLLGTIVTLLIASYYYVETSRAVRLIKKLP (1)

GPSAIPILGHSLLCYKESPEFLFQLALKYYTTYGNVIGVYVGLKTIVFFDES &

QDIEIILSSSVHIDKADEYR (2)

LFKPWLGDGLLITSGDKWRRHRKVIAPTFHMNILKTFVPFFYENS

IDLVNQLRDKIGKEFDCHDYLSAVTVDILTETAMGVMKERRPKTGYDYAMAVMK (2)

MSNILHRRHFNMSERYDIFFKFSKFSTLQKKFLKIIHTLTEQVIKEKSKDVEEKYEKSQQLKEAQNDKPIE

NSKIIENVKENAKNNAANYMHYVRDDLDDIDENDVGEKKRLAFLEMMFELKRNGQMTDEEIWEEVNTIMFE (0)

GHDTTAAGSSFALCVLGNHPDIQ (0)

ARVHEELDTIFGDSNRQCTFQDTLEMKYLERVIMETLRLFPPVPMIARRLNEEVKI (1)

VTGNYVLPKSTTVVIGQFLIHRLEEYYPNPTVFNPDNFLPENIQKRHYYAYIPFSAGPR (2)

SCVGRKYAMLKLKVLLSTILRNYRIISEISEKDFFLQADIILKRHDGFKIKIEPRTPTSYKE*

 

>CYP4AA1

AC15225-PA ACEP_00015225-RA protein

79% to CYP4AA1 Linepithema humile

MWIYLAFLAVIYIIYTLKNYIRILRFIFTLDGPKTVPILGNANIVLEGNLIQRMTNEAQSYGRIFRIWLT

LLPYVMLVEPEDIQVVLNSMKHTQKIFFYKLFDNFLGKGLITQNVDQWKVHRRILQPIFHRQVLEKFVGI

FGKCADRLVDKLFEKDGKDINITVFINNSVYDILIETILGTPTNQGKNDGEDDPFRKGQVMMSYRFARPW

LLIDWIYRLTAAGKSEKQQQKDLFNFCFKKMKEKREFLKKNGSLIADDSTIRKKSLLEYMVEISERNPQF

TERDIIEECCTFMLAGQDSVGTATAITLFLLANNPKWQERCVMELHEIFNNDTRSPTMQDLKKMTCLDMC

IKESLRLYPSVPLFARTLGEDIKLGKYIIPAGCGVFIAPYCTHRLSHHYPDPHDFKPERFSSENSEGRHP

YAYIPFSAGPRNCIGYKFATLEIKSIISAILRKCQLEPTLGKEKVIAKFRLTVRAQGGLWVKIRARNKQY

KLTQLN

 

>CYP4AB AC17295-PA ACEP_00017295-RA plus AC04297-PA ACEP_00004297-RA

61% to CYP4AB32 Linepithema humile

scaffold00009

5641852 MLISTFLLLILIVYLIYHYYVQYGPIGRLINNIPGPSGYPIIGNTLQLLISREDLWKLLKILSDKYSVWK

LWSFFEYIVSIRHPDDLETNYKNSIIFSVKKYTNNTSEIILSKPKTKLYNVLHPWFGTGLLTSGGSKWQS

RRKILTSAFHFNILQQFVEILIEESENMTKSLKNTEGTVVKNLVPFISEHTLNALCETTMGISLKEMNLD

QQRYRDAVYKMNQIIIYRMMRQWLRNDWIFSLTPKGREQVKILKILHGFTKKIIAERKVYHKYTNGQYLK

NFGEEAIVETDDVDNIKKRKKRLAMLDLLILASQENLLTDLDIREEVDTFMFEGHDTTAMGICFVLSLLA

EHKDIQDRVRKEINAVIQENQGKLTMKSLLDLQYLERCIKEALRLYPSVYFISRMTSDYVQLKT (1) 5647173

5650418 QSYLLPPKTMLHLNIYGVHRDPNFWSNPEIFDPDRFLPEKIQNRHPYSYLPFSAGPRNCI (1) 5650597

5650659 GQRFALLEIKAIIVSLIHNFFLEPIDYLKNVRLVADLVIRPIDPHRIKFIPVKT* 5650823

 

