This page has known lower eukaryote P450 sequences in FASTA format.  The whole page 
below this point can be pasted into the Do-It-Yourself WU BLAST second window to 
compare a new sequence with all of these by BLAST search.
Last modified August 9, 2001

>CYP51  Erysiphe graminis f. sp. hordei AF052515

MGISESFMFPYLQPLLQLGFGIALASGILSLLLLLTFLNVLKQL
LFKNPNEPPIVFHWIPIIGSTISYGMNPYKFFHESQAKYGNIFTFILLGKKTTVYLGR
QGNNFILNGKLRDVNAEEIYTVLTTPVFGTDVVYDCPNSKLMEQKKFMKAALTTEAFR
SYVPIIQNEVKSFIEKCDDFRKSKGIINIDAVMAEITIYTASHTLQGKEVRDRFDSSL
AVLYHDLDMGFTPINFMLHWAPLPHNRARDHAQRTVAKIYMEIINSRRTQKETDDSNL
DIMWQLMRSSYKDGTPLPDKEIAHMMIALLMAGQHSSSSSSTWIMLWLAARPDITEEL
YQEQLELLGSELPPLKYEDLSKLSLHQNVLKEVLRLHAPIHSILRKVKNPMPVPGTSY
VIPKTHSLLAAPGWTSRDASYFPNPLKWDPHRWDTGSGGVIGTDMEDEKFDYGYGLIS
TGAASPYLPFGAGRHRCIGEQFATVQLVTIMATMVRSFKFHNLDGRNSVAETDYSSMF
SRPMQPATIAWEKR

>CYP51 Pichia anomala AF019903

EFVKGALTRDAFKSYVPQIREEIIHYFQNSKNFKFGERKHGISN
VMATQPEITIFTASRSLMGKQMRERFDESFAGYYSDLDKGFTPINFVFPNLPLPSYRR
RDYAQQKISSTYMGLIKERRENNDIKDRDLIDTLMKTSTYKDGVKMTDQEIANLLIGV
LMGGQHTSAATSAWFLLHLAEKPELQEEIYQEIMKVTGGEDVTYDDLQEMPLVNNVIK
ETLRMHMPLHSIFRKVKNPLPVPGTSYVVPKGHHVLVSPGFAMTNENYFPQPEVYNPH
RWDEDSTSKAAQDSSTVDYGFGAVSKGVSSPYLP

>CYP51 Candida glabrata S75389

VFYWMPWVGSAIPYGTKPYEFFEDCQKKYGDIFSFMLLGRIMTV
YLGPKGHEFIFNAKLADVSAEAAYSHLTTPVFGKGVIYDCPNHRLMEQKKFVKGALTK
EAFVRYVPLIAEEIYKYFRNSKNFKINENNSGIVDVMVSQPEMTIFTASRSLLGKEMR
DKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQQAISGTYMSLIKERREKN
DIQNRDLIDELMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSAATSAWCLLHLAERP
DVQEELYQEQMRVLNNDTKELTYDDLQNMPLLNQMIKETLRLHHPLHSLFRKVMRDVA
IPNTSYVVPRDYHVLVSPGYTHLQEEFFPKPNEFNIHRWDGDAASSSAAGGDEVDYGF
GAISKGVSSPYLPFGGGRHRCT

>CYP51 Issatchenkia orientalis S75391

MPWVGSAVVYGMQPYEFFENCRKQHGDVFSFLLLGKVMTVYLGP
KGHEFVLNAKLSDVSAEDAYTHLTTPVFGKGVIYDCPNWKLMEQKKFAKVALTKESFI
RYVPLIKDEMLKYFNANFRGDSGKTDVLKSQSEMTLFTASRSLFGDALRNRLDASYAE
MYSDLDKGFTPLNFVFSYLPLPNYWKRDAAHKNISNTYLDLINTKRAGGEIKNEDLVD
ALLKNSVYKDGTRMTDEELAHLMIGVLMGGQHTSSATSAWFLLHLGEKPQLQEEIYRE
IQSVLGENFERELTYDDLQKLDLVNATIKETLRLHMPLHSIFRKVTRDLPVPNTSYIV
PKGHYVLISPGYTMLSERYFPNASEFQPHRWDEIKSIDGGISFGAEGENAKETVDYGF
GKISKGVASPYLPFGGGRHRCT

>CYP51 Candida parapsilosis AF019902

AQLYADLDKGFTPINFVFPHLPLPHYWKRDAAQQKISETYMTEI
ARRRETGDIDENRDLIDSLLVNSTYKDGVKMTDQEIANLLIGVLMGGQHTSATTSAWF
LLHLAEKPQLLDELYQEVLNALSGKGGNLDDLSYEDLQQMPLVNNTIKETLRLHMPLH
SIFRKVVSPLVVPNTKYIVPRGHHVLVSPGYAHTNERFYKDASDFNPHRWDESASTND
AGEVDYG

>CYP51  Kluyveromyces marxianus X97682

MTDQEIANLLSILMGGQHTSAATSAWAILHLAERPDVQQELYEE
QMRVLDNGKKELTYDLLQEMPFLNQTIKETLRLHHPLHSLFRKVMNDMPVPNTSYVVP
KGDHVLVSPG

>CYP51 Unicinula necator U72657

MYIADILSDLLTQQTTRYGWIFMVTSIAFSIILLAVGLNVLSQL
LFRRPYEPPVVFHWFPIIGSTISYGIDPYKFYFDCRAKYGDIFTFILLGKKVTVYLGL
QGNNFILNGKLKDVNAEEIYTNLTTPVFGRDVVYDCPNSKLMEQKKFMKTALTIEAFH
SYVTIIQNEVEAYINNCVSFQGESGTVNISKVMAEITIYTASHALQGEEVRENFDSSF
AALYHDLDMGFTPINFTFYWAPLPWNRARDHAQRTVARTYMNIIQARREEKRSGENKH
DIMWELMRSTYKDGTPVPDREIAHMMIALLMAGQHSSSSTSSWIMLWLAARPDIMEEL
YEEQLRIFGSEKPFPPLQYEDLSKLQLHQNVLKEVLRLHAPIHSIMRKVKNPMIVPGT
KYVIPTSHVLISSPGCTSQDATFFPDPLKWDPHRWDIGSGKVLGNDAVDEKYDYGYGL
TSTGASSPYLPFGAGRHRCIGEQFATLQLVTIMATMVRFFRFRNIDGKQGVVKTDYSS
LFSMPLGTPLIGWEKR

>CYP51 Candida albicans X13296

MAIVETVIDGINYFLSLSVTQQISILLGVPFVYNLVWQYLYSLR
KDRAPLVFYWIPWFGSAASYGQQPYEFFESCRQKYGDVFSFMLLGKIMTVYLGPKGHE
FVFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKRYVP
KIREEILNYFVTDESFKLKEKTHGVANVMKTQPEITIFTASRSLFGDEMRRIFDRSFA
QLYSDLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPNRDL
IDSLLIHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDVIY
QEVVELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSIFRKVTNPLRIPET
NYIVPKGHYVLVSPGYAHTSERYFDNPEDFDPTRWDTAAAKANSVSFNSSDEVDYGFG
KVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTIDGYKVPDPDYSSM
VVLPTEPAEIIWEKRETCMF

>CYP51 Candida guilliermondii X97680

MTDQEIANLLIVILMGGQHTSTSAWFLLHLGEKPHLQDVIYQEV
VELLKEKGGDLNDLTYEDLQKLPSVNNTIKETLRMHMPLHSTFRKVTNPLRSPNKYMS
SHTVYMFKFL

>CYP51 S. pombe Z54096

MAFSLVSILLSIALAWYVGYIINQLTSRNSKRPPIVFHWIPFVG
SAVAYGMDPYVFFRECRAKYGDVFTFVCMGRKMTAFLGVQGNDFLFNGKLADLNAEEA
YSHLTTPVFGKDVVYDIPNHVFMEHKKFIKSGLGFSQFRSYVPLILNEMDAFLSTSPD
FGPGKEGVADLLKTMPVMTIYTASRTLQGAEVRKGFDAGFADLYHDLDQGFSPVNFVF
PWLPLPRNRRRDRAHKIMQKTYLKIIKDRRSSTENPGTDMIWTLMSCKYRDGRPLKEH
EIAGMMIALLMAGQHTSAATIVWVLALLGSKPEIIEMLWEEQKRVVGENLELKFDQYK
DMPLLNYVIQETLRLHPPIHSHMRKVKRDLPVPGSKIVIPANNYLLAAPGLTATEEEY
FTHATDFDPKRWNDRVNEDENAEQIDYGYGLVTKGAASPYLPFGAGRHRCIGEQFAYM
HLSTIISKFVHDYTWTLIGKVPNVDYSSMVALPLGPVKIAWKRRN

>CYP51 yeast M15663 U10555

MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIV
WQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTV
YLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTK
EAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMR
AKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNN
DIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERP
DVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMH
VPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNNDSASSYSVGEEVDYGFG
AISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTS
MVTLPTGPAKIIWEKRNPEQKI

>CYP51 Ustilago maydis Z48164

MVASSSSATASLLDQLFALTPLADSSAWIKTITVLVLLPLLAVV
LNVASQLLLATPKNHPPVVFHFVPVIGSAIYYGIDPYKFFFECREKYGDVFTFVLLGR
KITVALGPKGSNLVFNAKHQQVTAEDAYTHLTTPVFGKEVVYDVPNAVFMEQKKFVKV
GLSIENFRVYVPQIVDEVREYIKSDARFSALKTRKTITVDIFQAMSELIILTASRTLQ
GKEVRQGLDKSFAQLYHDLDSGFTPINFVIPNLPLPSNFKRDRAQKKMSQFYQDIVAK
RRAAGASTSADDASGENDMIAALIEQKYKNGRALSGVEIAHMMIALLMAGQHTSSATS
SWAFLRLASRPEIIEELYEEQLNVYSDGHGGLRELDYETQKTSVPLLDAVVKETLRLH
PPLHSIMRYVKSDLAVPPTLSSPTSTKSEPDAHYVIPKGHYIMAAPGVSQVDPQIWKS
SDQFDPHRWLDATTAAAMQDSGEDKQDFGFGMISTGANSPYLPFGAGRHRCIGEQFAY
LQIGVILATFVRIFKWHLDSKFPDPDYQSMVVLPSKNGCAIVLTPRAESLHLD

>CYP51 Penicillium italicum Z49750

MDLVPLVTGQILGIAYYTTGLFLVSIVLNVIKQLIFYNRKEPPV
VFHWIPFIGSTIAYGMDPYQFFFASRAKYGDIFTFILLGKKTTVYLGVEGNEFILNGK
LKDVNAEEVYGKLTTPVFGSDVVYDCPNSKLMEQKKFIKYGLSQEALESYVPLIADET
NAYIKSSPNFKGQSGTIDLAAAMAEITIFTAARTLQGEEVRSKLTSEFADLFHDLDLG
FSPINFMLPWAPLPHNASAIKHTTYARDLSGNYPSATGSWRRRQRRRQDKSKGTDMIS
NLMRCVYRDGTPIPDKEIAHMMITLLMAGQHSSSAISCWILLRLASQPEMAEKLHAEQ
IKNLGADLPPLQYKDMDKLPLLRNVIKETLRLHSSIHTLMRKVKNPMPVPGTDFVVPP
SHTLLSSPGVTARDERHFRDPLRWDPHRWESRVEVEDSSDTVDYGYGAVSKGTRSPYL
PFGAGRHRCIGEKFAYLNLEVIVATLVREFRFFNPEGMEGVPDTDYSSLFSRPVQPAT
VRWEVRS

>CYP51 Candida tropicalis M23673

MAIVDTAIDGINYFLSLSLTQQITILVVFPFIYNIAWQLLYSLR
KDRVPMVFYWIPWFGSAASYGMQPYEFFEKCRLKYGDVFSFMLLGKVMTVYLGPKGHE
FIYNAKLSDVSAEEAYTHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKTYVP
KIREEVLNYFVNDVSFKTKERDHGVASVMKTQPEITIFTASRCLFGDEMRKSFDRSFA
QLYADLDKGFTPINFVFPNLPLPHYWRRDAAQRKISAHYMKEIKRRRESGDIDPKRDL
IDSLLVNSTYKDGVKMTDQEIANLLIGVLMGGQHTSASTSAWFLLHLAEQPQLQDDLY
EELTNLLKEKGGDLNDLTYEDLQKLPLVNNTIKETLRMHMPLHSIFRKVMNPLRVPNT
KYVIPKGHYVLVSAGYAHTSDRWFEHPEHFNPRRWESDDTKASAVSFNSEDTVDYGFG
KISKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTYIYNFKWRLNGDKVPDVDYQSM
VTLPLEPAEIVWEKRDTCMV

>CYP52A1 Candida tropicalis M24894

MSSSPSIAQEFLATITPYVEYCQENYTKWYYFIPLVILSLNLIS
MLHTKYLERKFKAKPLAVYVQDYTFCLITPLVLIYYKSKGTVMQFACDLWDKNLIVSD
PKAKTIGLKILGIPLIETKDPENVKAILATQFNDFSLGTRHDFLYSLLGDGIFTLDGA
GWKHSRTMLRPQFAREQVSHVKLLEPHMQVLFKHIRKHHGQTFDIQELFFRLTVDSAT
EFLLGESAESLRDESVGLTPTTKDFDGRNEFADAFNYSQTNQAYRFLLQQMYWILNGS
EFRKSIAIVHKFADHYVQKALELTDEDLEKKEGYVFLFELAKQTRDPKVLRDQLLNIL
VAGRDTTAGLLSFLFFELSRNPEIFAKLREEIENKFGLGQDARVEEISFETLKSCEYL
KAVINETLRIYPSVPHNFRVATRNTTLPRGGGEGGLSPIAIKKGQVVMYTILATHRDK
DIYGEDAYVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEF
GNLKQDPNTEYPPKLQNTLTLSLFEGAEVQMYLIL

>CYP52A2 C. tropicalis X17560

ISLLNILVAGRDTTAGLLSFVFFELARTPRVANKLREEIEDKFG
LGQDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATRNTTLPRGGGKDGLS
PVLVRKGQTVMYSVYAAHRNKQIYGEDALEFRPERWFEPETKKLGWAFLPFNGGPRIC
LGQQFALTEASYVTVRLLQEFSHLTMDPNTEYSPKKMSHLTMSLFDGANIQMY

>CYP52A3 Candida maltosa P450cm1. X51931

MAIEQIIEEVLPYLTKWYTIIFGAAVTYFLSIALRNKFYEYKLK
CENPVYFQDAGLFGIPALIDIIKVRKAGQLADYTDTTFDKYPNLSSYMTVAGVLKIVF
TVDPENIKAVLATQFNDFALGARHAHFDPLLGDGIFTLDGEGWKHSRAMLRPQFAREQ
IAHVKALEPHVQILAKQIKLNKGKTFDLQELFFRFTVDTATEFLFGESVHSLYDEKLG
IPAPNDIPGRENFAEAFNTSQHYLATRTYSQIFYWLTNPKEFRDCNAKVHKLAQYFVN
TALNATEKEVEEKSKGGYVFLYELVKQTRDPKVLQDQLLNIMVAGRDTTAGLLSFAMF
ELARNPKIWNKLREEVEVNFGLGDEARVDEISFETLKKCEYLKAVLNETLRMYPSVPI
NFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSVYKTHRLKQFYGEDAYEFRPERWF
EPSTRKLGWAYLPFNGGPRICLGQQFALTEASYVIARLAQMFEHLESKDETYPPNKCI
HLTMNHNEGVFISAK

>CYP52A4 Candida maltosa ALK3-A X55281

MPVSFVHNVLEVVTPYVEYYQENLTKWYILIPTILLTLNFLSIL
HTKYLEYKFNAKPLTNFAQDYSFGVITPLMLMYFKWHGTVMEFACNVWNNKFLVLNGN
VRTVGLRIMGLNIIETTDPENVKAILATQFNDFSLGTRHDFLYSLLGDGIFTLDGAGW
KHSRAMLRPQFAREQVAHVKLLEPHVQVLFKHVRKSQGKTFDIQELFFRLTVDSSTEF
LFGGSVESLRDASIGMTPSTKNIAGREEFADAFNYSQTYNAYRFLLQQFYWILNGSKF
NKSIKTVHKFADFYVQKALSLTEADLEKQEGYVFLYELAKQTRDPKVLRDQLLNILVA
GRDTTAGLLSFLFFELSRNPTVFEKLKEEIHNRFGAKEDARVEEITFESLKLCEYLKA
CVNEALRVYPSVPHNFRVATRNTTLPRGGGKDGMSPIAIKKGQNVMYTILATHRDPNI
YGEDANVFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEFHT
LTQDADTRYPPRLQNSLTLSLCDGANIQMY

>CYP52? Yarrowia lipolytica gene for ALK1 AB010388

MSNALNLSLALGVFLLAYYGFSVIQYRIKTRKLEKKWKCGKPKD
ISRFPFSASFFIPFLVESKKNRLLEFVQWMFESQVYPGYTCKTTVFGVDMYHTVDPEN
LKAVLATQFKDFCLGERHAQFLPVLGNGIFTLDGQGWQHSRAMLRPQFARDQVSDVEM
IEEHIQYMTSRIPKDGSAFDAQELFFNLTLDTATEFLFGQSVGSQTVETNPTAVPTDM
PVHLRKSFQEDFNTAQEHLGQRARLQMFYWAWRPRELYSSGERVHAFVDHYVKKALEE
SEKHVDDGKYVFLRELAKETKDPIVLRDQALNILLAGRDTTASLLSWCLYLMARRPEV
YAKLREEVIENLGDGEDLSTITFESLKRCDYLRYVLNEVLRLYPSVPANMRYATRDTT
LPRGGGPDGMQPIVVRKGNLVSYHVFTTHRLKEFWGEDAEEFRPERWYEDGASQAKGW
EYLPFNGGPRICLGQQYALTEAGYALARIAQLYDTIENADDKPEPPVKFHALTMCHHT
GVLVKLYNSKTTKAQ