>CYP4AB AC04294-PA ACEP_00004294-RA revised

66% to CYP4AB32 Linepithema humile

scaffold00009

5662265 MIVITLILFVLIILIYNYYVHYGRNGRLINLIPGPSSYPIIGHVLMLQGS (1)

ENLWKLLITITDKYYPICKIWGFFTPIVSLRDPDDME (0)

AILNNMKHINKSLIYDVLLPWFNTGLLTSG (1)

GTKWQSRRKILTPAFHFNILQHFVEILIEESENMTKSLKNTGGTVVKDLIPFISEHTLNAIC (1)

ETAMGISLRDQGAYQQRYRKAVHEMGEIVMYR (2)

LMRQWLRYNWIFSLISKGKKQAKILRILHGFTER (0)

IIAKRKLYQECTNNQYLKDFDSDTMTETSDVETIK (1)

IRKKRLALLDLLIAASRKGLLTDLDIREEVDTFMFE (0)

GHDTIAKGICFALLLLAEHKDIQ (0)

NRVRDEIRTAIEENGKKFTINILQNLSYLDRCIKEVLRLYPSVYFISRITSEDIKL (1)

KSYIIPAKTIVHLNIYGLHRDPNFWPNPEIFDPDRFLLEKIRNRHPYSYLPFSAGPRNCI (1)

GQRFALLEMKAMIASLIHNFYLEPIDYLKDLQMEIDLVLHPVHPLRVKFVPIVKMHATI* 5668918

 

>CYP4AB AC04293-PA ACEP_00004293-RA

scaffold00009

exons 9,10 in a seq gap

60% to CYP4AB30 Linepithema humile (top part)

5676211 MMLYKFFHFVKFVRQINNIPSVPALPFIGHMLKFFW (1) 5676318

5676784 QDLWKFQRQLCKDYYPIYKLWCGPIAFVSIHHPDDLE (0) 5676894

5679216 KVLSSTKEHLSKGYLYDSLIPWLGTGLLTSE (1) 5679308

5681443 GIKWHKRRKILTPTFHFNILKQFVEILINEGNRMVKFLKDTNGSVNDLMFLVSHHTMNAXX (1) 5681619

5682076 ETAMGTSLQEMDEFQQYHQAIHDMGKIVIYR (2) 5682168

5682914 VLKPWLASNLIFSLTSMGKRQDKNLKILHGFTEK (0)

5683166 IIKERKQYHERTNGRYLKYFDDMTETDDEKIIG (1) 5683264

5683337 IKKRRLAMLDLLIAAVRNNEMNDLDIREEVDTFVFE (0) 5683444

 

 

5686450 KTHLVPSGTILHLNIYDIHRDPNFWPNPDVFDPDRFLLEKIQKRHPYSYLPFSAGPRNCI (1) 5686629

5686698 GQRFAMMELKAIMATLIYNFYLEPIDYLKDLQFKTDLISRVTQPIRIRFIPINRTPSKVI* 5686880

 

>CYP4AB AC15614-PA ACEP_00015614-RA plus AC18178-PA ACEP_00018178-RA

56% to CYP4AB31 Linepithema humile

scaffold00080

missing last three exons

56130 MFVIVLLSICVFILLVCNYYVHYGKIGRLPGPLCYPIFGSVYVLLCSR (1) 56273

56799 VLWKRIITLSNKYYPIGVIWAFFVPIVFIRHPDDLK (0)

57851 TILSNPKHIKKSFFYDNIKPWLGTSILTSE (1) 57940

58144 GTKWQLQRKILISTFHFDILNQFVEIFEKESKNMIKSLKNAEGTVVKDLSSFISEYTLNTIC (1) 58329

59812 ETAMGVSLKDFGGFQQQYRKAIHRMGELCAYR (2) 59907

60323 VTRQWLHFDWIFSLTPKGREQAKILNILHGFTER (0) 60424

60582 IIAERKLYHEQTNGQYLKNDDTSIEEDDTKLIS (1) 60680

60775 KRRKKLAMLDLFIVASREGLMTDLEIRQEIDTIMFG (0) 60879

60955 GHDTIAASLSFILALLAEHKDIQ (0) 61023

 

>CYP4AB pseudogene AC15613-PA ACEP_00015613-RA

51% to CYP4AB33 Linepithema humile (top part)

59% to CYP4AB33 Linepithema humile (bottom part)

up to ETAM exon possible pseudogene fragment

scaffold00080

119230 MFVIALLSICVFILVRNYYV*LLCNYYGKIGQFINLPGPL & 119349

119351 SIFGSVYVLFGSR (1) 119389

119904 EILWKIITLSNKFLRTFYPIGIIRAFFVPIVSIRHPDDLK (0)

       xxxxxxKHIKKSFFYDNIKPWLGTSILINE (1)

121308 GTKWQLQRKILIPTFHFDILNQFVEIFEKESKNMIKSLKNAEGTVVKDLSSFISEYTLNAIC 121493

(five exon gap)

122880 DRIVSETKSILQENENKLTMKFLHQLSYLEKCIKEALHLHNVAFFISRVCEEDVKL (1) 123047

123508 QSYLIPAGTVLHININGVHTDPNFWR & 123585

123585 IFPNPEIFDPDRFLPERIRNRHPYSYIPFSAGSRNCI (1) 123695

123762 GQRYAMLQMKMMVASLIHNFYLESVDYIKDIRFQINITVHPHSLRVRFVPVLQN* 123926

 

>CYP4AB Pseudogene AC16463-PA ACEP_00016463-RA

73% to CYP4AB29 Linepithema humile

aa 400-429

scaffold00526

2917 IPVATVMIIIYDIYRDPNF*Q

2980 NPEVFDLDRFLPENIQNHHSCSYIPFSVGPRNYI 3081

3193 IASLIHNFY & 3219

3221 LEPIDYLKNLQ 3253

 

>CYP4AB pseudogene AC17660-PA ACEP_00017660-RA

scaffold00021

54% to CYP4AB33 Linepithema humile

FVEILTEEDENMTNFLRNTV 656383

ARRKRLSMLDLLIAESREYLMIDTNIREEVDAFxxxxx

DSTAAAVSFILV*LAEYKD

IQERIVLGTNLLLQGNEKKFTFELLKQLPYLERCIKEALRLYPSVPFIFGEK 661232

ESYLVPAGTMIIINIYTV

HKNPNFWPNSEVQLFDP &

KFLFEKI*NRHLYSYILFSAGSRNCISKQ

KIMIASMIHNFYLESIDYLKDV*LQIDITL*PTQPFRIRFISIHKINA

 

>CYP4AV AC03981-PA ACEP_00003981-RA

joined seq = 74% to CYP4AV6 Linepithema humile

missing internal piece

scaffold00008

CYP4AV AC16489-PA ACEP_00016489-RA

89% to CYP4AV7 Linepithema humile

aa 100-145

3141562 MVLAILIPEWSFLTIFLSICMVTLSVPLMIRRTKFLYALKNVPHPSALPIVGNAYQLNCTQE (1) 3141377

        GFFQKLIKWANKFGDIYLVWVGMRPFIFLYRVESVQPLLSSSVHIDKSLEYQYLKPWLGTGLVTSS (1)

3126650 GEKWHVRRKLLTPTFHSGLLETYLKTIKEETNVLISCLEKEVDKWFNIVPFAKRVALDIC (1) 3126471

DTAMGYKLNSQKNLTKLKVDYVEAVDKVASIVQMRFTNVWLSFDSIFKLTKSGKEHDHSIQIIQEFVSKVIVKRKAEWKSD

ANFNNSKKKRQALLDLLLQISQNGTILSDEDIYEEVNTFMYAGHDTLATSISWTLYALGRNPEYQQKILE

EYNDMMMDTDEITLENIHKLTWLEACIKEQWRLYPVTPLIARQIYKPIEIMSNQIPPGSTVLINSYLLHR

DDRFFPEPHIYRPERFLPDGPKLPPYAFIPFSAGSRNCIGWKFATLVVKIAILSVLKAFHVEALDKEDEL

RFISELVLVNANGLRLKLTPR

 