>CYP52? Yarrowia lipolytica gene for ALK2 AB010389

MIILYVLAVAVSFLIFKRVTYTMRSRELAKKWHCEEPHNLNEFP
LNLPLFFLIINASRRHELLDTLLGLFRSFAPTKTVKQVLLGSFTIIPTNDPENIKAVL
ATQFKDFCLGQRHGQLAPVLGDGIFTLDGQGWQHSRAMLRPQFARDQVSDVEMIERHV
QMMLLRIPNNKKFDIQELFFNLTLDTATEFLFGQTVGSQTVEMPNEDKSTVSDMPKDM
RKSFQEDFNVAQHHGGIRTRFQMFYWLWRPTELFSSSKRVHAFVDHYVEKALANSDEE
KSDDKYIFLRELAREVKDPRVLRDQALNILLAGRDTTAGVLSWIVYELARHPEVWKKL
RAEIHQDFGDGSDLSQITFEGLKRCEYLRFVINETLRLYPSVPLNVRYASRDTTLPRG
GGPDESKPILVRKGDTIVYNVFSMHRTEEFWGKDCDEFRPERWAEKGSRGWEYLPFNG
GPRICLGQQYALTETSYVITRICQLFTNIENADTAVEPPQKLHALTLCHLNGVFVKMT
RDEAAFAETEKLINA

>CYP52? Yarrowia lipolytica gene for ALK3 AB010390

MIIIETLIGAVVFVAVYVAFVKLDYYRRKAKFETSDMPVAYNGL
LGWKGLRHMLTVFNNDIGPVGWREVFATYGKTLKYYAFPSNTILTYDPDNIKAMLATQ
FKDFSLGLRKEALAPSLGYGIFTLDGSSWSHSRALLRPQFSREQISRLESVETHVQEM
MSCIDRNQGAYFDIQRLFFSLAMDTATDFLLGEAVGNLQEILHPEMPRTGTTFQVAFD
RAQRLGSLRIICQEAFWVVGSLFWRRDFNNTNQHIHDYVDRYVDKALLARKEKSEIYT
NPDKYIFLYELARETTNKITLRDQVLNILIAGRDTTASTLSWIFMELAKKPDIFHKLR
EAILNDFGTSCESISFESLKKCDYLRQVLNEGLRLHPVVPVNLRVAVRDTTLPRGGGP
QGDKPIFVAKGQKINYAIFWTHRDKEYWGEDAEEFRPERWETTSGGALGKGWEFLPFN
GGPRICLGQQFALTEMGYVITRLLQEYSDISIQPSDAAVKVRHSLTMCSAQGINISLT
RAKEE

>CYP52? Yarrowia lipolytica gene for ALK4 AB010391

MLTNLTIVLITLLVTYTVLTRTALRIQRARKAKQMGATLPPRVN
NGILGWYGLWLVIQNARSMKLPHTLGKRFANGPTWLTPVAGNEPINTIDPENVKAILA
TQFKDFCLGIRHRALSPSIGDGIFTLDGEGWTHSRALLRPQFSRQQISRVHSLERLMQ
ILFKLIRKENGEYFDLQNLFFMFTLDSATEFLYGASVDTLADLLGEPVEGDHGGVGEE
VRKAYQQSINNAQDISAIRTRLQGLYWIAGNIYQRNLYQKSNKGVKDFSQFFVDKALN
TSKEKLKEMEDSDNYVFLYELVKSTRNPVVIRDQLINILVAGRDTTASLLSFTFYTLG
RRPDVLKKLRAAILEDFGTSPDEITFESLKRCDYLRYVLNEVLRLYPSVPINARSATR
DTTLPRGGGPDGKQPVFVYKGQMVAYCVYWMHRDKKYWGEDALEFNPDRWDPKVQPQN
KGWEYLPFNGGPRICLGQQFALTEAGYVVTRMLQEFDTVHCKNQKEEEHPPYALDLTM
RHGEGVWVSMK

>CYP52? Yarrowia lipolytica gene for ALK5 AB010392

MLQLFGVLVLALTTALLAQLAYNKYEYNRKVKQFGCGELTVAKN
GFLGWKGIRAVLHVLKTKKGPAALKERIDAYGRTYVFHIGPAPVISTMEPENIKAMLA
TQFKDFSLGTRYRSLAPTLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSLEAHFQ
ILKMCVDKEMREKGNDPRGFDIQNLFFLFTLDSATEFLFGSSVDSLVDFLDDPSVRTG
DHGGVDEAARKGFNNSFNHAQELCALRSRLHTLYWIVGSVVKKEPFERYNKEIKTFVD
FFAAKALKARKEKDMSLMDNDQYIFMYELVKETTNPVTLRDQMLNILLAGRDTTASML
SWIYFRLARDPKLYAKLRSAILEDFGTTPEAITFESLKQCDYLRYVLNEALRLYPVVP
INGRTATRDTTLPRGGGPDQSQPIFIPKGQTVSYSVYWTHRDPRFWGEDAEEFIPERW
DPRNGNIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSRLVQTYETLETCDHKPLPPL
YNHALTMCHEEGVWVKMYKGEKA

>CYP52? Yarrowia lipolytica gene for ALK6 AB010393

MIQSVFLALAILIAYLGFAEWFSRFQHRRISKKKGCGMPPMANG
GFLGWYGLYKTYQITSERTYPHSMRMGLEAFGHTFVYPVPGTDMLQTIHPDNIKAILA
TQFKDFSLGTRHKIMLPTLGDGIFTLDGEGWTHSRALLRPQFARDQVSHVASLERHIQ
VLFKTIKKENKECDPAKGFDIQELFFMLTLDTATEFLCGDSVDSLTDYLADPTAPQLD
HSGIDENVRRAFPEAFNTAQWFCSIRAKLMKLYFFAGTVFYRKKYADANKIVHDFTDF
YVSKALAARKEKFQELDQEGKYIFLYELAKETRNPKVLRDQMLNILLAGRDTTASLLS
WVMFRMARQPETWKKLRQAVINDFGDTPDELSFESLKRCEYLRYVLNEGLRLYPSVPM
NFRVATRDTTLPKGGGPDLDQPIFIPKGGIVVYSVYHTHRAEEYWGKDTEEFIPERWD
PAEGYQIARGWEYLPFNGGPRICLGQQFALTEAGYVLARLAQEFETVTSCDDKPLPPK
YNTHLTMSHDDGVWLKME

>CYP52? Yarrowia lipolytica gene for ALK7 AB010394

MFQLFSILVLAFTTALVAQLAYNQYDYQRKVKKFGCGQLRVAEN
GLFGWKGLREVLRINKYKLGPAALKDRFEKYGKTHVFHVGPSPLITTMDPENIKAMLA
TQFKDFCLIARYKALGPMLGDGIFTLDGHGWTHSRALLRPQFAREQVSRLDSIEHHFQ
ILKKCISKEMSDKRDTQRGFDIQNLFFLMTLDTATEFLFGSSVDSLVDFLDDPSIQTG
DHGGIDEAARKGFSNAFNRAQELSSLRTRLHKLYWVIGTLAVREPYHRYNREVKTFVD
HYAAKAIKARNEKNTDLLDNDKYIFMYELVKETSNPITLRDQMLNILLAGRDTTASML
SWIYFRLARDPKRYAKLRAAVLADFGPGPENITFESLKKCDYLRYVLNESLRVYPVVP
INARTASRDTTLPRGGGPDGSQPIFVPKGQTVSYSVWWTHRDPEFWGQDAEEFIPERW
DTKNGSIGRGWEYLPFNGGPRICLGQQFALTEVGYVLSRMVQTYETLESGDTKPLPPL
YNHALTLCHQEGVWIKTE

>CYP52? Yarrowia lipolytica gene for ALK8 AB010395

MIPFTKINLELLLLPLLIIPITLFLLVLNVQVNTVHRRYKEYRL
KLARCPQQSTGLFGWWLIYAVVRCNRDRFYSAKVVDYFTKLRTFIVSLGGELVIYTSE
SENIKALLATQFSDYDLGKTRHALLFTLMGDGIFTLDGQGWAHSRALLRPQFSKETVS
PLSSLETSLQQLMAIVKRRVALKGEVDIQELFFMLTMDTATNLLYGESVDSLGDCLKE
TKKETHVMTDGKRNLLQSRDHHSNVPNEWEPIYGTYEKKGLGIGSENSLQSGVSPRDS
PVFEVSVSEDIRKAYPAALTTALEFSAMRSKLQRFYWIWGDVLYRQKFHSAVNTVHAF
SNHFVNQALKLTPQELQMKSAEKYTFLYELAQRTRDPVAIRDQLINILIAGRDTTAAL
LSFVFLCLVANPEKLAKLREGIMTDFGTSTDSITFESLKRCVYLRYVINEALRLCPPV
PINMRQANKDTTLPTGGGKNHDEPIFVAKNQIVTYSVLFMHHNQNIWGPDASEFRPER
WGEPACPKGWEYLPFNGGPRICLGQQYALTEAAYVIVRLVQEFTEIEWRDRKGLPVLF
KTHITMSLGEGLRVHMK

>CYP52A5 Candida maltosa ALK2-A X55281

MTSDSTIHELIQSYITKWYVIVPLAIIIYKVFDYFYVLSLRKRL
GAAVPTNEETDGYFGFHLPFVLMSKKKDGTIIDFSIERYPELKHPETPTFEFPIFTVK
LISTIDPENIKAILATQFSDFSLGTRHAHFAPLIGDGIFTLDGAGWKHSRAMLRPQFA
REQVGHVKLLEPHVQVLFKHIRKNKGREFDLQELFFRFTVDSATEFLFGESVESLRDA
SIGMTSKSKDVDGIEDFTGAFNYSQNYLASRSIMQQFYWILNGKKFRECNAIVHKFAD
HYVQKALNLTEADLEKQAGYVFLYELVKQTRDPQVLRDQLLNILVAGRDTTAGLLSFV
FFELARNPDVVAKLKDEIDTKFGLGEDARIEEITFESLKQCEYLKAVLNECLRLYPSV
PQNFRVATKNTTLPRGGGKDGLSPILVRKGQTVMYSVYATHRMESVYGKDATTFRPER
WFEPETRKLGWAFVPFNGGPRICLGQQFALTEASYVTVRLLQEFSTLTLDPNLEYPPK
KMSHLTMSLFDGTNVQMY

>CYP52A6 C.tropicalis alk3 Z13010

MATQEIIDSALPYLTKWYTVITLAALVFLISSNIKNYVKAKKLK
CRDPPYFKGAGWTGISPLIEIIKVKGNGRLARFWPIKTFDDYPNHTFYMSIIGALKIV
LTVIQENIKAVLATQFTDFSLGTRHAHFYPLLGDGIFTLDGEGWKHSRAMLRPQFARD
QIGHVKALEPHIQILAKQIKLNKGKTFDIQELFFRFTVDTATEFLFGESVHSLYDEKL
GIPTPNEIPGRDNFATAFNTSQHYLATRTYSQTFYFLTNPKEFRDCNAKVHYLAKYFV
NKALNFTPEEIEEKSKSGYVFLYELVKQTRDPKVLQDQLLNIMVAGRDTTAGLLSFAM
FELARHPEIWSKLREEIEVNFGVGEESRVEEITFESLKRCEYLKAILNETLRMYPSVP
VNSRTATRDTTLPRGGGPNGTDPIFIPKGSTVAYIVYKTHRLEEYYGKDADDFRPERW
FEPSTKKLGWAYVPFNGGPRICLGQQFALTEASYVITRLVQMFETVSSPPDVEYPPPK
CIHLTMSHDDGVFVKM

>CYP52A7 C.tropicalis alk4 Z13011

MIEQVLHYWYYVLPAFIIFHWIVSAIHTNSLRRKLGAKPFTHTQ
LDGFYGFKFGRDFLKAKRIGRQVDLINSRFPDDIDTFSSYTFGNHVIFTRDPENIKAL
LATQFNDFSLGGRIKFFKPLLGYGIFTLDGEGWKHSRAMLRPQFAREQLPMSPSLEPH
FNVKAYPQEQRWVFDIQELFFRFTVDSATEFLFGESVNSLKSASIGCDEETELEERKK
FAEAFNKAQEYISTRVALQQLYWFVNNSEFKECNEIVHKFTNYYVQKALDATPEELEK
QSGYVFLYELVKQTRDPNVLRDHHSISLLAGRDTTAGLLSFAVFELARNPHIWAKLRE
DVESQFGLGEESRIEEITFESLKRCEYLKAVMNETLRLHPSVPRNARFALKDTTLPRG
GGPDGKDPILVRKMSCSIFISGTQIDPKHYGKDAKLFRPERWFESSTRNLGWAYLPFN
GGPRICLGQQFALTEAGYILVRLAQSFDTLELKPDTEYLTKISHLTMCLFGAFVKMD

>CYP52A8 C.tropicalis alk5 Z13012

MYEQVVEYWYVVLPLVFILHKVFDMWHTRRLMKQLGAAPVTNQL
HDNFFGIINGWKHLSSRKKVELKNIMIINLPIRKFQVWVHMLVPSLEQSSSSQKIRRN
IKALLATQFSDFSLGKRHTLFKPLLGDGIFTLDGQGWKHSRAMLRPQFAREQVAHVTS
LEPHFQLLKKHMVKNKGGFFDIQELFFRFTVDSATEFLFGESVHSLKDETIGSYQDDI
DFVGRKDFAESFNKAQEYLAIRTLVQDFYYLVNNQEFRDCNKLVHKFTNYYVQRALDA
TPEELEKQSGYVFLYELVKQTRGPNVLRDQSLNILLAGRDTSAGLLSFAVFELARNPH
IWAKLREDVESQFGLGEQSRIEEITFESLKRCGYLKAFLNETLRVYPSVPRNFRIATK
NTTLPRGGGSDGNSPVLVKKGEAVSYGINSTHLDPVYYGDDAAEFRPERWNEPSTRKL
GWAYLPFNGGPRICLGQQFALTEAGYVLVRLAQSFDTLELKPPVVYPPKRLTNLTMSL
QDGTIVKID

>CYP52A9 Candida maltosa D12717

MIDEILPKLVQYWYIVLPTLLIIKHVVSYINTQRLMRKFRAKPV
TNVLNDGFFGIPNGIKAIKEKNKGRAQEYNDEKFAAGPKPKVGTYLFKLFTKDVLVTK
DPENIKAILATQFEDFSLGKRLDFFKPLLGYGIFTLDGEGWKHSRAMLRPQFAREQVG
HVKLIEPHFQSLKKHIIKNKGQFFDIQELFFRFTVDSATEFLFGESVESLKDESIGYD
QQDFDFDGRKNFAEAFNKAQEYLGTRAILQLFYWLVNGADFKKSVAEVHKFTDYYVQK
ALDATPEELEKHSGYIFLYELVQQTRDPKVLRDQSLNILLAGRDTTAGLLSFALFELA
RNPEVWSRLREEIGDKFGLDEDATIEGISFESLKQCEYLKAVVNECLRMYPSVPRNFR
IATKHTTLPRGGGPDGKDPIFIKKGAVVSYGINSTHLDPMYYGPDARLFNPDRWSKPE
TKKLGWAFLPFNGGPRICLGQQFALTEASYVLVRMIQNFKELELTPNTVYPPRRLTNL
TMSLYDGAYIKVN

>CYP52A10 Candida maltosa D12719

MIFTAFILDYWYFTLLFLIAAYFIGKHVYTNYLMRKHHAEPILD
VVDDGAFGFKFGFQSLKAKKIGNQIDLLFLKFNEAKHPSIGTFVTRSFGMQFIATKDP
ENIKAMLATQFNEYTLGQRLNFLAPLLGKGIFTLDGNGWKHSRAMLRPQFSRDQIGHV
KMLEPHFQLLKKHIIKNKGTFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYDQE
EIDFAGRKDFAEAFNKSQVYLSTRTLLQLLYWLVNSADFKRCNKIVHKFSDYYIKKAL
TATPEELEKHSSYIFLYELAKQTRDPIVLRDQSLNILLAGRDTTAGLLSFAVFELGRN
PEVWSKLRQEIGHKFGLDSYSRVEDISFELLKLCEYLKAVLNETLRLYPSVPRNARFA
AKNTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPEVR
KLGWAFLPFNGGPRICLGQQFALTEASYVLARLIQSFETLELSPEAAYPPAKLSHLTM
CLFDGTPVRFE

>CYP52A11 Candida maltosa D12719

MVFTAFILEYWYFTLLSLAAGHFIGKHVYTNYLMRKHHAEPILD
VVDDGAFGFKFGFQALKAKKIGKQIDLLFKKFNEAKHPSIGTFVTRSFGMQFIATKDP
ENIKAMLATQFNDFTLGQRLSYFAPLLGKGIFTLDGEGWKHSRAMLRPQFSRDQVGHV
KMLEPHFQLLKKHIIKNKGSFFDIQELFFRFTVDSATEFLFGESVSSLKDESIGYDQE
EIDFAGRKDFAEAFNKSQVYLSTRSLLQLLYWLVNSSDFKRCNKIVHKFSDYYIKKAL
TATPEELEKHSSYIFLYELAKQTRDPIVLRDQSLNILLAGRDTTAGLLSFAVFELGRN
PEVWSKLREEIGDKFGLDPDSRIEDISFELLKLCEYLKAVINETLRLYPSVPRNGRFA
AANTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPEVR
KLGWAFLPFNGGPRICLGQQFALTEASYVLVRLIQSFETLELSPDAPYPPAKLTHLTM
CLFDGAPVRIE