>CYP4BW AC03183-PA ACEP_00003183-RA

72% to CYP4BW6 Linepithema humile

scaffold00005

375246 MDFIFLVLCILCIVGIFSILSNYHQYNIRQKFGNIPEIKGYPFIGVAFDFMKLSEY (1) 375079

373880 GRVKRFSSFIEEFKEGIFMYQLGTKPFINIFKPKYLE (0) 373776

372731 LIFPSTVNITKGDSYDLLKPWLGNGLLTST (1) 372642

368308 GKQWFHDRKLIGPTFHFSILDQFAVVLSEKVEILTKCFEKTIKDNPGKAVDVFPFIVNAT 368129

368128 LDIIC (1) 368114

365886 ETAMGVDVQAQEVVNKYVSTVHQ (2) 365818

365678 ASLLIIDRMIQPWYWIDWLYYLLPAGKQFKSTLDILHGFTKK (0) 365553

       VISKKKVERQSQNTKLENEDNEFNID

365250 KRKRKAFLDLLLDQNEKDDTPLTDDELRAQVDTFMFE (0)

       GHDTTAVAITWALFLLGNNLEHQEKVHEELEEIFGDSEVQASVK 364891

364890 ELSQLKYLERVIKETLRIFPSVPLIMRKLKEDVKL (1) 364786

363540 DSYTLPKGTLVVLAIMLTHRSSEIWPDPLKFDPDRFLPENSQNRNPYAYIPFSAGPRNC 363364

363363 IGQRFALLEEKIVLTAILRKWRVKSVKTIDTIEYGSSLIMRPIEEVFIHFTPKK 363202

 

>CYP4BW AC03184-PA ACEP_00003184-RA

scaffold00005

missing exons 3,4,5 in a sequence gap

76% to CYP4BW6 Linepithema humile (last part)

348751 MDLIFLTLCTLCIVVIFTFLPKVYHHYVIRQKLKNLPAPVIDSIFKLMRLSDY (1) 348593

347999 ERMKLFLTVIENCKEGIFIHYIGITPYINIFKPEYLE (0) 347889

 

341773 TSSLIIKRLLRPWHWIEWLYYLLPTGKQFKSALDILHGFTKE (0) 341642

341474 VISKRKIERQSQNGHTELENEDNEFNI (1) 341442

341332 GKRKRQAFLDLLLDQNEKSDTPLTDDELRAQVDTFMFE (0)

       GHDTTAVAITWTLFLLGNNLKHQAKVHEELEEVFGDSET 340970

340969 PASVKELSKLKYLDRVIKETLRIFPSVPLISRELSKDVKI (1) 340850

339151 DNYILPKGITVILTILLTHRNPMVWPDPLKFDPDRFLPENSKNRNPYAYIPFSAGPRNC 338972

338971 IGQKFAQLEEKIVLTAILRKWRVKSVKTVDTIKFEGSIILRPNEDVLMHFTSK 338813

 

>CYP4BW AC03186-PA ACEP_00003186-RA plus AC03187-PA ACEP_00003187-RA

72% to CYP4BW6 Linepithema humile

missing the N-term

scaffold00005

322574 MDLIFLTLCTLCIVVIFAFLPKVYHHYVMRQKLKNLPSPVTGSIFKLMRLSDY (1) 322416

321871 ERTKLFLMEIEKCKEGIFIHYIGIAPYINIFKPEYLQ (0) 321761

317260 ILPSTVNITKGDFYDMLKPWLGNGLLTST (1) 317174

314900 ASGEQWFHDRKLIGPTFHFSVLDQFAMIVFEKAEILTKCLQKEIEKDPGKAVNIFPFIIN 314721

314720 VALDIIC (1) 314700

314270 ETAMGVDIHAQEVVTKYTXXXXX (2) 314217

306001 TSSLTTKRLFRPWHWIEWLFYLLPTGKQFKSALDILHGFTKE (0)

       VIRKRKIERQSQNGHTELENEDNEFNI (1) 305675

305564 GKRKRQAFLDLLLDQNEKSDTPLTDDELRAQVDTFMFE 305451

305319 GHDTTAVAITWTLFLLGNNLKHQAKVHEELEEVFGDSETPASLKELSKLKYLDRVIKETL 305140

305139 RIFPSVPIITRELSKDVKI (1) 305083

303448 DNFILPKGVMVVLAILLTHRNPVVWPDPLKFDPDRFLPENSKNRNPYAYIPFSAGPRNC 303269

303268 IGQKFAQLEEKTVLTAILRKWRVKSVKTVDTIKFEGSLTLRPSEDVLMHFTSKK 303107

 