>CYP52B1 C.tropicalis alk6 Z13013

MSLTETTATFIYNYWYIIFHLYFYTTSKIIKYHHTTYLMIKFKA
SPPLNYINKGFFGIQATFTELKHLICHTSIDYAIDQFNNVPFPHVHTFVTKVLGNELI
MTKDPENIKVLLRFPVFDKFDYGTRSSAVQPSLGMGIFTLEGENWKATRSVLRNMFDR
KSIDKVHDFEPHFKTLQKRIDGKVGYFDIQQEFLKLGLELSIEFIFGQVVSEDVPHYD
DFTQAWDRCQDYMMLRLLLGDFYWMANDWRYKQSNQIVQAFCDYLVQKSLENTCNDKF
VFVHQLAKHTTNKTFIRDQALSLIMASRDTTAELMAFTILELSRKSHHLGKLREEIDA
NFGLESPDLLTFDSLRKFKYVQAILNETLRMYPGVPRNMKTAKCTTTLPKGGGPDGQD
PILVKKGQSVGFISIATHLDPVLNFGSDAHVFRPDRWFDSSMKNLGCKYLPFNAGPRT
CLGQQYTLIEASYLLVRLAQTYETVESHPDSVYPPRKKALINMCAADGVDVKFHRL

>CYP52C1 C.tropicalis alk7 Z13014

MYQLFCFLAGIIVVYKAAQYYKRRTLVTKFHCKPARISPNKSWL
EYLGIASVVHADEMIRKGGLYSEIDGRFKSLDVSTFKSITLGKTTYVTKDIENIRHIL
SATEMNSWNLGARPIALRPFIGDGIFASEGQSWKHSRIMLRPVFAKEHVKQITSMEPY
VQLLIKIIKNHEGEPLEFQTLAHLFTIDYSTDFLLGESCDSLKDFLGEESNSTLDTSL
RLAFASQFNKTQQQMTIRFMLGKLAFLMYPKSFQYSIQMQKDFVDVYIDRVVGMSEEE
LNNHPKSYVLLYQLARQTKNRDILQDELMSILLAGRDTTASLLTFLFFELSHHPEVFN
KLKEEIERHFPDVESVTFGTIQRCDYLQWCINETMRLHPSVPFNFRTAANDTVIPRGG
GKSCTDPILVHKGEQVLFSFYSVNREEKYFGTNTDKFAPERWSESLRRTEFIPFSAGP
RACLGQQLPRVEASYVTIRLLQTFHGLHNASKQYPPNRVVAATMRLTDGCNVCFI

>CYP52C2 Candida maltosa D12718

MIDALYILIVALVIYKTAQFVHRKSLEKKHHCQPVKQIPLVSIL
SGLGFDMFFKDTAEMTKNGGLHKKLQQMLESLQTTTFRSRMLTGSQIVTMEPENERTM
CSSAHMKDWTIGYRPFALKPLLGDGIFSSEGESWKHSRIMLRPIFAKEHIKQITAMEP
YMLLLIEIIKSSSANEGPVDLQPLFHAFTIDYASDFLFGESCDVLKENLGGKSTSGMD
AQVKRDFASVFNDVQNYLTKRMMLGPLAFLVSSKDFHDGIKKQHEFVSYFVQKAISMS
DEELNDESKNYVFLYQLAKQTKDAKVLQDELLSILLAGRNTTASLLSFLFFELSHHEN
VWTTLKEVVDQSFPDVESITFETIQNCDYLRWCLFESLRVNPSVPFNSRTANKDTILP
RGGGEDCSHPILVKKGDQVLFPLYASNRQEKYFGRKPEEFIPERWRDLPKTGGPAFMP
FSTGPRMCLGQQFALIEASYVTIRLVQTFSKLKSHSLEYAPKRLVAATIRLIDGCFVS
FE

>CYP52D1 Candida maltosa D12716

MAIFTPELWLICFAVTVYIFDYIYTKYLMYKLGAKPITHVIDDG
FFGFRLPFLITLANNQGRLIEFSVKRFLSSPHQTFMNRAFGIPIILTRDPVNIKAMLA
VQFDEFSLGLRYNQFEPLLGNGIFTSDGEPWKHSRIMLRPQFIKSQVSHVNRLEPHFN
LLQKNITAQTDNYFDIQTLFFRFTLDTATEFLFGQSVHSLNDGENSLQFLEAFTKSQA
ILATRANLHELYFLADGIKFRQYNKMVQDFSQRCVDKVLNMSNSEIDKLDRYFFLYEM
VKITRNPQVLRDQCLNILLAGRDTTASLLSFAFFELALNEPIWIKLRTEVLHVFQTSL
ELITFDLLKTKCPYLQAILHETLRLYPSVPRNARFSKKNTTLPHGGGVDGMSPILIKK
GQPVAYFICATHVDEKFYTKDALIFRPERWCEEPLIKKNLAWSYLPFNGGPRICLGQQ
FALTEASYVLTRLAQCYTKISLQPNSFEYPPKKQVHLTMSLLDGVHVKISNLSIS

>CYP52E1 Candida apicola X76225

MIIGLSDAFALGGIALSFLVAYQFIYFYFIYSPRAKKLGCAPPV
IVFSFPLGLPALYKFATAMLHDNLLEYISIRIADMKVRTGFQTLAGQRWLVTLEPENI
KTVLATSFKDYSLGFRYDIMYGLLGNGIFTLSGDGWKHSRALLRPQFSREQVSHLESM
RTHINLMINNHFKGGQVVDAQALYHNLTIDTATEFLFGESTNTLDPDLAQQGLPGPKG
LVTGEQFAEAFTSALEILSVRVIVGAAWFLIWTPKFWRSCKVCHNFIDYFVYKALATP
MEKDQEADRYVFIRELTKETSDPRVIRDQALNILLAGRDTTAGLLSFITYYLGAYPEV
YAELREAVLSEFGSTDVETPTFEQLKQCKVLQNVIREVLRLHPNVPLNFRQAIVDTKL
PTGGGPNGDQPVFVPKGQNVFYSTYSMQRRTDIWGPDATTFRPDRWNEPREALASGWD
YIPFNGGPRICLGQQFALTEASYTIVRICQEFSRIEVLHPDVITSKNSMKQRMRLTQT
ASGGVITRFIR

>CYP52E2 Candida apicola X87640

MNINFSDALMLGGISLSFLLASQAIYFYFIYSPRAKKLGCAPPP
IFFSFPLGIPDLIRLVNAWFHDDLLEWFTHRFEEFGRRTAFQSVAGQLWIGTIEPENI
KTMLATSFKDYSLGFRYNAMYGLLGNGIFTLSGDGWKNSRALLRPQFSREQVSHLESM
RTHINMMINNHFKGGQVVDAQVLYHNLTIDTATEFLFGESTNTLDPALAQQGLPGPKG
LVTGEQFAEAFTSALELLSVRVMAGAAWFLVWTPKFWRSCKVCHNFIDYFVYKALATP
MEKGQDADRYVFIRELTKETSDPRVIRDQALNILLAGRDTTAALLSFTTYYLGAYPEV
YDELREAVIADFGSADAEPPTFEQLKQCKVLQNVIREVLRLHPNVPLNFREAIADTTF
PTGGGPNGDQPIFVPKGQKVFYATYVMQRNAGIWGPDSTSFRPDRWNEPREALASGWD
YIPFNGGPRICLGQQFALTEASYTLVRICQEFSRIEVLHPDVITARNVMKQRMRLPNS
SSGGVITRFIR

>CYP53 Aspergillus niger X52521

MLALLLSPYGAYLGLALLVLYYLLPYLKRAHLRDIPAPGLAAFT
NFWLLLQTRRGHRFVVVDNAHKKYGKLVRIAPRHTSIADDGAIQAVYGHGNGFLKSDF
YDAFVSIHRGLFNTRDRAEHTRKRKTVSHTFSMKSIGQFEQYIHGNIELFVKQWNRMA
DTQRNPKTGFASLDALNWFNYLAFDIIGDLAFGAPFGMLDKGKDFAEMRKTPDSPPSY
VQAVEVLNRRGEVSATLGCYPALKPFAKYLPDSFFRDGIQAVEDLAGIAVARVNERLR
PEVMANNTRVDLLARLMEGKDSNGEKLGRAELTAEALTQLIAGSDTTSNTSCAILYWC
MRTPGVIEKLHKALDEAIPQDVDVPTHAMVKDIPYLQWVIWETMRIHSTSAMGLPREI
PAGNPPVTISGHTFYPGDVVSVPSYTIHRSKEIWGPDAEQFVPERWDPARLTPRQKAA
FIPFSTGPRACVGRNVAEMELLVICGTVFRLFEFEMQQEGPMETREGFLRKPLGLQVG
MKRRQPGSA

CYP53B1 Rhodotorula minuta D63703

MGIVQEAAAFVGSLTAVQLAGAFAALVLAFHVVPYILDPHGLRK
YPAAGPFGIAAFTDAWVVWQARRGKRFEALDKAHRKYGKYVRISPRQVSIADPKALDT
IYGHGTGTMKPAFYDAFVGLKNVRGLFNTRDRAEHTRKRKIVSATFAQRNVLEFEPYI
ASVMRQLLNKWDAMCDKAVKDGKGWVTLDTLTWLNFLAFDIIGDLAFGAPFGMVEREA
DICEIEQEDGSIKHLPAVTILNERGEYSNCLGVMPPHWRPFSKYVDPWFSRGHASVIN
LAGMARARVNARLKSGAGDRKDLLARLQEARDESGNPMDIDELTAEALTQLIAGSDTT
SNSSCAIIFYLARNQDAQKKLQAELDKTFKDRGISGVMEYEDIKTLPYLEACINEALR
MHSTSSMGLPRVMPAQGADFQGEHFKEGTEVSVPAYTIHHLESIWGDPFNYRPERWLG
SDAKQLEKSFIPFSIGPRSCVGRNLATMELLVFMSTLFYRYDFKLADENQTKLETSEG
FLRKPLESWIKMRRRSIDA

>CYP54 Neurospora crassa (Genbank translation incorrect) X15033

MVSLCLSPLLPSSICYLHLTYYTNALEVKSKELPGYGTTAIMAL
TQLAHSASALLPLVLPSIAAILAFAIFQRYFAPNPLSNLPIVGEEYHGYEKKRQGYLT
KAKDLYLEGYTKFKHGLFRIVTPNRNSVIVVSPRFLDELKKLPDDVVSFDAANDDSMH
TKYTLIPTHEPILPHTIKTSLTPSLPRLNPQLSEEVQIAFSQEIAPLMSSSPSDWAPI
NINSKLLRIVAKVSGRVFIGPELCHDERYLEAAVGYTVSVMEAQRAVERMNPWVRPIA
AWAVRRFGSWRRWSGMPRLS

>CYP54 Neurospora crassa (more accurate translation) X15033

MALTQLAHSASALLPLVLPSIAAILAFAIFQRYFAPNPLSNLPIVGEEYHGYEKKRQAYLTKAKDLYLEGYTKFKHGLFRIVTPNRNSVIVVSPRFLDELKKLPDDVVSFDAANDDSMHTKYTLIPTHEPILPHTIKTSLTPSLPRLNPQLSEEVQAFSQEIAPLMSSSPSDWAPININSKLLRIVAKVSGRVFIGPELCHDERYLEAAVGYTVSVMEAQRAVERMNPWVRPIAAWRLKEVRKLAQMERDATAFLRPVVEARREKQRKGEEKDNDMLQWLMDSADQGQGKQHGKWGEDTTTTRKLARLQLAISFAAIHTTTLVTTHAVYSLAADPKLQATLREEIQSVLQEHKGVFNTSALQAMKKTDSFLKETMRFHPLGQTSFNRKVLRTFALSNGQVIPKGSTIEVPNYAVSRDPEAYPNPDVPDPLRFYNLRNEAREKGEAEQGASGQFVSVNKEFLTFGYGRHACPGRFFAANEIKMILANLVMTYEMGLVEGETERYRDWDIAAGTIPDPTKDVMFRKL*

>AI068604      897 bp    mRNA            EST       04-AUG-1998
Magnaporthe grisea Appressorium Stage cDNA Library similar to CYP54 (46% identical)
Choi,W., Fang,E., Sasinowski,M., Wing,R. and Dean,R.A.
Expressed sequence characterization during appressorium formation
in rice blast fungus, Magnaporthe grisea
Unpublished (1998)

TRRTDTTVSIPAEFLEELKRLPDDTISFGGAVNEVMAGKYTGIDGIEPTAPHLVKSHLTPALAKINPVLTEEVARTVREELGSLEDWTEVNIHSKLLRIVGIVSGASFXGPELCHNEK

Frame 3 whole EST

TRRTDTTVSIPAEFLEELKRLPDDTISFGGAVNEVMAGKYTGIDGIEPTA
PHLVKSHLTPALAKINPVLTEEVARTVREELGSLEDWTEVNIHSKLLRIV
GIVSGASFWAGAVPQRKDIESASTTRWSSTRPQAILAPGGTAFALVLPRS
KLPTRAQFSLISHRQAAQARVDPLQDATLLPAHDSDKHRRHRRCS*LGYL
RISTLTHTITLCTRETLQAFAAATTIALYKKVSRRPTRFL*GTSHANHGM
PS*PFSMGVVREWCM*RLS***SGKFGELYILIWCVSNCSVKGLWCRKX

frame 2

HEEDRHYRFNPRRVPGGAQEAAR*HHQLWRCRERGHGRQIHWNRWD*ANC
TALGQEPPHPGPRQNQPRPHRRSRPHRPRGARLARGLDRGQHPQQAAAHR
GHRVGGIFLGRSCATTKRHRVGIYYTMELNQAAGHFGSGWHGVRPGSAEI
KTANASAV*PHQPSSSRAGPRRPTTGRDTATCS*FRQTPQTSQMQLTGLL
AHLHTDSHYYTVHPRDTSSFRCRHDYCAVQKGL*KTYAFSLGYLSCKPRY
AVVTILNGCCA*MVYVAVVVIVIREVR*VVYSYMVCI*LFCERVVVS*X

frame 1

ARGGPTLPFQSPPSSWRSSRGCPMTPSALAVP*TRSWPANTLESMGLSQL
HRTWSRATSPRPSPKSTPSSPKKSPAPSARSSARSRTGPRSTSTASCCAS
WASCRGHLSGPELCHNEKTSSRHLLHDGAQPGRRPFWLRVARRSPWFCRD
QNCQRERSLASSAIVKPRRPASTHYRTRHCYLLMIQTNTADIADAADWAT
CASPH*LTLLHCAPERHFKLSLPPRLLRCTKRSLEDLRVFFRVPLMQTTV
CRRDHSQWVLCVNGVCSGCRDSDQGSSVSCIFLYGVYLTVL*KGCGVVK

>CYP55A1 F.oxysporum M63340

MASGAPSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWL
VTKHKDVCFVATSEKLSKVRTRQGFPELSASGKQAAKAKPTFVDMDPPEHMHQRSMVE
PTFTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIYTLLGVP
FNDLEYLTQQNAIRTNGSSTAREASAANQELLDYLAILVEQRLVEPKDDIISKLCTEQ
VKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVATLAQHPDQLAQLKANPSLAPQFV
EELCRYHTASALAIKRTAKEDVMIGDKLVRANEGIIASNQSANRDEEVFENPDEFNMN
RKWPPQDPLGFGFGDHRCIAEHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNR
DVGIVDLPVIF

>CYP55A2 Cylindrocarpon tonkinense D78511

MASEPPSFPFQRASGMEPPAEFARLRATDPVSKVKLFDGSLAWL
VTKYKDVTFVATDERLSKVRTRPGFPELNAGGKQAAKAKPTFVDMDAPDHMNQRGMVE
SLFTLEHVKKLQPYIQKTVDDLLAAMKKKGCANGPVDLVKEFALPVPSYIIYTILGVP
FNDLDHLTNQNAIRTNGSSTAREASAANQELLDYLASLVEKRLEEPKDDLISKLCTEQ
VKPGNIEKADAVQIAFLLLVAGNATMVNMIALGVVTLFQHPEQLAQLKANPSLAPQFV
EELCRYHTASALAIKRTAKVDLEIGGKHIKANEGIIASNQSANRDADIFENPDEFNMN
RKWPAEDPLGYGFGPHRCIAEHLAKAELTTVFATLFKEFPDLNIAVPFEKINFTPLGG
DVGVVDLPVTF

>CYP55A3 Cylindrocarpon tonkinense D78512

MHATEDETTTIPRFPFQRASAFEPPAEFARLRANEPISQVELFD
GSLAWLVVKHEDVCRVATDERLSKERTRLGFPELSAGGKAAAKNKPTFVDMDAPAHMN
QRSMVEPFFTEDHVENLRPYIKETVQGLLNDMVANGCEEPVDLIEKFALPVPSYIIYT
ILGVPFEDLEYLTEQNAIRSNGSGTAQEAAAANQQLLKYLAKLVDQRLQEPKDDLIGR
LVDQQLVPGHIEKSDAVQIAFLLLVAGNATMVNMIALGVVTLMQNPSQLEELKADPTL
VPGFVEELCRYHTGSSMAMKRVAKEDMELGGKLIRAGEGIIASNQSANRDEDVFPNPD
VFDMHRDFDSRDGLGFGFGPHRCIAELLAKAELEIVFETLFATLPDLRVSIPLDEIEC
TPRHKDVGIVRLPVKW