>CYP4BW AC03188-PA ACEP_00003188-RA

71% to CYP4BW6 Linepithema humile

scaffold00005

294230 MDLIFLTIYTLCILVIFAFLPKVHHHYVIRQKLKNLPSPVIGSIFKLMRLSDY (1) 294072

293535 ERMKLFLTIIENYKEGIFIHYIGITPYINIFKPEYLE (0) 293425

290149 HILPSTVNITKGDFYDMLKPWLGNGLLTST (1) 290063

287720 GEQWFHDRKLIGPTFHFSILDQFAMIVFEKADILTKCLQKEIEKDPGKAINIFPFIINAA 287541

287540 LDIIC (1) 287526

287097 ETAMGVDIHAQEVVTKYTSTVHL (2) 287032

285650 TSSLIIKRLLRPWHWIEWLFYLLPTGKQFKSALDILHGFTKE (0)

       VISKRKIERQSQNGHMELENEDNEFNI (1) 285324

285214 GKHKRQAFLDLLLDQNEKSDTPLTDDELRAQVDTFMFE

       GHDTTAVAITWTLFLLGNNLKHQAKVHEELEEVFG 284864

284863 DSETPASVKELSKLKYLDRVIKETLRIFPSVPLISRELSKDVKI 284732

282997 DNYILPKGVMVVLAILLTHRNPVVWPDPLKFDPDRFLPENSKNRNPYAYIPFSAGPRNC 282821

282820 IGQKFAQLEEKIVLTAILRKWRVKSVKTVDTIKFGGSLILRPSEDILMHFTPK 282662

 

>CYPCXa AC01144-PA ACEP_00001144-RA

61% to CYP4CX5 C-term

65% to CYP4CXd AC07210-PA ACEP_00007210-RA

scaffold00002 (+) strand

7431295 MLFVIIALSLTCVAISFFVQNYRLFFAFLTMKPLLEPLSLPFIGIFLFLYRYNSM (1) 7431426

7434971 xxxKVWTKFTETYSSPFRICLGPYLFIVVHELDQIK (0) 7435066

7440200 AVLKNRHSLDKSIVYNCLKPVFDMGLLTAS 7440289

7440654 ESTWTESRKIIAPAFGMMPMKEYFNIFVQESLILTEDLEKIAQSENEIECLDHLCRCTLKIAC (1) 7440842

7441608 DTMMGVKMERNLIDEWWKISAR 7441673 (2)

7446593 QIWQYRFRNVLLVPDIIFNFTSWRGKQQECLNSFHSIIEK (0) 7446667

       

7450141 DTRFYDILMHSFRNGKFTQKEIMDNIFTMLGA (0) 7450236

7450303 SSDTTATVVHFVIIMMANFPETQ (0) 7450371

7461168 EKAYKELLEIYGTETPKFAPVKYEDLQHMHYLDCIIKETLRLFPIVPMIGRKLTEDLKM (1) 7461275

7465073 GEFVLPKGADVIISLMGMHRNEKYWPNPLMFNPDRFLQEKTNCVPYYYIPFSDGPRNCI (1) 7465249

7465323 GLKYAMMSMKVILATLIRTFVFKLNQSIEIEKIKLISDILLSIDEPINIRIEKRISNNT 7465499

 

>CYPCXbP pseudogene AC01144-PA ACEP_00001144-RA

scaffold00002 (+) strand

39% to CYP4CX5 Linepithema humile N-term

7468575 MLFIIIVLSLICIAISYFVQHCRLFSSRTVKPLPGSK & 7468685

        LPFIGSTYHFLQCNSK (1)