>CYP56 S. cerevisiae DIT2 X55713

MELLKLLCLILFLTLSYVAFAIIVPPLNFPKNIPTIPFYVVFLP
VIFPIDQTELYDLYIRESMEKYGAVKFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGN
QKKIPYSALAAYTGDNVISAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNR
LLEGQTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFL
TFPFLDVLPIPSRKKAFKDVVSFRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNE
IIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLA
DLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKT
WGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEIRISLA
EMLKQFRWSLDPEWEEKLTPAGPLCPLNLKLKFNENIME

>CYP57A1v1 Nectria haematococca L20976

MLVDTGLGLISELQAKLGWAVLLQIVPITIVAYNLLWFIYASFF
SSLRKIPGPFLARISRVWEMKKTATGNIHEIMMDLHRRHGAIVRIGPRRYDFDTMEAL
KIIYRIGNALPKADYYKPFGLPSFPNLFDEQNPARHSAIKKQVASLYTMTALLSYEEG
VDGQTAILKEQLQRFCDQKQVIDLPRFLQYYAFDVIGVITVGKSMGMMESNSDTNGAC
SALDGMWHYASMMAYIPNMHAWWLRLSSLLPIEVPIKGLTEYVERRIIQYRLKAAEFG
DDAALKGENNFLAKLLLMEKKGTVTPVETQQAVGLNIGAGSDTTANALSTILYYLYTN
PRTLHTLREELERYVKDGPISFQQSQSMPYLQAVIKEALRLHPGVGTQLTRVVPKGGL
VIEGQFFPEGTEVGVNGWALYHNKAIFGNDASIFRPERWLEANENINIGGSFAFGAGS
RSCIGKNISILEMSKAIPQIVRNFDIEINHGDMTWKNECWWFVKPEYKAMIKPRRCCL
SRDESLV

>CYP57A2 Nectria haematococca X73145

MLVDTGLGLISELRARLGWAALLQIVPVTVVAYNLLWFIYTSFF
SSLRKIPGPFLARISRVWEIKKAATGNIHEIVMDLHRCHGPIVRIGPNRYDFDTMEAL
KIIYRIGNALPKADYYIPFGLPSSPNLFDVQNPARHSAMKKQVASLYTMTALLSYEAG
VDGQTIILKEQLQRFCDQKQVIDLPQFLQYYAFDVIGVITVGKSMGMMETNSDTNGAC
GALDAMWHYSSMMAFIPHMHAWWLRLSSLLPIDVPIKGLTEYVEQRIIQYRLKAAEFG
DDDALKGENNFLAKLILMERQGTVTSTETQQAVGLNIGAGSDTTANALSSILYFLYTN
PRTLRRLREELDTHVKEDPIRFQQSQSMPYLQAVIKEALRLHPGVGTQLTRVVPKGGL
VIEGQFFPEGAEVGVNGWALYHNKAIFGNDASVFRPERWLETKGNLNIGGSFAFGAGS
RSCIGKNISILEMSKAIPQIVRNFDIEINHGDMTWKNECWWFVKPEYKAMIKPRAA

>CYP58A1 Fusarium sporotrichioides U22462, ALSO U10456 mini chromosome

MVDQDWIKALVNIPISHAVGVVAASTVIYFLSSCFYNLYLHPLR
KIPGPKLAAIGPYLEFYHEVIRDGQYLWEIAKMHDKYGPIVRVNDKEVHIRDPSYYST
IYTAGARKTNKDPATVGAFDVPTATAATVDHDHHRARRGYLNPYFSKRSITNLEPFIH
ERVTKLLSRFQEHLDNDQVLSLDGAFCALTADVITSRFYGKHYNYLDLPDFHFVVRDG
FLGLTKVYHLARFIPVLVTVLKRLPYSCLRLIAPSVSDLLQMRNEIHERGGDEFLSSK
TSEAKSSILFGALADTHIPPVERTVERMLDEGTVILFAGTETTSRTLAITFFYLLTHP
ECLRKLREELNSLPKVEGDRFPLATLENLPYLNGVVHEGFRLACGPISRSGRVATQEN
LKYKEHVIPAGTPVSQSTYFMHTDPKIFPEPEKFKPERWIEAAEKKIPLKKYITNFSQ
GSRQCIGYTMAFAEMYLAMSRIARAYDVELYDTTKADIDMTHARIVAYPKAIPGKTEH
VGEIRVKVLKAL

> CYP58A2 Myrothecium roridum AF009417 65% identical to 58A1

MAVLNFETVSNAIPLGAVAGGIAGLYFLYLAWNCFYNIYLHPLS
HIPGDKLAVMGPYLEFYHEVIRGGQYLWEVEKMHERYGPIVRVNAREVHVKDSSFYHT
IYTAGSRKTNKDPSAVGAFDVPSSTAATIDHDTHRARRGYLNPYFSKRSLASLEPTIN
ERIGKLAERMNGHMNGKEILTLDGIFSALTADIICSRFYGKNFDYLSVPDYHFVVRDG
FQGLTKLYHLARFLPTMVNGLKVLPEWFVRMFLPPLADLMVMRQEIHTNGAEMFTNSH
TADSKASALVGALADTNIPVHERTISRLLDEGTVFLFAGTETTSRTMAITMFYLLSNP
DCLRKMREELDTLPASEGFAHSLQTLEALPYLSGVVNEGLRLAFGPITRSARVPMNVD
LQYQDYTIPAGTPLSMSTYFVHTDEELYPDPMAFKPERWIKAAEDGVPLKKFLTNFSQ
GSRQCIGINMSFAEMYLTLSRVAREFDFELYDTTMADLDLTYARIVGYPKAIPGKTEG
TGEIRVKVLNRHSPNFEKQELISTA

>CYP59A1 stcS Aspergillus nidulans L27825

MPSFSLLTGHFGALKQTIDGMPPNATLHSIMLKLSQKFRSGMFY
INMWPFSGTWLVVATPSGAAQIQSLNLSKPNILRRPLETITGGPSLMSMHGETWKRWR
ALFNPGFNPNYLIGLAPLIADEVVVFCEQLRQKARTGTVFQLEPLTLRLTVDTICSVT
LYVVTPVGRWPFLTPDLEIHSSTTKLRTTPLPQRCNGRSNGPRLELPSTPLRRYLTVR
PLVMWYNNRLMNRFIDQEVDRAYREQSGRQSKSVISLALRDYMKEKDGSLEDFKRRVA
PQLRVFLFAGRDTTSSTLLYAFYLLSRHPEALAKVRLEHDQVFGPYHQQVHEKIHQDA
KLLNQLPYTTAVLKETLRLFPPSASMREGGPGVEITDDNGQVYPTAGCNVWTLTVALH
HNSAHWAEAESFIPERWLVGSDHPLYPAKGAWRAFEFGPRSCIGQTLAMLELRVALAM
TLREFDIAPAYDKWDHIYPNDAVKEFNGHRAYQAEKGGGGAHPADGMPCLVTFRV

>CYP60A1 Aspergillus parasiticus L40839

MHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLI
ERSIDLLITQLHENCGQGSGLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQ
GNVKLIPILNAFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDI
WDAVLAQKPDGEPPMTRDEMISNASAIVLAGSETSATLLSICTWLLLKNPSHLHQLTS
RIRSQFTHASEIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPQAGAYIAGGWVP
GGTSVGLQQFVACRSSSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQ
LAYVEMRLILVKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKNRCGLRWNLAMSSSS
NYSL

>CYP60A2 stcF Aspergillus nidulans U34740

MILPLILVLYLLSTAAYRLWLHPVRNYPGPCWWAVWRVPYLKGT
IRGTIVRDIQRLHNQYGPVVRIAPDELSYITPEAAKPIYTSSPEFPKDPMLLPPFHNG
APGILAADYAHHRRYRRLLASAFSEKGLRAQQGMIQSHIDRLMTRLQGNCSSGSLDMT
VWFNWATFDIIGDLAFGEPFGCLERMETNPWIASIQGNVKSIPILNALRRYRLDRLIE
FLAPPRLLEMRRRNAQFTAEKVDRRLKHATTTRGDLWDSVLADPPDGEPPMSRAEMVS
NASAIVLAGSETSATTLSGCLWLLLTNPEYLQQLTERIRARFSTATVIDAQTVTQIQG
LQAVLDESLRLYPAVPMQSNRIVPPPGARLAGSWVPGGTSVAVQQFAACRSPTNFHRP
DEFIPERWEKEGEFINDRREASQPFSIGPRNCIGRQLALAEMRLILVHLLWHFDIELD
RRRMENMDWMAVQGILDPVGQETAVGCVEEQKYVGTKVFAALVWMLVLPLYSLLLY

>CYP60A3 Aspergillus parasiticus avnA U62774

MGGDGWPSDGHILLLIVLTVLTPPSLALYRLWIHPLRSYPGPRW
WAIWRGPYILSNIRGNLVRDLQRLHQQFGPVVRIAPNELSFIVPEAASPIYTSNPEFP
KDPMHLPPFHNGTPGILAADHAHHRRYRRLLAFSFSDKGLRHERSLIERSIDLLITQL
HENCGQGPLDLALWFNWATFDIIGDLAFGDSFGCLENVQTHPWIASIQGNVKLIPILN
AFRRYRLDGLLRLLGSRKLLEQRRRNAQFTTDQVDRRLKNSSTPRGDIWDAVLAQKPD
GEPPMTRDEMISNASAIVLAGSETSATLLSGCTWLLLKNPSHLHQLTSRIRSQFTHAS
EIDSQSVSRVEGLQAVLEESLRLYPPVPMQSNRIVPQAGAYIAGGWVPGGTSVGLQQF
VACRSSSNFHRPDEFLPERWQGQGEFAHDRREVSQPFSIGPRNCIGRQLAYVEMRLIL
VKLLWHFDLRLDTTRMKDTDWLAEQGIWILWDKKPLWVTLEPRNE

>CYP60B1 stcL Aspergillus nidulans U34740

MVLQDGFPIPSYPNSARRVVYVLFQLVYNLYFHPLRDYPGPLLW
RASSLPWKLTLLRGTMHHDLMRHHQTYGDTVRIKPDEISYANGQAWRDIHAHVPGRPE
FLKDPVRLPLAPNGVMSILVSDTRNHARFRSLFGHAFSDKGLRAQEPTIARYADLLVE
VLREVADTGKSVEMVRYFNMAIFDSIGALSFGESFDSLRNRELHPWVDTIHKNLKSVA
ISHVLRSMGVEFLAPYLMPAELRGKRQENYTYAIEKLKKRMQKTGDQGDFWDRVIVKS
ADGNQSGDGMSYGEMINNAAVMVVAGSETTSSALCGCTYLLCKFDKMDKAVAEVRGAF
AAADQIDLVSVSRLPYLTAVIDETLRMYPSVPGQPPRVVPEGGAIVCGRFVPAETRVG
VSHLGAYYAPYNFSHADKFIPERHLAGAKLEEPFRHDNYAAYQPWSVGVRNCIGRNLA
YAEVRLTLAKLLWHFDISLDEERTGNFLDQKIWSIWAKRELYLEIRTREF

>Yeast CYP61A1 Z49211 Z71257

MSSVAENIIQHATHNSTLHQLAKDQPSVGVTTAFSILDTLKSMS
YLKIFATLICILLVWDQVAYQIKKGSIAGPKFKFWPIIGPFLESLDPKFEEYKAKWAS
GPLSCVSIFHKFVVIASTRDLARKILQSSKFVKPCVVDVAVKILRPCNWVFLDGKAHT
DYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHEMREILCAL
SLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFE
NCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSRIYHREFTNKEISEAVFTFL
FASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMV
IKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIP
ERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHHTVTPLSE
KIKVFATIFPKDDLLLTFKKRDPITGEVFE

>CYP61A2 C.albicans AL033396 comp(39932..41485) gene="Ca35A5.10c" 68.9% identical to 61A1

MNSTEVDNLPFQQQLTSFVELAVAKATGSPITTLFTIIFLILSY
DQLSYQINKGSIAGPRFKFYPIIGPFLESLDPKFEEYKAKWDSGELSCVSIFHKFVVI
ASSRDLARKILSSPKYVKPCVVDVAIKILRPTNWVFLDGKQHTDYRRSLNGLFSSKAL
EIYIPVQEKYMDIYLERFCKYDGPREFFPEFRELLCALSLRTFCGDYITEDQIALVAD
NYYRVTAALELVNFPIIIPYTKTWYGKKIADDTMKIFENCAAMAKKHINENNGTPKCV
MDEWIHLMKEAREKHSEDPDSKLLVREFSNREISEAIFTFLFASQDASSSLACWLFQI
VADRPDIVAKIREEQLRVRNNNPDVRLSLDLINEMTYTNNVVKESLRYRPPVLMVPYV
VKKSFPVTESYTAPKGAMIIPTLYPALHDPEVYDEPDSFIPERWENASGDMYKRNWLV
FGTGPHVCLGKNYVLMLFTGMLGKFVMNSDMIHHKTDLSEEIKVFATIFPKDDLILEW
KKRDPLKSL

>CYP61A3 S. pombe Z98974 join(10345..10419,10514..12001) gene="SPAC19A8.04" 51% identical to CYP61A1

MEPSDQIIRFNDKFTTISYLPWILIMQKGHIPGPRFKIPFMGSF
LDSMKPTFEKYNAKWQTGPLSCVSVFHKFVVIASERDLARKILNSPSYVQPCVVDAGK
KILKHTNWVFLDGRDHIEYRKGLNGLFTTRALASYLPAQEAVYNKYFKEFLAHSKDDY
AQYMIPFRDINVATSCRTFCGYYISDDAIKHIADEYWKITAAMELVNFPIVLPFTKVW
YGIQSRKVVMRYFMKAAAESRKNMEAGNAPACMMEEWIHEMIETRKYKSENKEGAEKP
SVLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQLRIRKG
DIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKKAFPITPDYTVPKDAMVIP
TLYGALHDSKVYPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIA
CIGKASIMLDWKHKRTPDSDTQMIFATTFPQDMCYLKFSPFDASTVDWKNSKEAFSNE
AVSAATVETESA

>CYP62 stcB Emericella nidulans U34740

MLSISSGPEATGADVSQAIRIAYFTPLKHIPGPWYASLTGLRLS
WSVFANNRIHYVHSLHQKYGPIVRIGPQEIDVADPVAGREIHRMGSGFMKAPFYELLS
PGPVDNIFNFRDPKLHAARRKLYARGFTLQSLRNEWEPKVRDIIKLTVEKIKCDAVKG
EAEIMGWWTLMANEIVCQLTFGGGAGIVAKGVKEPFVLMLERRMGDLAHLLKHFAPPG
YYLGQAGNLTDTDIITDAGALLLAGSDPTAISLTFLLWCVLSRPEVQKQVEAEVATLE
GELTDEACERLPILNAVIDESLRLYGAAPGCMPRSPPSGGVTIGGYFIPDDTIVATQN
WSLQRNPSIWDDADTFDHTRWLSNSRITDQAKLAFNPFGYGARQCLGIHLGRMEMRLA
AAMFFRECVGARLGRSVTDESMHVVDSFIAGVPRDRRCAITLT

>CYP63A1 Phanerochaete chrysosporium (white rot fungus) AF005475

GAGGETTAGTLTFVVYFLTQHPNVLQRLRQEILDVVGPSNLPTY
DDIKQMKYLRAVLNETLRLYPPVPWNMRYAVKDGILPNSEPDGKPWFIPAGASVSYSV
HCMHRRKDYWGPDAEEFDPDRFLDERLHKYLTPNPFIFLPFNAGPRICLGQQFAYNEM
SFFLVKLLQTFEDISFERDAFEPNALPPAEWAKFPGRKGKEKFWPRHI

>CYP64 Aspergillus flavus U81806

MIYSIIICAGALLGLWILEKLLAPKDTRPPLPPGPWRKPIIGNL
TDFPPKGTPEWLFWAKHQERYGPMSSLEVMGQTIIMINDAQLGIEIMHKKSALSQMIP
DAPFAHMAGWGMSLATERNRQAWKTIRANMKQEIGTRRAISTFHPKMEIGIRRFLLRT
LDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSV
NFFPILRYVPSWFPGASFQIKAAEYKRTIERMTMVPYLWIKDQVARGCSRPSILLRLL
QKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSFFVAMALYPEVQRKAREELDRV
VGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLL
PNIWTFTHDPSVYHDPMVFKPERFLEGKDSPPETDPMKFVFGFGRRICPGRFVTDEKL
FLIACHAVSCFFISPKDPGAPEPDWLPGVISQPGAFDLNVVPRSPAHEELIRSIETDH
PWKNADATDISRFMARNQMI

CYP64 Aspergillus parasiticus AF017151

MIYSIIICAGALLGFLILQKLLAPKDTRPPLPPGPWRKPIIGNL
TDFPPKGTPEWLFWAKHHERYGPMSSLEVMGQTIIMINDAHLGIEIMHKKSALSQMIP
DAPFAHMAGWGMSLATERNKQAWKTIRANMKQEIGTRRAIATFHPKMEIGIRRFLLRT
LDNPDDLRFHIRKEANAFMMDVAYGYTIAPHGKDELYDLTQQSVRQFSHIFSPGEWSV
NFFPILRYVPSWFPGASFQIKAAEYKRTIERMTMVPYLWIKDQVARGCTRPSILLRLL
QKGHYESGSHQEQVLVWTNAEFVMGGSDTTVSAVSSFFVAMALYPEVQHQAREELDRV
VGPTTLATFEHRSQLPFIDALVKEVFRWHPASPLGAPHITQEDQIWDGYLLPKGALLL
PNIWTFTHDPSVYHDPMVFKPERFLERQSSPPETDPMKFVFGFGRRICPGRFVTDEKL
FLIACHAISCFLISPKDPGAPEPDWLPGVISQPGPFDLNVVPRSPAHEELIRSIETDH
PWKNADATDISQFMARNQMI