7469704 NFSDFLNVCIKFAETYSSPFRIWIGPKLIIAIYEPDQIK 7469820

 

>CYP4CXd AC07210-PA ACEP_00007210-RA

42% to CYP4CX9 Linepithema humile

scaffold00015 (-) strand

2246187 MIFLSVVLITLAYVAIRYYIRNYRCLTYEIRNEDILPGPKKYYMTKYLYGNPD (1)

2244619 ELLNILCILGKYFSSPFQLLKRSFVIIYEPNQVK (0) 2244518

        TVLKSRHCSDKNIIFYKFAEEIFGTKLLTAS (1)

2243708 ESMWNQNRKKIAPSFSLNMLQRFFNTFVEESLMLTNKLEKVGINGNEIIFLEHIATCALDIAC (1) 2243520

        STIMGTKMELNKKDQYFKTVVR (2)

2242668 YRLYSVWNESWFDKIIFNFTTLGREQHQTSKLMHSLINE (0) 2242552

        QQLHELNKLHKTEMKTNNT (1)

2242304 NKTFFNILMEASHKKNFTQEMICDNVITMIIL (0) 2242209

        TSDKITITIDFVIFMLANFPEIQ (0)

2241541 EKVYKELMTIYGTETLISAPVKYDDLQHMHYLDQVIEETMRLFPTIPIIGRRLTEDVKI (1) 2241365

2241052 GNFILPKNTSIIIVLMLMNRQEQYWPNPLKFDPDRFLPERIKDSPLHYHIPFSDGPKNCI (1) 2240885

        GTKYAMISIKVILATLIRTFVFKVDKSIQIRNIKLKTDITLSTIEPLKIRIKKRDLQ*

 

>CYP4CXcP pseudogene AC01698-PA ACEP_00001698-RA

scaffold00003 (-) strand

37% to CYP4CX9 Linepithema humile N-term

8297145 MFGNSVSIYLTIVIISYFFWNYYQKIFFIKKLNTLPGSHCHLLAAFIIFF 8296996

8293849 IIKTIHDFSKDYPSLCQVWMGSKLFIAVYKPDEAK 8293745

8293466 ILHSKNCINKSIFYKFFDPAFDTESLVIS 8293380

8291833 SESMWSRMRIMQTAPTFSSFMLQNFFNTFVEQSLALTCKLEKVGLNKNEIIHVEHISDYIWRIAC 8291639

 

69% to CYP4CX9 Linepithema humile EXXR region

8267435 KKKVYQELLEIYGTETIKSAPIKYNDLQHMHYLDRIIKETLRIFPPAPLIGR 8267280

 

>CYP4CY pseudogene AC15909-PA ACEP_00015909-RA

76% to CYP4CY1 Linepithema humile

aa 318-407

scaffold00091 (-) strand

425080 AELIDCIDAVIKKYGNLTRVIVGTDIFIVLTKPEDYK (0) 424970

       LVLTNVNGNYKSSVTQTWEAILGDGIIRAS (1)

424539 GVSHKLRRKIIHPLMNIKYISEYITFFDSNFCTDILEKNVDGPMFDLKPYIAQYVFNIFLGEN* 424348

424094 FYSIIYNCCRLFKDAYSKVIKPWLRLNWI & 424014

424014 FFFTKNRKQMCIAQNTVLDFIYN (0) 423946

(70 aa gap)

421160 EKLRQEILVTFNNDKIDVQRLLSMRYLYMVFQETLRLFPVVPLISRQLTGDIKL (1) 420999

420900 ESCTLPEGCYVMIPIFAIHRNPMYWYKPLEFIPERFSSTHHRYTYIPFGVGLRDCV (1) 420733

420310 GQKYAFLFMATIIVNLLRRFRFVTVGNLNDVKTTTDIVLRLQHVKMSIFRI* 420155

 

Mito clan (4 complete sequences, one partial sequence and one pseudogene)

 

>CYP12KxP scaffold00032 Pseudogene

65% to CYP12K1 Linepithema humile

ACEP_00010862-RA (partial sequence)

2180680 RNAQPIKDIPGPKALPFLGN*FRFLPYISK 2180769

(gap)