>CYP65A1 Fusarium sporotrichioides AF011355

MFQYSLWPLLALSGGTGLAYLVVVVVYNLFFHPLRNFPGPWLNS
ITQVPHTLLMLCGLPHKKHLALHMKYGPVVRIGPNMLSFNHPDAMKDVRGHRKSGEPE
HGKDPISVQSNGDNIVGSDRENHTRFRRALAYGFSAQAMLEQEPTFKAYVNQLFQRLH
EQSSGGTKPVDISKWYTFTTFDMIGDLAFGESFSCLDNSTYHPWVSLAFESLKSLAFL
AEIGRYPRIAPYLGLLVPRGLLTKFAENKELASMKVRKRLDTETDRPDFVGKITQGLK
SKGTSMEFNELASNASVLIVAGSETTATLLSAAVYFLCAHPRTLDLLTKEVRSTYTQA
HDIDLVSTQGLRYMQAVLDEALRMYPPVAGGGSPRKIAKGGSFVAGHFVPENTLVEND
MWAMHYDPKYFTQPHDFIPERWLGDVRFANDRLDAVKPFSIGPRNCIGMNLAYAEMRM
MLARTVWEFDIRLSEGSRNWYEESRVYLAWNKPPLNVYLIPR

>CYP66 Z82021

WSYINSIVANSLWNSVKERMEAGTAKPCIATAMLEDLLDDDSAE
SKEEETVRRGACANGFLGGADTTVSLVTSFFMAMALYPDVQKKAQAELDQVLGGRLPE
FSDRPSLPYVNALLKESERWQPVFPLAIAHMSSNADEYDGYYIPKGTYVIGNAWSILH
DPEFYKDPLVFNPDRFLKDGEIDPSVRDPNVASFGFGRRICPGRFFPDASLYSTVTHV
LTVFDIKPNLDENGKEIGIKPDMTDGLLSIPM

>CYP67 Uromyces fabae U81739

FIVLISATAHFIFRRREPTAFQYACFQAGLALLLSVLLREPFGA
VVLILLALNFLLGVQIALYRLFWHDLRVFPGPRLAAITQGWILREAYLGRSRFSMKEV
GETYGDWVRIGPNELCTTSIEALSTIMGPKGWPKGPSYDSGITKGDSGGDSVLTIKNL
PEHATRRRIWNKAFTPNAINGYLPSIEIRLEEMLSVIDTEIKKGESVDLCLQLGCFVY
DTMCDMAFGALAGSAFSKTQEDKYRILTHMGRVVRQVGIVRNMPWLTPIVKAWPSSHR
REQNEFKEFTKSMFLRRKNQGLGKQLDVFHYLLGEDTETGTRLTEAELAADSTLLVIT
GADTTRTVLLAFFLYLLKHPNYMEQLQAELLAAPDLSPPSLSRLEYLNACLQETMRLQ
PPSPANLQRICPPGGAVICGRQIPEGTKVRFSNYAIHRDERYFSRAEEFRPQRWLQKA
KDDLGNQGEEKERLDQRAFFGFLIGPGACVAKNLAWMEMRLVVATILTNFDLSFAPGF
DPVAFESSWTDAYLLLIEEPFEVMFTPKSQRMR

>CYP68A1 Gibberella fujikuroi P450I gene Y15277

MANHSSSYYHEFYKDHSHTVLTLMSEKPVILPSLILGTCAVLLC
IQWLKPQPLIMVNGRKFGELSNVRAKRDFTFGARQLLEKGLKMSPDKPFRIMGDVGEL
HILPPKYAYEVRNNEKLSFTMAAFKWFYAHLPGFEGFREGTNESHIMKLVARHQLTHQ
LTLVTGAVSEECALVLKDVYTDSPEWHDITAKDANMKLMARITSRVFLGKEMCRNPQW
LRITSTYAVIAFRAVEELRLWPSWLRPVVQWFMPHCTQSRALVQEARDLINPLLERRR
EEKAEAERTGEKVTYNDAVEWLDDLAREKGVGYDPACAQLSLSVAALHSTTDFFTQVM
FDIAQNPELIEPLREEIIAVLGKQGWSKNSLYNLKLMDSVLKESQRLKPIAIASMRRF
TTHNVKLSDGVILPKNKLTLVSAHQHWDPEYYKDPLKFDGYRFFNMRREPGKESKAQL
VSATPDHMGFGYGLHACPGRFFASEEIKIALSHILLKYDFKPVEGSSMEPRKYGLNMN
ANPTAKLSVRRRKEEIAI

>CYP68B1 Gibberella fujikuroi P450II gene Y15278

MSIFNMITSYAGSQLLPFYIAIFVFTLVPWAIRFSWLELRKGSV
VPLANPPDSLFGTGKTRRSFVKLSREILAKARSLFPNEPFRLITDWGEVLILPPDFAD
EIRNDPRLSFSKAAMQDNHAGIPGFETVALVGREDQLIQKVARKQLTKHLSAVIEPLS
RESTLAVSLNFGETTEWRAIRLKPAILDIIARISSRIYLGDQLCRNEAWLKITKTYTT
NFYTASTNLRMFPRSIRPLAHWFLPECRKLRQERKDAIGIITPLIERRRELRRAAIAA
GQPLPVFHDAIDWSEQEAEAAGTGASFDPVIFQLTLSLLAIHTTYDLLQQTMIDLGRH
PEYIEPLRQEVVQLLREEGWKKTTLFKMKLLDSAIKESQRMKPGSIVTMRRYVTEDIT
LSSGLTLKKGTRLNVDNRRLDDPKIYDNPEVYNPYRFYDMRSEAGKDHGAQLVSTGSN
HMGFGHGQHSCPGRFFAANEIKVALCHILVKYDWKLCPDTETKPDTRGMIAKSSPVTD
ILIKRRESVELDLEAI

>AA965576 j4d06a1.r1 Aspergillus nidulans
>AA786034 j4d06a1.f1 Aspergillus nidulans 58% identical to 68B1

KGETINVVNTRIWDPAVYPNPLEWDPYRFVRRRDSGDHAAHLVSPTPDHMG
FGLGKHSCPGRFFAATKIKIILCHILLKYDVKIPDEEISTVISSGNFLFPDSTLRISVRR

>CYP69A1 Gibberella fujikuroi P450III gene Y15279

MKYTTCQMNIFPSLWSMKTSFRWPRTSKWSSVSLYDMMLRTVAL
LSGRAFVGLPLCRDEGWLQASIGYTVQCVSIRDQLFTWSPVLRPIIGPFLPSVRSVRR
HLRFAAEIMAPLISQALQDEKQHRADTLLADQTEGRGTFISWLLRHLPEELRTPEQVG
LDQMLVSFAAIHTTTMALTKVVWELVKRPEYIEPLRTEMQDVFGPDAVSPDICINKEA
LSRLHKLDSFIREVQRWCPSTFVTPSRRVMKSMTLSNGIKLQRGTSIAFPAHAIHMSE
ETPTFSPDFSSDFENPSPRIFDGFRYLNLRSIKGQGSQHQAATTGPDYLIFNHGKHAC
PGRFFAISEIKMILIELLAKYDFRLEDGKPGPELMRVGTETRLDTKAGLEMRRR

>CYP501 Candida albicans 

GEKVLLLQGQMTINQQYPVSCQYREALVLETLRHFTVSPLSLPRLTTKAIRYKDFVIPKETHLFMNAYSANHDCQIFVNPYKFDPDRWLDPVSNSIKSQLANFIINNNSKSSSGHGHQFKSLHSHQHFAFGAGSRMCSGYNLVIKQMYVMIIKMLLIFEIH

>CYP502 Coprinus cinereus AB013443

MTTTSSSIFAGLGCLLVASIIYFRKFKANPARAHLPPGPKPIPV
LGNVKDLRAKELWLPAMDWAKQYGDITYLHVFGQGLTFINSLESASDLLEKRGGMYAD
KPQFTMVCELCNCKNMVAFTPYGEQSKRQRRLMHKAFAPARIPDYHPLMESSTNLFLR
NVIASPADYIGHVRRYSGSLTLNIVYGYEVTSNEDEYLMMAEECVGILANEIASAGGV
WAVDVMPFLAKIPKWAEGLPGMSFKRKARKWKKMMEDWVDGPFEYVKNTMKSGTYKQS
FCSSLLDDESISQTQEHFEFDLKWTANSMYAASIDTTITSVAHFLLAMMKHPEVLKKA
QHEIDTVVGQDRLPTFSDRKSLPYVEAVLSETWRWASPVPLSLPHKLTEDDVYRGMYI
PKGSLIFANIWAMTRDERIFPDPETFNPERYLNMDPETKKKQDPRNFIFGFGRRLCPG
NHIVDASLWLLVVRMMATLDISTPVDEKGNAIDIVPVFDNPIFRTPNPFPCDMRPRSE
KAVNLIRQYADPRASA

>CYP503 Gibberella fujikuroi Y17243

MSKSNSMNSTSHETLFQQLVLGLDRMPLMDVHWLIYVAFGAWLC
SYVIHVLSSSSTVKVPVVGYRSVFEPTWLLRLRFVWEGGSIIGQGYNKFKDSIFQVRK
LGTDIVIIPPNYIDEVRKLSQDKTRSVEPFINDFAGQYTRGMVFLQSDLQNRVIQQRL
TPKLVSLTKVMKEELDYALTKEMPDMKNDEWVEVDISSIMVRLISRISARVFLGPEHC
RNQEWLTTTAEYSESLFITGFILRVVPHILRPFIAPLLPSYRTLLRNVSSGRRVIGDI
IRSQQGDGNEDILSWMRDAATGEEKQIDNIAQRMLILSLASIHTTAMTMTHAMYDLCA
CPEYIEPLRDEVKSVVGASGWDKTALNRFHKLDSFLKESQRFNPVFLLTFNRIYHQSM
TLSDGTNIPSGTRIAVPSHAMLQDSAHVPGPTPPTEFDGFRYSKIRSDSNYAQKYLFS
MTDSSNMAFGYGKYACPGRFYASNEMKLTLAILLLQFEFKLPDGKGRPRNITIDSDMI
PDPRARLCVRKRSLRDE

>CYP504 confidential

>CYP505 confidential

>CYP506 Fusarium oxysporum fragment

MAPMLRPLVYRFIPERARIKDQWTKGRKRVMASMRERQEKGGNL
EDPPTMLDHLSNGRNEHIADDVELQLLHQMTLIAVGTVTTFSSTTQAIYDLVAHPEYI
TILREEVESVPRDPNGNFTKDSTVAMDKLDSFLKESQRFNSPDLSMSNLKNYKLCESL
TGHSNLPTRTIADMKLPDGTFVPKGTKLEINTCSIHKDHKLYENPEQFDGLRFHKWRK
APGKEKRYMYSSSGTDDLSWGFGRHACPGRYLSAINIKLIMAELLMNYDIKLPDGLSR
PKNIEFEVLASLNACANA

>CYP507 Neurospora crassa genome project

SIITDQEARKLPYLQAVLYEAIRMM
PPLMNGFPRQVPAGGDTICGRFVPGGTDIFVNYVGMLRDKSVFGEDANVF
RPERYLEGDEERRNRMWKTTDLAFSHGRWRCLGQRLAWVQLQKVVVEFMR
NFEMQIVDPMHPCRLRCYCTPEMDDLMVKVTEAKWD*

>U89769 Penicillium griseofulvum downstream of pks2

EKGYAVPDKQGLRDELLTVISAGDDTTGIANTVTLFNIFNDREIHDRLL
AELKTVMPTSNSHVSYIQLEALPYLTA(intron)
VIKEGLRYSSPAASRTPRLVPPGGVRLPDGRFIPAGTRVGMAIYHIHYNE
TLFENPRVFDPERWLQGSEVTAERAKFLVPFSRGSRSCLGIN (intron)
MAYMEMYMAIAYIVRRFDLDLVGTTVEDMKWDDMVVPQFH
GEFLALTKRRED*

>AA787488 n3h07a1.r1 Aspergillus nidulans

WHELDLNFTIASLVSRVSAVMFVGEELGRDQKWLSIVTNYSSDMFVADLDLCKWPEALRP
IATYFLPSCGKLRRHIREAALMLYPILSEGYSAHQNKQNFLDWLEEIAG
DRKYNPVLAQLSLAAAAIDTTS 

>AA783169 c1g09a1.f1 Aspergillus nidulans
>AA965628 m2a02a1.f1 Aspergillus nidulans 

SYSLKNGELVIIPHGVIHNDPTHFSNPDQFDPLRFIRTDPQSG 
QKYAKSETMTPFGGGMPACKGRAFAEKKILALSAAIISLWQITPAEGKKFKIPEHRISSA 
AFLPKNDIRVR 

P450 sequences outside the plants/animals/fungi/slime molds clade 
(protist P450s)

>CYP51      Trypanosoma brucei (African sleeping sickness parasite)
           GenEMBL AZ217433 AQ948529 AQ950690 AL492728 AL481001 AZ217732 
           AQ948526 AQ647531 AL480043 AQ660405 AL495885 AZ212935 AL481816 
           Assembled from overlapping GSS fragments
           33% to mammalian CYP51s
MLLEVAIFLLTALALYSFYFVKSFNVTRPTDPPVYPVTVPILGHIIQFGKSPLGFMQECKRQL
KSGIFTINIVGKRVTIVGDPHEHSRFFLPRNEVLSPREVYSFMVPVFGEGVAYAAPYPRMREQ
LNFLAEELTIAKFQNFVPAIQHEVRKFMAANWDKDEGEINLLEDCSTMIINTACQCLFGEDLRKRLDARRFAQQ
LLAKMESSLIPAAVFLPMLLKLPLPQSARCHEARTELQKILSEIIIARKEEEVNKDSSTSDLLSGLLSAVYRDGTPMSLHEV
CGMIVAAMFAGQHTSSITTTWSMLHLMHPANVKHLEALRKEIEEFPAQLNYNNVM
DEMPFAERCARESIRRDPPLLMLMRKVMADVKVGSYV
VPKGDIIACSPLLSHHDEEAFPEPRRWDPERDEKVEGAFIGFGAGVHKCIGQKFGLLQVK
TILATAFRSYDFQLLRDEVPDPDYHTMVVGPTASQCRVKYIRRKAAAA*

>CYPxx N-term to I-helix about 41% identical to Chlamydomonas scaffold 306
Tb03.27F10.920 |||cytochrome P450, putative|Trypanosoma brucei|chr
MAVITNTSSLNGGFVSGSFMFLNDIFLYYSTSDLIWVGFMSMLMFIIMLWLSNVVVPAIR
MDRYLANIPRAPGGLPVLGHALELLEGSPSSKMASWSLRPWKAKRENTVAVTKAGTNRIV
AFTVFSQRVVYINEPALIKRVLLSNQRNYTKDIASSYKHFMCLLGNGLVTAEGHKWRKGR
LMLSHSLRIDILEDMPEMTMRAVGRIMEKLRTVGSGVPFLDLNEEFRHLTLQVIGETVLS
LSAEETDRIFPTLYLPIVHECNRRVWEPWRAFMFFSDGFRERRRCLKRLNAVICDIIQER
WRQRNEGSQKDVMSLCLSQVDALDNNMLLQLRDDVKTLLLAGHETSAALLTWATYEVICH
PEIRDKVVEEAKALFDP AHCDRTMETPEGVWGIPSASAVRSSLRWTPAVLRETLRKHSVV
PLVMRVAVNNDKWPASETGLDKDVVIPAGCSVAVGIEGVHQRPDIWEDPGSFNPERFLDV
AIPNDTNSPPTGEKYEKRIDPYAFIPFIN GPRNCLGQHLSMMETQVALAYLFLNWDLQLH
GAVSQSDTEINKELQQEVGRPHKFLIPIVPGNGLKVVGHPRPRY*

>tryp_XI-892a03.q1k chromosome 11 Trypanosoma brucei, a third P450
CHCPGSAASAGRFAWLRGFIDRQVRLRLAQADAHWPEDLLSRLLRLHRGDAQAWTLQAVR
DECMTAFLAGHETVASSLTWWSWCMATHPEAQQQVADEIHEQLQGRTPTAQDLPALRQLG
WSLQEAMRLYPAAPVLISRRCTRPVQLGPWRLPARTLFMIAPGLMQRDARWFPQPDAFQP
QRFADADKDGTPAAPRGSWMPF


>AI066238 TENU2354 T. cruzi epimastigote normalized cDNA Library Trypanosoma
           cruzi cDNA Length = 442
2   DVWPASITGLDGDVTIPAGCSVAVGIQAVHRRPDIWPDPDAFKPERFLDVKLENNFTTP 178
179 NHEAYKDTVDPYAFIPFINGQRNCIGQHLSLMETEVALAYLFLNWDLRFYGADAGATDVE 358
359 KRLFQEEVGRPHVFMFPIVPQNGLKVV 439

>CYP51      Leishmania major (Leishmaniasis parasite)
           GenEMBL AZ048391 LMAJFV1_lm78a01.x1 Leishmania major FV1 random genomic 
2   NKFFTPRNEILSPREVYSFMVPVFGEGVAYAAPYPRMREQLNFLAEELTVAKFQNFAPSI 181
182 QHEVRKFMKANWNKDEGEINILDDCSAMIINTACQCLFGEDLRKRLDARQFAQLLAKMES 361
362 CLIPAAVFLPWILKLPLPQSYRCRDARAELQDILSEIIIAREKEEAHKDSSTSDLLASLL 541
542 GAVYR*WTRMSQHEVCGMIVDAMFAGLPTFTITTT 646