2182925 SQGKLWHDFRSKVNPHMMQPRMIKAHVSQISEVASEFIEKIR 2183050

2183059 LRDPETLELPSVFTNELLKWILE 2183127

2183429 AICSIALDVALECLIPNLAAASEPRIMINCMHEMFDLMYCMEIQMSLWKIYNTRNLKK 2183602

2183603 FFHVLDTLN

2183967 KSLVNTSSKLKYETMNNSTNLHECSILEKLLHIDKITAQVMALDIL 2184104

2184787 xxxxxxTGNLSGSLLYYIANNSEEKLREEVMSVLLDKTLPITQNVLNQKRYAKACIKESLRLFP 2184960

2184961 IAVAILRTMQMDVCIGGGGYKIPAG 2185035

2185558 FDVMACHSLIVNEPTQFSRTQKYIPER*LRGNTEFPSAKEAHPFAYMPFGFGFRTCIGRR 2185737

2185738 FAEMELETLLLT 2185773

2187956 VIRNFRIE*HHGPLEYENRFINAL 2188027

 

>CYP12K AC05275-PA ACEP_00005275-RA protein

55% to CYP12K1 Linepithema humile

missing N- and C-terms in sequence gaps

FVCYAGEYYNVNVLT

MRMLHNKYGNIVKFDGLKKQPSIFLFCPELCKNMYQLQGKIPMRIAMEPLHNYRKSRKDIYKGQYGLTTR

LPNVNLQGESWKDFRSKVGPHMMRPNIVKMHATQIHDITSEFVDKMSTLRDPKTLELPDDFMNELYKWSV

ETMCLIALNYRMGCLKSNLALDSEPQIMINCVKEMFNLTYRIENVPSLLKISHTRNYQKLFRALDQINVI

SAKYIEYAKNNISKSRDNTNRDYSILEKLLCIDKQVALVMALDILMSTDTTSNAAGALLYYIANNKEKQD

KLREEVMSVLPDKTTPITHDLLEKIPYVRGCIKECMRLFPIANGILRNMPKDVSLGGYLIPKGVRRFFLA

NVMACHAVLSMDPKYFARPMEYIPERWIRDSPEFLLYRSTHTHAYMPFGYGVRACIGQRFAEMELEMLLLK

 

>CYP301A1 AC02082-PA ACEP_00002082-RA with revisions from scaffold00003

86% to CYP301A1 Linepithema humile

GC BOUNDARY AT GIDT

936330 MIMMDYRMKSLLRNCETRHRLSQSCEPFLQKIVLQTFCSDTITSECSHTSSRLASLSVKP

YNEIPGPRPIPIVGNAWRLLPLIGQYQISDVGKISQMFYEEYGKIVRLSGLIGRPDLLFV

YDADEIEKVYRQEGPTPFRPSMPCLVHYKSVVRKDFFGELPGVVGV (2)

HGEPWKEFRTRVQKSILQPKAIRKYITPIEVVTKDFINR (2)

IEKIKGDDDELPGDFDNEIHKWALE (1)

CIGRVALDVRLGCLNDTLSSNSEPQKIIDAAKFALRNVALLELKAPYWRYIPTPLWSRYVRNMNYFIE (2)

ICMKYIDAAIVRLKNKMDESDLSLIEQILAKETDPKIAYIFALDLILVGIDT (0)

ISMAVCSILYQLATRPEEQEKIHQELLQILPDPSVSLTTSHLDQAIYMKAFIREVFR (2)

VYSTVIGNGRTLQNDTIICGYKIPKG (0)

IQVVFPTLVTGNMEEYVADAKTFKPSRWLKDSNNENLHPFASLPYGYGARMCLGRRFADL

EMQVLLAK (0)

LLRSYKLEYYHQPLKYKVTFMYAPDGELKFKFIKR* 942767

 

Note: no CYP301B was found

 

>CYP302A1 scaffold00021

79% to CYP302A1 Linepithema humile

AC08292-PA ACEP_00008292-RA short at N-term 12 aa

4618816 MYARVKLCGKKGMIKKLCARSCSNNPYQIDSTKPKPFENIPGPRALPVIGTLYKYVPFI (1)

GEYNFTKLHTNGLLKLKRYGPLVREEIIPGQPVVWVFRPEDIAEIFKAETGLHPKRRSHL

ALLKYRKDRSNVYNSGGLLPT (2)