>AC125412 AC125412.2 Leishmania major chromosome 27 clone LB01811 strain
59% to the Trypanosoma brucei seq Tb03.27F10.920
      MAANVLQSYIVAALHSAATQLPSSVQPYAMMLTREDMVSTTLATAIATA
18369 VILYTVITVVLPVLRMDFYLSKLPTIKNSIPFLGHALLLAGPSPWSKMSNWSLYPEKNLP 18190
18189 QKKKSVDGPQTSRLVTYNVAGMRVIYINEPRLLRRVLLTHQRNYRKALAAAYKHFMCLLG 18010
18009 TGLVTSEDEQWKKGRLLLSHAMRIDILDSVPEMAMKAVDRILLKLDAVDAKNPSVDLNEE 17830
17829 YRHMTLQVISESALSLSAEESDRIFPALYLPIVHECNKRVWAPWRAYMPFLHGSRMRNRC 17650
17649 LSELNKVLRDIICRRWEQRNDSNYTAKPDILALCISQIDRIDEKMIVGLIDDVKTILLAG 17470
17469 HETSAALLTFATYEVLRHPEIRQKILEEATRLFDPARCTCTVQTRYGPRGVPALNDVRS 17293
17292 LVWTPAVLRETLRRHSVVPLVMRYAAKDDVWPAADTGLDADVRIPAGCTIAVGIEGVHNN 17113
17112 PDVWNKPEVFDPTRFIDAEIANDTNYLNQSTKDVKFAKKIDPYAFIPFINGPRNCLGQHL 16933
16932 SMIETQVALAYMVLSYDLTIYRDPSYKGDVAAYEDAVGRHHDFIIPQVPHDGLKVWGT 16759
16758 PNKLFM* 16738

>LM7_11c.1.Contig2  L. major Friedlin chromosome 7_11c unfinished whole
              chromosome shotgun data sequenced by the Wellcome Trust Sanger
              Institute, part 1, Contig number Contig2, length 576199 bp
122673 AQKDSNTSDLLASLLGAVYRDGTRMSQHEVCGMIVAAMFAGQHTSTITTTWSLLHLMD 122500
122499 PRNKRHLAKLHQEIDEFPAQLNYDNVMEEMPFAEQCARESIRRDPPLIMLMRKVLKP 122329
122328 VQVGKCVVPEGDIIACSPLLSHQDEEAFPNPREWNPER 122215

>LM34.1.Contig35  L. major Friedlin chromosome 34 unfinished whole chromosome
              shotgun data sequenced by the Wellcome Trust Sanger Institute, part
              1, Contig number Contig35, length 527005 bp
146355 FSMDDVLDHVVTFLFAGHDTVSHTLEFLFALLGTNTEVQERLYEALEDLMPSICTCPTVQ 146534
146535 ELMECDYLVAIVKEVLRMYPAAPIIYRDAAEDVYLPGSAVVIPKGMTVVITLSALQRN 146708
146709 THVYGDDVDVFRPERWLGEEGEALRKRCGRCGYIPF 146816

>AA676046 Trypanosoma cruzi simlar to CYP61 and CYP51
EUGLENOZOA
best match to CYP710A 42% C-TERMINAL FRAGMENT
VPKGSLIIPSLVGACREGFPNPDVYDPDRMGSERQEDRKFAKQF 
IPFGVGPHRCVGYNYAINHLTVYLALVARLAEWRRTRTPNSDKVIYLPTLYPHDCLCTWRHREGLKAGK*

>gb|AI066238.1|AI066238 TENU2354 T. cruzi epimastigote normalized cDNA Library Trypanosoma
           cruzi cDNA clone 25j9 5' similar to (Z93099) cytochrome
           P450 [Sus scrofa] gnl|PID|e308612.
          Length = 442
most like 3A  31% C-TERMINAL FRAGMENT
DVWPASITGLDGDVTIPAGCSVAVGIQAVHRRPDIWPDPDAFKPERFLDVKLENNFTTPNHEAYKDTVDPYAF
IPFINGQRNCIGQHLSLMETEVALAYLFLNWDLRFYGADAGATDVEKRLFQEEVGRPHVFMFPIVPQNGLKVVG


Below is a collection from Phyophthora ramorum 

>scaffold 6 plus strand
MTPPPPHHHHGGHQTSFAFVHRPVTMLSPSAVLTHPLVVGLLTAAAVAALSSVATSYAADA
DSGDEDTKPVKPVPYLPGAHPVLGHTLLMAKNLDRFQDWLVETSVARNGEPFVLRQPGKN
DWLFSARPEDFEQILRVHFDTFIKGPQVRELLDDFMGENIVIINGHRWKFQRKALVNLFT
ARALRDHMTPIVQKCALALQRVFAQAATSGEAIDVHHVMGKFTLETFAEIEFGSQLGLLE
SGQEHAFETAIDDANHISLERFAVPMWVWKLKRWLNVGSERRLREDMAVISSFVMSCISG
AMERRKQRQEAAARGEPLGPVAKDIVSILLDSEDTIGEPVLPKDVFNISLAGVLAGKDTT
GDATSWLMHMLHENPRVENKLRTILLAEVPKLAVDESYVPSMEELDGVTYLEATIRESLR
LKPPAPCVTQHCTQDTVFPDGTFVSKGTDTTLLYHASALLPSVWGPDAAEFKPERFLDEN
DKLLVLPPLKFIAFSAGPRKCVGRKLAMIEMKVVTACLLSRFHLVQVPGQDIRGTMGISL
GMKYGMKVNVQRTPGVAIRA*

>scaffold 6 minus strand
MLRQWLVKHRVLSPLGPAGLVLLAGAAAVAAYISTRSSGVEVKEFDLKEEE
STDKPRVVPYLPSKVPLLGNMLELAGNAHRFHSWMAEQCVIHNGVFKLYLPGQSDMLVTA
VPEHYEHVVKTQFEHFSKGKQQYDMFVDLMGHSVLIIEGERWKYHRRLLVRLFSARALRE
HMTPVIQRHTRMLQTVFLKAAVAKKPVDVYMLMHRFTFKAFAEMVFNNTLDSIDSEHEHP
FEQAFDEAQSIVAGRLQQPVWFWKLKRWLNVGLEHKLREDVALIDEFIMSIISTAIETRR
RRQEDLKAGRPVKPADKDIVSIVLECMEQDGDMVSPTDVRNIAVAALGAGRDTSADAMSW
LLHTLTQHPEVENKLRAELLEKLPKLAVSATYVPSMDEVHGLVYLEATIRELLRLQTPVP
FTLRECIHDTVFPDGTFVPKGTNVGMCHFGAARRTEVWGPDAAEFKPERFVDPVTGKLLH
TPMAKFNAFSGGQRVCVGKALAMLEMKLVIATLVGRFHFSEVPGQDVQYAMGITIGMRSS
LMMNVQPVIRGAAGAAA*

>scaffold 11 introns or pseudogene
305733 QHPSTNHNTFETAAGLSALYTWWRIASELYSQHIIDSTLKK*GPHIPPST 305882
305883 VPILDNTLDALVFQKEHFWDWLTEQSNLSGGKPWMLHLVGRPTTLL 306020
306020 ETLEDIFKSHFDTFERGDDL*ELIYPFFGDGIVGADGENWLKQRRAGRH 306166
306156 RDVMGAVVKEKTLQLHDVLVKFSKEGRTVDMTSLFGKFSSDTFTKIAFGV 306305
306306 DLNGLAGDVGAEAYHPFNAAVGVMAEMLGSRLLSPTWVWKLKHFLNIGDE 306455
306456 RKLKEACDIVHELTY*VMIESIQKKIGDADQ 306548
306562 LHDTVMNFLLAGKDTTTFSMTWILVNLNRHPEALAKLRVEIKENLPGLLTGE 306717

>scaffold 11 from JGI seq a
MWGIAQHQVNER
QAVIAVGALSGLYLGYKLLSAVYSDMKITRALDSQGLHRPKSTLPILGNTLDVMFFQKDR
LQDWMADQSQISDGKPWVLSIIGRPQTLIITSPEACEDVFKTQFDNFGRGDELVDLQHDI
FGEGVAGVDGEKWLKQRRIASHMFSMKMLRDVMDEVIIEKSKKLRDVLAACAKEGRIAPM
KSLLGKFSSDVFTKIGFGVDLHGLDGDINSEMDHPFIEAVDGYAEVFGARLQSPMWFWKL
KRFLNIGDERMLKRCIKVATDLLNDVMLKSMSNKTAEDWNSKTDLLTLFVDSTGNTDSSD
LRDAMMNFFLAGKETTSFSMAWIIVNLNRHPRVLAKLRAQIRENLPELLTGELEVPTMED
LQKIPYVEAVLKESLRLNMTGVHRTPMRSTTLSEGTFVPFGSYVVMSVYAAARVKNVWGE
DAAEFNPDRWIDEETGKVKFVNPFQFITFGGGPHQCLGMRFALLEMQTVIAVLFSRFDIK
TLEDPFKITYDYSVTLPVKGPLECAINEVAAPAF*

>scaffold 11 from JGI seq b
MLAGSFRQCRSHH
FGICNTLHTSQSMWGLAQHQGNQREAMLAVGTVSALYVSYKVLSAMYKSNSIGRAFDAQG
LHRPRSTLPLLGNTLDVMFYQKERLWDWMAEQSNLSDGKPWVLSIIGRPDALIVTSPEAC
EDVFKTQFDNFGRGADLRDVIYDIFGDGIAGVDGEEWQKQRRVASHLFSMKMLRDVMDEV
IIEKVTKLREVLAGCAKEGKVVPMKSLFGKFTSEVFTKIGFGVDLHSLESDPCCDSNNAF
IKAVDVYAEVFGARVQSPAWFWKLKRFFSIGDEGRLKESAKVAEGLTQEVLAKSLEARRR
DSSEVKRTDLLTLFVETNTNIDPKAVHDTLMSFLLASKDTTSFSLSWVLINLNRYPAVLA
KLRDEIREKLPGLMTGEIKVPTMEDLQKLPYLEAVVKESLRLYMAVTNRMAKTSTTLSDG
TFVPEGCAVMVPIYASARVKNVWGDDAEEYKPERWIDLSTGKVKPVSPFKFFTFAAGPRQ
CLGMRFALLQIQTTVAVLFSHFDLKTQENPFDLTYDFAITLPVKGPLNITVRDIVPAAF*

>scaffold 20 seq a
MLPIAELVENSSVTIGGLA
LLALALSFWHKMRVDEKSKVHRPDSTLPFLENTLDLIIHGGGKGDLHDFTTQMAKQFDAE
PVFLRALGIPLNIMLFTPEAFEDVLKTQFHNFEKGPFVCENLKDLLGEGIFAVDGDQWVH
QRKTASNLFTMRALRDSMTVVIQRHAVVLYDILQRASDNKETLDLFRLFNRFTIEAFAEI
GFGVHMGCLDSDEEHPFQKAFDRAQRALLLRFTRPGWFWKTQRWLGVGVEGQLRRDIQVI
DKTVLDIVEKALAQRAQRVTHGDGGYDNGDNKVKKVGNIVSLFMDNLANSQQFDPKYLRD
IVVNFLVAGRDTTAQALSWFFVDLSKNPHVEVAIRKEMAEKLQPAEVNRPGAVSSTMEDV
SHRVYLEAALKEALRLHPSVPVVPKQAVQDTMLSDGTFVPAGSAIGLANYAMARMPQVWG
PDAEEFKPERWIDPTTGKLIPVSAYKFASFNAGPRMCLGMNLAMLEMKLVVAGLLSKFHV
EVLNPEDVTYDLSLTLPVKGALNVKVSSIGRSASPAYA*

>scaffold 20 seq b plus strand (has one intron)
MQAQCCCFCLVKRSAMLKWISLFDHSGVAPVHPLLIADRFDVDLVSIDLVRIQVARW
DSSLQNPVDLVVA (?)
SLIASTSTSLASTSSESKWRAG
TQVSKILSISSLREKVIVGVLLVSAVVFLVKSRSEPSGSGSIDPQRKVH RPDSTLPLLEN
TLDILQAARDGDIHDRTVRACRGFKGEPVLIRSIGLPDKLVVSTPEAFEDVLKTQFNNFP
KGSYMCENLRDLLGDGIFVADGDQWVHQRKTASNLFTMRALRDSMTVVIQRHAVVLYDIL
QRASDNKETLDLFRLFNRFTIEAFAEIGFGVHMGCLDSDEEHPFQKAFDRAQRALLLRFV
RPGWFWKTQQWLSVGAEGRLKQDIEVINATVLEIVEKALAKRSTVSNDEIGDEDKNIVTL
FLDSVGGFASADSQQPDPMHLRDIVVNFLIAGRDTTAQTLSWFFLNLTKNSDVEAAIRDE
IAEKLPKGGRNATTSATATMQDVSQLVYLEAALKETLRLHPPVPMAPKYVVEDTTLSDGT
FVKGKSMIVLATYVMARMQEVWGPDAEVFKPERWIDAATGKLVNVSAYKFASFNAGPRLC
LGVNLAMLEMKLVVAGLLSKFHVEVLNPEDVTYELSLTLPVKGPLNVKVSPAKLPTSPDFA*

>scaffold 20 seq c plus strand
MLSIASLKLEHPLYHALTVTSIVLLPIVFQL
SRGSSSSSTDDEERADSELERRDAD RPPWTLPVLHNTLNWILGGDGIHEWITRNCERFKG
RPFTVKALGLPEMLVVSTPEAFEDVLKNQFMNFPKGPHVKENLQDLLGDGIFAADGVKWA
HQRDVARGLFRMRELRDCMTEAITRHTKALHDVLGKVCARNRSVDLHKLLSCFSTEAFAE
ISFGMKMGCLRANKELPFQAAFDSAQRLTAQRFVRPRWFWKMQRRLGLGAEDQLQLDIKE
IDAAVLNIVQRVLSQRALVPDDGAPKSTNMLSLFLDTIAKSPKAEEQLYDPAYLRDVVVN
FLVAGRDTTAQALSWFFYNVSQNPHVEAKLRREIYKKLPELVNSEVCVPTLQQVNRLVYL
EAVMKETLRLYPPVPMSPKYAVRDAMLSDGTFVAAGSMVCLPMYAMGRMPHVWGPDAAEF
NPERWIDPATKKIVSVSAFKFVAFNAGPRMCLGTTLAGLELKLVAASLLSRFHIHVENPE
DVTHEFSLTLPVKGPMNVRLARVQAAVA*

>scaffold 20 seq d minus strand
MSSVDPTSALL
YAASCSLALLVGAKVLFPEPKRAARHPDSLPLLGETWAALKYADEYYDWEAAMTEKMEGR
PWLFDVVGRPSEFVIGKPEIIEDVLRTHAESFGKGEYVHEVLSGLLGDGIIAVDGHKWAR
QRKTASNLFSLRELRESMATVVQDNVLTLNGIFQHAMDRGESLDLFQLLNRFTFEVIAEI
AFGIKFGGLATGSKHPLEAAFNCAQQRMFMRFLEPTWWWKLQRWLNVGPEGAFKKQVQII
DETCYSIISRSMKERKAKRSSHDADTLEGSASTQRQKSNIISLFLDGVSDDEAKAGDGLD
PKFLRDIVVTFMTAGRDTTASALSWFFYTLSQHPQTEEKIRQEMASKLPELANGAVSSPS
MLQANELVYLEAALKETLRLYPAVPTNIREALEDVVLCDGTVVKAGETVSWSTYALGRMP
HVWGEDAKEFKPERWVDADGKLIAVSPFKYPLFSAGPRVCLGGKLALMEMKITAASVLSK
YHFTIVPGQNVTYRIGLTFGMKNGLHVKVSEAAPAI*

>scaffold 20 seq e minus strand
MTDKLSSSVAVAALSGLVTLPLAWYLLSTA
HGEKQLGTRKVVRPSTTKPLIGNTLDILYNLPIRHDWITSLCEEAKGEPVLLQSLGTPDM
TLLSTPGAFEDVFKNQFDNFPKGPKKSEYLRELLGEGIFAVDNEKWYRQRKTASNLFTMR
ALRDSMTSTIQRHLVVLERIFRRAAETNASIDMFRLLNRFTMEAFTEIGFGVEMNCLDSD
QEHPFQTAFDRSQQSLALRFVRPSWFWKTQRMLGLGPEGQLQQDMKVINSTICDIVAKTL
QNSARGAPKPDDKAAMDIVSLFLDDLNKSSDVDANCFDPTYLRDIVVNFIIAGRDTTAQA
LSWFFYCLSQNKQVETKIREELLAKLPDLFNGQCSPSMDAVGELTYVEAALRETLRLYPS
VPIVSKQAVQDAVLSDGTFIAAGAMAGLPMYALGRMPHVWGPDAADFKPERWVDAQTGKL
ISVSAYQFVAFNAGPRLCLGKNLAMLEMKLIVASLLSKYHVELETPKTVTYAISFTLPVK
GQLNAKISAV*