NGIEWWRLRREFQKVLSKPRNVVDYLEDTDAVVQEFVQLCSREKSNDFLPLFSHLFLE (1)

LICLVTFDVKMGSLSEEEKHPHSRSSKLIEAALMTNSVMLKLDNGPMFWRFFETPLYRKL

RKAQNYMEK (2)

IALQMVTQRNQDASICRKQSLLKEYLKNETLDIKDIVGMACDMLLAGMDT (0)

TTYSMSFALYHLARNTSVQEKLRLEATTLLTDPMSPITAEILRNATYTKAVIKETFRLNP

LSVGIGRILQTDVVLSGYHIPEGV (0)

TVVVTQNQVICRLPEYFDEPNSFRPERWLRDNNDKVTKLKEKFINPYTVLPFGHGPRSCI

ARRFAEQNLQVILLR (0)

ICRNLRFTWCGDSLDSVSLLINKPDGPIKLRFESLDA* 4610801

 

Note: did not find CYP314A1

 

>CYP315A1 scaffold00020 (+) strand

60% to CYP315A1 Linepithema humile

AC08199-PA ACEP_00008199-RA short at C-term, missing last two exons

725736 MHTTPRTLRRFTRSMNFHNDFNVSFSKRGTILGSDLRFLLLNDINDAAPSSWNITNQGLS

SVLSRTFAQDFGTSARKEPPEPRGLPWLGTILSLIMSGGAKKLHEYVDNRHQELGPVFRD

QIGPIEAVFVNSPAEYRKVLADLAGNTPRHFLPESWMLYNEIRTQNRGLLFI (2)

TLRCWNRDGEEWWHYRKILNKVMLKPAPKTFFCGPCQEAAENLTKEWQRYSRIGCVIPN

LEHQLYQWSIE (1)

VMLGTMIGSQWHACEPWLRRDIEDVATILHQIFTYTSRLSMIPAKLAMKLRLPVWNKFVK

AADEVLDKVRKLVPEMIELSNNDGLLQMILNNGIRGDEAVRIICDFVVAAGDT (0)

TSITMQWALLLLSTHPELQDQLFDEIKNLPLEDLLQHQLLRYTWKETLRLHPVAPFLTRY

LPVDSIIGGYFVPKG (0)

DLIILSLYSSGRDKNNFLRPNEFWPERWFRTGGKKIHSPIE

NVPFAIGVRNCIGQRLAETQLSLTLAQ (0)

NFKIECENRDRIKMILRMVSVPSESIRLKLIDREI* 729262

 

>CYP334A AC09407-PA ACEP_00009407-RA revised

62% to CYP334A1 Apis mellifera

MNATSTKMMPLLETANFEITTENVKIPKVMPRVRIEKTSLPFEEIPGPMILKLWEKYWRYVPLL

GRLSWNRNVTPIKYLFDKYGCVVRINGPLVNDIIMIHRPEHIAEVFKQESESPIRSGIDIL

QHYRLNHHKYRSAGAFSLQGLEWLEVKKKVAQPLHETVSDYIEKLDSVCDELINKIRNIRNRQDEVPTNF

DQELTAWGMECFYMTMFNKHFGFLDSTSKSASEATKIINALITAHTYMSRCETGFQVWRFFETPFVKKLY

EACDALDEVIGKYIRQTQNKLQTLSLSKQEESMNKERNLPLLEKMMIQRIHPNDISILLMDMLILGVQA (0)

VINCEAFLLYFLAKNPRIQKRLYNEIMTVLSKTDGTLTKESLKDMPYLKACIKESLRLRPAFP

YLTRLLPSEISLHGYTIPKGTFVIMANQITSQREEHFEDPKKYQPERWLNQDEHAHNDYQEYSCLPFGYG

IRSCLGKKMAETQMMLLTAK (0)

LVQEFTIEYDYAEIRSRFLMINVPNRSLRFRFVDKN*