>scaffold 21 minus strand
PQNCIACSLTSITSWCSNGVAYPASNYLLRCTXXXXXXXXXXXXXXXXXXPSTN
SQKLFRPASTLPILGNTLDLLWFQKHRLHDWMTEQSLASGGKPWLLTGIGQLPRVVVTSP
AAYEEVFKTQFDVFVRGPGETVLEVLGEGIFNVDGDKWRRQRRVTSHLFSMHMLKDCMNA
VVREKTVKLRDVLAMCAERGDPVSMKSLLNKFTADAFTRIGFGVELNGLDDPADVDTSQP
LDAALQVVQIRLQSPVWLWKLRRFFDVGSERVMRESMQQVHDTIQHIMAKSLADKEEQAA
ASEEATRTSSHKDLMTLMLQTGDFKDTREIRDVAVNFYAAGKDTTAFSLSWFIVMMNRHS
HVLCKVRDELRCVAPELFTGELDTPTLEHLQQLTYLEAALKESLRLNSLAVYRLANRDTT
LSDGTFVPKGARVVFSMYGSARQPGVWGPDAAEYKPERWIDETTGKLKNISSFQFVTFSA
GPRQCIGMRLAMMEMMTVLAVVYSRFDLKTVEDAFDITYDFSLVLPVKGPLAVRVHSLAAHKA*

>scaffold 36 plus strand
MEPWSHGAKAVATVCRPADIRYRANLVADPPDLKALSRTFRPGHKSIRVV
MRTADVVACIQILWPTFPPWASVLVECLVISD
RNEGGGGGGINTISYPNSTSLGQVGFKLSRLISLTMLLPLQLMGDARAPVGLLACGLLVS
AVAVVRVRSHTQQKPHDTATRVPYLPTLVPLLGNTLELATNVGRFHEWVTGHSQQRDGKP
FALRLLGKNDLVFIARPEHFEEVLKTQSRNFCKSDTTREVFDDFLGEDIVLLNGKRWQFH
RKILASLITTRALREYMTPIIQENILRLQRTLKQWSETKGSVDFHKLVRHFTIDTFAEIG
FGCKLDVLASGEEHPFEVAFNDANRISSERITSPTWIWKLKRWLNIGDERRLREAIEEMN
ELMMKLIFTAFGLLQAGADDNQQSAHQNLISIIVSSEREITPTEVRDIALSGLEAGRNTT
ADTLSWLFHALSHNPRVETTLRAEIAAKLPKLEESDSYVPSFEEIQEVPYLEATIREVLR
LYPTVPTVPYHCVNDTVLADNTFIPAGTDVFLTLYAAGRLASVWGHNATEFSPERFIDEK
TGKLCQDSPYSAFSDGPRVCLGRNLAMLQLKIVAATIISRFHLSEDPEQDVQPILDLTIG
MKDPLMMRVETTQQEEAASFS*

>scaffold 1485 early
PFAIAASLVAAAVAYLTSPNDQDRAVCELPTPRSTLPVIKNTLDLAVRQRARIYDWILEQ
CREHGGRPWRVRVLGRPPAVIVSSPEAMEDILKTQFEVFVKGSAVATISKDLLGDGIFAV
DGSQWKHQRKAASHFFSMNMIRDAMEHVVRDHSVRLTKKLSEAAVSGEVVNIKRVLDFYT
MDVFTKIGFGVELRGLETGGNSDFMEAFERATRRIMARFQQPMCIWKLARWLSVGAERQM
ASDMKLINGVVYDVIHRNLEGKKQRKQSGGTFNSGREDLISLFLEKANVEYSDDDHVKMT
PTMLRDMSMVFLFAGRDSTSLTMTWYIIEMNRHPEALANVRRELTDKLPRLGLNDAETPS
MEDIDELVYLEAAIRECIRLNPVAPVLQRTAAQDTTLYDGTFVKAGTRVILPHYAMGRLE
TVWGPDAEQYKPERWIDPDTGKLVHASPYKFAAFLAGPRMCLGMRFALAEMKLTLATVLS
KFHIETVEDPFEFTYVPSVTLQVKGPVDVRVTRPSSM*

>scaffold 1485 later
MKLEAMTAWVSPASVAATCVAALLVYLATPSAHDRAVKHLPGPDGD
LPILRNTLEIIAAQKSGTFHDWALKYCRKYQGKPWRLRVVGKEPTVVLCCPEAFEDIQKT
QFEAFDKSRFVSAAMYDVLGQGIFAISGPLWQHQRKTASHLFTTQMLQYAMEVVVPEKGD
ELIKRLDGVCLKEKTADRVVSMKRLLDLYTMDIFAKVGFDVDLHGVQSNQNAELLDSFDR
MSVRILERIQQPMWYWKLLRWLHVGPEKQLAEDVKKLDDLVYGVMARSIEDKNRQDASQS
ARKDLISLFIDKSDVEYTKGVHTKKDLKLMRDFVISFLAAGRETTATAMSWVILMMNRYP
DVLKRVRQELNEKLPGLASGKLRAPSMEDAQKLVFLEAVVRETLRLFPVVAITGRSATRD
VYLYEGTLIKAGTRVVMPHYAMGRMSTVWGPDVDEFKPDRWIDPITGKGKVVSPFKFSVF
LGGPRICLGKKFALAEIKISLAKLLSQFDFKTVRDPFDFTYGSSITLQIKGPLDVVVSRLH*

>scaffold 27 seq a
MQACDYLQVDARYGCYHIVGRIARGGEVEGASSWLALSHLRASAQAPTMWSSLKFAIEASTTS
WGALLLCSLLVGWHLLSMRKQARAPSKFARPQSTLPVLGNTVDLMFTHQEDIHDWMLAEC
RRCKGRPWVLAALGRPMSLVLSNVEAFEDVLQRKFDQFGKRSAWLVSDVFGDGIFAADGV
SWIHQRKTASHLFSLHMMRESMEQVVREQAAVLCKTLFAHLNSNQSSSMADQHGVPVNLK
YTMDWYATNVFTRVGFGVDLDSLPSQEHDEFFRAFTRLPIAIHRRIQQPGWLWRIKRALN
LGYEKQLKLDMKRVDDVIYQVISRSMTSKSSEDPRRLPDLISLFLAKESNEYRDRDTKQE
GGAAATRSVKTTPKLIRDMAFNFTAAGRGTTSQSLQWFIIMLNRYPSVERKIREELLAKL
PQLFESNSSPPTMNDVQQLVYLEAAIKESLRLNPVAPLIGRTATQDVCFSDGTFITSGTR
VVIPTYAVARLKSIWGEDAAEFNPERWIDPQTGKLLVISPYKFLVFLAGPRSCLGAKLAM
LELKVALATVLSKFHLRVLRDPFEIGYDASISLPVKGDVLAVVEPAEMVVPPSAENVERSAGAA*

>scaffold 27 seq b introns? 
366140 PDGDLPILRNTLEIIAAQK 366196

366212 DWALKYCRKYQGKPWRLRVVGKEPTVVLCCPEAFEDIQKTQFEAFDKSRF 366361
366362 VSAAMYDVLGQGIFAISGPLWQHQRKTASHLFTTQMLQYAMEVVVPEKGD 366511
366512 EL 366517

XXXXXXXXXXXXXXXXPVAPVLQR
TAAQDTTLYDGTFVKAGTRVILPHYAMGRLETVWGPDAEQYKPERWIDPDTGKLVHASPY
KFAAFLAGPRMCLGMRFALAEMKLTLATVLSKFHIETVEDPFEFTYVPSVTLQVKGPVDV
RVTRPSSM*

>scaffold 27 seq c
MKLEAMTAWVSPASVAATCVAALLVYLATPSAHDRAVKHLPGPDGDLPILRN
TLEIIAAQKSGTFHDWALKYCRKYQGKPWRLRVVGKEPTVVLCCPEAFEDIQKTQFEAFD
KSRFVSAAMYDVLGQGIFAISGPLWQHQRKTASHLFTTQMLQYAMEVVVPEKGDELIKRL
DGVCLKEKTADRVVSMKRLLDLYTMDIFAKVGFDVDLHGVQSNQNAELLDSFDRMSVRIL
ERIQQPMWYWKLLRWLHVGPEKQLAEDVKKLDDLVYGVMARSIEDKNRQDASQSARKDLI
SLFIDKSDVEYTKGVHTKKDLKLMRDFVISFLAAGRETTATAMSWVILMMNRYPDVLKRV
RQELNEKLPGLASGKLRAPSMEDAQKLVFLEAVVRETLRLFPVVAITGRSATRDVYLYEG
TLIKAGTRVVMPHYAMGRMSTVWGPDVDEFKPDRWIDPITGKGKVVSPFKFSVFLGGPRI
CLGKKFALAEIKISLAKLLSQFDFKTVRDPFDFTYGSSITLQIKGPLDVVVSRLH*

>scaffold 27 seq d
MLPFAIAASLVAAA
VAYLTSPNDQDRAVCELPTPRSTLPVIKNTLDLAVRQRARIYDWILEQCREHGGRPWRVR
VLGRPPAVIVSSPEAMEDILKTQFEVFVKGSAVATISKDLLGDGIFAVDGSQWKHQRKAA
SHFFSMNMIRDAMEHVVRDHSVRLTKKLSEAAVSGEVVNIKRVLDFYTMDVFTKIGFGVE
LRGLETGGNSDFMEAFERATRRIMARFQQPMCIWKLARWLSVGAERQMASDMKLINGVVY
DVIHRNLEGKKQRKQSGGTFNSGREDVISLFLEKANVEYSDDDHVKMTPTMLRDMSMVFL
FAGRDSTSLTMTWYIIEMNRHPEALANVRRELTDKLPRLGLNDAETPSMEDIDELVYLEA
AIRECIRLNPVAPVLQRTAAQDTTLYDGTFVKAGTRVILPHYAMGRLETVWGPDAEQYKP
ERWIDPDTGKLVHASPYKFAAFLAGPRMCLGMRFALAEMKLTLATVLSKFHIETVEDPFE
FTYVPSVTLQVKGPVDVRVTRPSSM*

>scaffold 1
MWSSTSHDGAQQSVLMALGALTVVYASWKILNLPVPMPDPGMEQLFRPASTLPVLGNTLDVLLFNRYRMSD
WINDQTDASSGQPWILQLLFQPPWVVLSMPNDLHDVFVDQFQVFEKGGTLGDISFDVLGN
GLLNVSGDKWKQQRRAASHLFSTQSIRDVMEPVIREKTLQLRDVLAQSAGRKQTVSMKSL
LGKFTSDVFTRIGFGVELDQLGGDVFKDEQHPLDIALHAVQNRFQTPAWMWKLARFLNVG
AEKRLRESMKTVNDMVRDIMVRSISEKSSGDQKKNLLTLLMKDNAAADPRELQDTAVNFF
IAGKDTTSFSLSWLIVMMNRYPRVLQKIREEIRSVLPTLLTGEMDAPTLEDTQKLVYLDA
AVKESVRLQAVSTYRCTTRDTTLTDGAFIKKGTVVVVSKYAAARRKGVWGEDAAEYKPER
WFDEKTGEPKNITPPQFITFSTGPRKCIGMRLAMLEMKTVMAVLFSRFDIETVEDPFKIT
YDFSFVLPVKGPLAVRVRDRAPLSA*

>BE775645.1|BE775645 MY-05-B-08 P. infestans MY Phytophthora infestans cDNA.
Title:          Initial assessment of gene diversity for the oomycete
                pathogen Phytophthora infestans based on expressed sequences
Authors:        Kamoun,S., Hraber,P.T., Sobral,B.W.S., Nuss,D., Govers,F.
Citation:       Fungal Genet. Biol. 28 (2): 94-106 1999
THIS IS A STRAMENOPILE P450 FRAGMENT
DPRVLFSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVVVSRLNV*

Rank 1>CON_001_02403 lcl|75102
           Length = 368
           
  Score =  135 bits (337), Expect = 1e-33
  Identities = 67/67 (100%), Positives = 67/67 (100%)
 
 Query: 1  FSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVV 60
           FSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVV
 Sbjct: 18 FSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVV 197
 
 Query: 61 VSRLNV* 67
           VSRLNV*
 Sbjct: 198VSRLNV* 218
 
 
Rank 2>CON_001_08203 lcl|80902
            Length = 619
            
  Score = 60.5 bits (144), Expect = 5e-11
  Identities = 29/63 (46%), Positives = 40/63 (63%)
 
 Query: 1   FSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVV 60
            F  F  GPR CLGM+FA+ E+K  LA +LS++ F T ++P  +TY  +  LQ+ GPL   
 Sbjct: 67  FVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHFTTRENPKSYTYDVASLLQVKGPLICK 246
 
 Query: 61  VSR 63
            V R
 Sbjct: 247 VQR 255
 
 
Rank 3>CON_001_06449 lcl|79148
           Length = 332
           
  Score = 60.5 bits (144), Expect = 5e-11
  Identities = 29/63 (46%), Positives = 40/63 (63%)
 
LMQDPWTGEQTIRPVSAFQFVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHFTTRENPK
SYTYDVASLLQVKGPLICKVQRAG* 
 
Rank 4>CON_001_10882 lcl|83581
            Length = 620
            
  Score = 54.7 bits (129), Expect = 3e-09
  Identities = 24/57 (42%), Positives = 35/57 (61%)
 
ARGEIDAPSMEQLGRLPYLEAAMRENLRLNTSMTTRSPNQDTTLSCGTFIPKNSVVCVCH
YASARLKSTWGDDAAEYKPERWLDPDTGKLRQFSPYQFVTFLAVPRQCIGMRFAMLELRM
VASVLCSRFNIKTVEDPFSLTYELSTVFPVKGRLMCTVESSGLAVSS* 
 
Rank 5>CON_002_03183 lcl|75882
            Length = 827
            
  Score = 34.8 bits (78), Expect = 0.003
  Identities = 22/58 (37%), Positives = 27/58 (45%), Gaps = 1/58 (1%)
 
 Query: 4   FFGGPRICLGMKFALAEVKITLAKLLSQFD-FKTVKDPFDFTYRPSITLQINGPLDVVV 61
            F  G R+C GM   L  V  TLA LL  FD      +P D T     T     PL+++V
 Sbjct: 605 FGSGRRVCAGMSLGLNMVHFTLANLLHSFDILNPSAEPVDMTEFFGFTNTKATPLEILV 781
 
 
  Score = 34.8 bits (78), Expect = 0.003
  Identities = 22/58 (37%), Positives = 27/58 (45%), Gaps = 1/58 (1%)
 
 Query: 4   FFGGPRICLGMKFALAEVKITLAKLLSQFD-FKTVKDPFDFTYRPSITLQINGPLDVVV 61
            F  G R+C GM   L  V  TLA LL  FD      +P D T     T     PL+++V
 Sbjct: 272 FGSGRRVCAGMSLGLNMVHFTLANLLHSFDILNPSAEPVDMTEFFGFTNTKATPLEILV 448
 
 
Rank 6>CON_001_05919 lcl|78618
            Length = 383
            
  Score = 34.4 bits (77), Expect = 0.003
  Identities = 15/32 (46%), Positives = 21/32 (64%)
 
 Query: 1   FSVFFGGPRICLGMKFALAEVKITLAKLLSQF 32
            F  F  GPR C+G K A+ E+K+  A L+S+F
 Sbjct: 102 FIAFRAGPRKCVGRKLAMIEMKVVTACLVSRF 197
 
 
Rank 7>CON_001_12625 lcl|85324
            Length = 648
            
  Score = 31.7 bits (70), Expect = 0.022
  Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 
 Query: 3   VFFG-GPRICLGMKFALAEVKITLAKLLSQFDFKTV-KDPFDFTYRPSITLQINGPLDVV 60
            V FG G R C G   A+  V  TL  L+  FD+K V ++  D T    ITL    PL+ +
 Sbjct: 218 VAFGMGRRACPGEPMAMQSVSFTLGLLIQCFDWKRVSEEKLDMTENNWITLSRLIPLEAM 397
 
 
Rank 8>CON_001_10030 lcl|82729
            Length = 724
            
  Score = 31.3 bits (69), Expect = 0.029
  Identities = 19/58 (32%), Positives = 29/58 (49%), Gaps = 1/58 (1%)
 
FKPERFLTTDKDIDMKGQHFQLLPFGGGRRICPVINLGLQTVRLTLASFLHS
FEILNPSTEPLDMTEVFTATNTKATPLEILIKPRLSPTCYESI*

>BE583529.1 7-11G-HA PsojaeHA Glycine max/Phytophthora sojae mixed EST library cDNA.
          Length = 558
Sbjct: 223 FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 134

Rank 1>CON_002_03183 lcl|75882
            Length = 827
            
78002 75882 BE583529.1
QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK
LLGENVESDRDFMDVMISALNGAQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLL
LRNPLALGKAKEEIDMQIGKDEYIRESDIS
KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV
WSDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFD
ILNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPNYYETL* 

Rank 1>CON_002_03183 lcl|75882
           Length = 827
           
  Score =  130 bits (323), Expect = 4e-32
  Identities = 60/60 (100%), Positives = 60/60 (100%)
 
 Query: 1  ARGKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV 60
           ARGKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV
 Sbjct: 2  ARGKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV 181
 
 
Rank 2>CON_001_05303 lcl|78002
            Length = 658
            
  Score =  118 bits (294), Expect = 9e-29
  Identities = 54/55 (98%), Positives = 54/55 (98%)
 
 Query: 4   KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDP 58
            KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIH DP
 Sbjct: 452 KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHXDP 616
 
>_2
QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK
LLGENVESDRDFMDVMISALNGAQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLL
LRNPLALGKAKEEIDMQIGKDEYIRESDIS KLVYLQAIVKETLRLYPPAPFSSPREFTEN
CILGGYHIKKGTRLIHNLWKIHXDPMFGQTHWNSNQKGS

Rank 1>CON_001_05303 lcl|78002
           Length = 658
           
  Score =  129 bits (321), Expect = 5e-32
  Identities = 60/60 (100%), Positives = 60/60 (100%)
 
 Query: 1  QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK 60
           QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK
 Sbjct: 2  QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK 181
 
 
Rank 2>CON_001_05188 lcl|77887
            Length = 621
            From aa 177 to the I-helix AGTEAS
NVQSGFATVELKQWFSLLVFNMILRMVCGKRYFSASTSDDEKANRCVKAVDEFVRLAATF
TVGDAIPYLRWFDFGGYENDMRETGKELDEIIGEWLDEHRQKRKMGENVQDLMSVLLSLL
EGKTIEGMNVDIXIKSFVLTVIQAGTEASITTLIWATRLILNN 

Rank 3>CON_001_06635 lcl|79334
            Length = 706
            
  Score = 44.1 bits (102), Expect = 2e-06
  Identities = 20/57 (35%), Positives = 32/57 (56%)
 
 Query: 1   QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHR 57
            + F + + E + LMG     D +P LRW D    EK +K+ +K  D +L++ L E+R
 Sbjct: 49  REFRETVTEMLELMGLANKGDHLPFLRWFDFQNVEKRLKSISKRYDSILNKILHENR 219
 
 
Rank 4>CON_001_08105 lcl|80804
            Length = 751
            
  Score = 37.1 bits (84), Expect = 3e-04
  Identities = 20/56 (35%), Positives = 31/56 (54%)
 36% to 71A23 from about 125 to EXXR
HEKMCTLELLSQTKINSFRIVREEELDLSIKLLREASNDGAAAVDISAKVARISADVACR
MVLGKKYMDQDLDEKGFKAVVQEVMHLLATPNIGDYIPYIGKLDLQGLIKRMKAVRKIFD
EFFDKIIDEHIQSDKGQDNKVKDFVDVMLGFVGSEEYEYRIERPNIKAILLDMLLGSMDT
SATVIEWTLSELLKNPRVMKKVQMELETVVGMQRKVKESDLDKLEYLDMVIKENMRLHXV
APLLIPHQ 
 
Rank 5>CON_001_08829 lcl|81528
            Length = 740
            
  Score = 32.1 bits (71), Expect = 0.011
  Identities = 19/58 (32%), Positives = 31/58 (52%), Gaps = 1/58 (1%)
 
 Query: 3   FMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKE-VDKLLSEWLEEHRQKK 60
            FM  +R+ + + G F V D  P L+ L L   +KA   +  +  DK+L + L  H +K+
 Sbjct: 473 FMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVEHVHQRADKILEDILRXHMEKR 649

HEALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLL
APQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSA
GSPIDLSGKLFSLLGTTVSRAAFGKENDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLH
LLTRQKAKVEHVHQRADKILEDILRXHMEKRTRVKEGHGSEAEQEDLVDVLLRLXESGSL

Rank 3>CON_002_03058 lcl|75757
            Length = 664
            

TRKDRCICESDISNLVYLQAVVKETFRLYAPGPLSSPREFAEDCTLGGYHVKKGTRLITN
IWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKGHHFQLLPFGSGRRVCPGISFGLQTVHL
ALASFLHSFEILNPSTEPLDMTEAFGVTNTKATPLEVLVKPCLSPSCYKSM*

 
Rank 4>CON_001_02478 lcl|75177
            Length = 721
            
  Score = 59.3 bits (141), Expect = 8e-11
  Identities = 26/54 (48%), Positives = 37/54 (68%)
 
 Query: 5   LVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDP 58
            L Y+QA++KE+LRL+PP PF  PRE  ++    G+ + KGT ++ N W I RDP
 Sbjct: 257 LPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDP 418
 
 
Rank 5>CON_001_07479 lcl|80178
            Length = 716
            
  Score = 56.6 bits (134), Expect = 5e-10
  Identities = 25/54 (46%), Positives = 37/54 (68%)
 
 Query: 5   LVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDP 58
            L Y++AIVKET R++PP P    R+ TE C + GY I +G  ++ N+W++ RDP
 Sbjct: 449 LPYIRAIVKETFRMHPPLPVVK-RKCTEECEINGYVIPEGALILFNVWQVGRDP 607
 
 
Rank 6>CON_001_06635 lcl|79334
            Length = 706
            
  Score = 55.4 bits (131), Expect = 1e-09
  Identities = 26/57 (45%), Positives = 37/57 (64%)
 
 Query: 4   KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV 60
            KL YL+ I+ ETLRLYPPAP   P   +E+  + G++I + T +I N W + RDP +
 Sbjct: 475 KLPYLRKIILETLRLYPPAPILIPHVSSEDITIEGFNIPRDTIVIINGWGMQRDPQL 645
 
 
Rank 7>CON_001_12625 lcl|85324
           Length = 648
           
  Score = 46.9 bits (109), Expect = 5e-07
  Identities = 21/48 (43%), Positives = 31/48 (63%)
 
 Query: 13 KETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV 60
           +ETLRLYPPAP   P   +E+  + G++I + T +I N W + RDP +
 Sbjct: 11 EETLRLYPPAPILIPHVSSEDITIEGFNIPRDTIVIINGWGMQRDPQL 154
 
 
Rank 8>CON_001_11558 lcl|84257
            Length = 754
            
  Score = 37.1 bits (84), Expect = 4e-04
  Identities = 20/38 (52%), Positives = 22/38 (57%)
 
 Query: 4   KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHI 41
            KL YLQA+VKETLRL    P   P     +  LGGY I
 Sbjct: 636 KLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDI 749
 
 
Rank 9>CON_001_01574 lcl|74273
           Length = 721
           
  Score = 31.3 bits (69), Expect = 0.022
  Identities = 13/34 (38%), Positives = 20/34 (58%)
 
 Query: 27 PREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV 60
           P     N  +GGY+I KG+ +  N+W + RDP +
 Sbjct: 13 PHMAGNNVKVGGYNIPKGSIVHVNVWALGRDPKI 114
 
 
Rank 10>CON_002_03426 lcl|76125
            Length = 860
            
  Score = 30.5 bits (67), Expect = 0.038
  Identities = 14/40 (35%), Positives = 22/40 (55%)
 
 Query: 5   LVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKG 44
            + YL+A ++E+LRL PPAP  +     +     G  + KG
 Sbjct: 464 ITYLEATIRESLRLKPPAPCVTQHCTQDTVFPDGTFVPKG 583
 
 
Rank 11>CON_001_02560 lcl|75259
            Length = 270
            
  Score = 28.6 bits (62), Expect = 0.15
  Identities = 13/28 (46%), Positives = 18/28 (63%)
 
 Query: 1   ARGKLVYLQAIVKETLRLYPPAPFSSPR 28
            A  K+  ++++V ETLRL PP P   PR
 Sbjct: 185 AINKMSLVKSVVYETLRLRPPVPRPRPR 268


Rank 2>CON_002_03058 lcl|75757
            Length = 664
            
  Score = 46.9 bits (109), Expect = 4e-07
  Identities = 20/30 (66%), Positives = 23/30 (76%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
            FGSGRRVC G+S GL  VH  LA+ LHSF+
 Sbjct: 304 FGSGRRVCPGISFGLQTVHLALASFLHSFE 393
 
 
Rank 3>CON_001_10030 lcl|82729
            Length = 724
            
  Score = 40.6 bits (93), Expect = 3e-05
  Identities = 17/30 (56%), Positives = 22/30 (72%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
            FG GRR+C  ++LGL  V  TLA+ LHSF+
 Sbjct: 111 FGGGRRICPVINLGLQTVRLTLASFLHSFE 200
 
 
Rank 4>CON_001_01574 lcl|74273
            Length = 721
            
  Score = 39.1 bits (89), Expect = 1e-04
  Identities = 16/29 (55%), Positives = 22/29 (75%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSF 29
            FG+GRR+C GM+L +N+V   L +LLH F
 Sbjct: 199 FGAGRRICPGMNLAVNLVTSMLPHLLHHF 285
 
 
Rank 5>CON_001_02222 lcl|74921
            Length = 732
            
  Score = 38.7 bits (88), Expect = 1e-04
  Identities = 17/29 (58%), Positives = 20/29 (68%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSF 29
            FGSGRR C GM LGL  +   +A+LLH F
 Sbjct: 220 FGSGRRSCPGMQLGLYALEMAVAHLLHCF 306
 
 
Rank 6>CON_001_12625 lcl|85324
            Length = 648
            
  Score = 32.8 bits (73), Expect = 0.007
  Identities = 14/30 (46%), Positives = 17/30 (56%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
            FG GRR C G  + +  V FTL  L+  FD
 Sbjct: 224 FGMGRRACPGEPMAMQSVSFTLGLLIQCFD 313
 
 
Rank 7>CON_001_11106 lcl|83805
            Length = 542
            
  Score = 32.5 bits (72), Expect = 0.010
  Identities = 14/30 (46%), Positives = 21/30 (69%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
            FGSGRR+C G++L  + +   LA+L+  FD
 Sbjct: 173 FGSGRRMCPGVNLATSGMATLLASLIQCFD 262
 
 
Rank 8>CON_001_02403 lcl|75102
           Length = 368
           
  Score = 31.3 bits (69), Expect = 0.022
  Identities = 15/30 (50%), Positives = 16/30 (53%)
 
 Query: 1  FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
           F  G R+C GM   L  V  TLA LL  FD
 Sbjct: 27 FFGGPRICLGMKFALAEVKITLAKLLSQFD 116
 
 

Rank 9>CON_001_07041 lcl|79740
            Length = 678
            
  Score = 30.1 bits (66), Expect = 0.049
  Identities = 13/30 (43%), Positives = 19/30 (63%)
 
 Query: 1   FGSGRRVCAGMSLGLNMVHFTLANLLHSFD 30
            FG GRR C G+ L L ++  TL  L+ +F+
 Sbjct: 225 FGVGRRSCPGIILALPILGITLGRLVQNFE 314


>BM399816 5009-0-62-A08.t.2 Tetrahymena thermophila cDNA. Ciliophora Alveolate
TAA and TAG are Q
38% to 4V2 frameshift between PERW and PYTF
KTVGKRATRGGAYNSVGKQISTPFYFLFRTNFFKWGIRESDRELNKQIKEFRQMIGDIINERIKEEEELEKRGEQTTKEDLVYYLKKNNLRGVLSLDEIISEFMTFYVAGMDTTGHLCGMAIWFLTQHPEIKKKLQEELDANTDYSQNGLLKLPYLNGVIQETQRLYGPAGQLFNRVALRDHMLKDIPIKKGTIVKPSPCSVHRHPKYFEDPHSFKPERWFNKKTVTPYTFIPFNAGPRNCIGQHLALVEARIMMYYFMKTFDFESDHNFEMVLNKASQQTSRQLRIILAQEI


RED ALGAE
>dbj|AV436797.1|AV436797 AV436797 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA
PS010g10_r 5'. Length = 375

Query: 423 PKGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKAS----------EAKKNWLVFGCG 472
           P G ++   +    H+P  Y +P  F P RW+  +              A+ ++L F  G
Sbjct: 89  PAGTVVHLPIIANHHNPTAYASPLAFDPTRWLPPTAPGGGGHTPAAQRAARTHFLAFHLG 268

Query: 473 PHVCLGQTYVMITFAALL 490
           P  C GQ    +   A+L
Sbjct: 269 PRACPGQNMAAVEAKAML 322

SLRRFPPAPNGSIRKLPADLRLPSSGDVIPAGTVV HLPIIANHHNPTA
YASPLAFDPTRWLPPTAPGGGGHTPAAQRAARTHFLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWSRVGDSAD

a related gene 82% IN OVERLAP REGION
>dbj|AV430754.1|AV430754 AV430754 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA clone
           PL023g10_r 5'.
          Length = 548

 Score = 62.0 bits (149), Expect = 3e-11
 Identities = 29/35 (82%), Positives = 33/35 (93%)
 Frame = +2

Query: 1   SLRRFPPAPNGSIRKLPADLRLPSSGDVIPAGTVV 35
           SLR FPPAPNG+IRKL ADLRLPS+G+VIPAGTV+
Sbjct: 443 SLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVL 547

DMTVLAGLPVPELLGSARMASLKK TGNNFLADFERLAARRQAAYADGSAAAQPPRDMLDIMLADLGQATGVYEGDRRRVAADLLFYLL
AGYDTTAHSIAWTVHALLDNPEAEARLVAELKTALPPAGQPITAAHLSAMPYLDAVWKE
SLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVL

another related gene upstream 70& IN OVERLAP

>dbj|AV436223.1|AV436223 AV436223 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA clone
           PM068e09_r 5'.
          Length = 533

 Score = 37.4 bits (85), Expect = 0.001
 Identities = 17/24 (70%), Positives = 18/24 (74%)
 Frame = +1

Query: 1   DMTVLAGLPVPELLGSARMASLKK 24
           D T L GLP PELLG ARM SL+K
Sbjct: 460 DTTALVGLPAPELLGRARMTSLRK 531

AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGTPTTETVLRVVNETLWGVPSRSVGSDGARSGGGAAPPARWAAHLEALADSGESVDIDDLATSFTVHMIYALLYSETPSLSELADEKDRLIRLIADTTALVGLPAPELLGRARMTSLRK

>dbj|AV430865.1|AV430865 AV430865 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA clone
           PL025d06_r 5'.
          Length = 470

 Score =  146 bits (369), Expect = 1e-36
 Identities = 72/72 (100%), Positives = 72/72 (100%)
 Frame = +1

Query: 1   AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGT 60
           AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGT
Sbjct: 253 AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGT 432

Query: 61  PTTETVLRVVNE 72
           PTTETVLRVVNE
Sbjct: 433 PTTETVLRVVNE 468

AVATAAATTAIVTALVWPRVATDVLGLHGTSFPSPADGGDMPLLGRVPQLVTAARGKTLVHTYLDWQRRVGWGVNHQFYTLGRR
AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGTPTTETVLRVVNE

>dbj|AV433636.1|AV433636 AV433636 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA clone
           PM031g08_r 5'.
          Length = 453

 Score = 85.9 bits (211), Expect = 1e-18
 Identities = 41/84 (48%), Positives = 52/84 (61%)
 Frame = +1

Query: 1   AVATAAATTAIVTALVWPRVATDVLGLHGTSFPSPADGGDMPLLGRVPQLVTAARGKTLV 60
           A A A+   A +TA+ WPR ATD LGLHGTSF  P  GGD PLLGRV +L TA + + + 
Sbjct: 34  AAAVASTLAAALTAVAWPRFATDTLGLHGTSFAGPTSGGDWPLLGRVAELATALKDRRMC 213

Query: 61  HTYLDWQRRVGWGVNHQFYTLGRR 84
             + DW+   G   N+Q +T G R
Sbjct: 214 FLFADWRAAAG-APNYQVWTAGTR 282

>dbj|AV433541.1|AV433541 AV433541 Porphyra yezoensis TU-1 Porphyra yezoensis cDNA clone
           PM030e08_r 5'.
          Length = 540

 Score = 82.4 bits (202), Expect = 1e-17
 Identities = 39/80 (48%), Positives = 50/80 (61%)
 Frame = +3

Query: 1   AVATAAATTAIVTALVWPRVATDVLGLHGTSFPSPADGGDMPLLGRVPQLVTAARGKTLV 60
           A A A+   A +TA+ WPR ATD LGLHGTSF  P  GGD PLLGRV +L TA + + + 
Sbjct: 276 AAAVASTLAAALTAVAWPRFATDTLGLHGTSFAGPTSGGDWPLLGRVAELATALKDRRMC 455

Query: 61  HTYLDWQRRVGWGVNHQFYT 80
             + DW+   G   N+Q +T
Sbjct: 456 FLFADWRAAAG-APNYQVWT 512

MARTPLPPRPVAAAAVATAAVAAAVATRALVGRGCLAAAVASTLAAALTAVAWPRFATDTLGLHGTSFAGPTSGGDWPLLGRVAELATALKDRRMCFLFADWRAAAGAPNYQVWTAVTRRVFIT

assembled hybrid RHODOPHYTA gene from five pieces most like 4A subfamily 35%
MARTPLPPRPVAAAAVATAAVAAAVATRALVGRGCL
AVATAAATTAIVTALVWPRVATDVLGLHGTSFPSPADGGDMPLLGRVPQLVTAARGKTLVHTYLDWQRRVGWGVNHQFYTLGRR
AVVIVDPDDIRAVAMRLNAPRDQRKLRFFGTPLSADMLFVVPDPRHDNARRLVHPFLSGTPTTETVLRVVNETLWGVPSRSVGSDGARSGGGAAPPARWAAHLEALADSGESVDIDDLATSFTVHMIYALLYSETPSLSELADEKDRLIRLIADTTALVGLPAPELLGRARMTSLRKTGNNFLADFERLAARRQAAYADGSAAAQPPRDMLDIMLADLGQATGVYEGDRRRVAADLLFYLLAGYDTTAHSIAWTVHALLDNPEAEARLVAELKTALPPAGQPITAAHLSAMPYLDAVWKESLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPTAYASPLAFDPTRWLPPTAPGGGGHTPAAQRAARTHFLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWSRVGDSAD


Phytophthora section

>CON_001_02478 lcl|75177 Length = 721 seq after RRRM is a guess
5   PRVRLDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQ 178
179 AMAEVKTEISKVVGLNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKF 352
353 MGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRFLGSLDGKGQPYELILFGARRRM
XPGNLQAPRKTPSPLRIPALMNFYWNFPRRCAPPHPTTTGRISLVLPPRTPTAAGRDDRSTA*


>Complete Phytophthora seq in the 2 clan 37% to 705A seqs
80178 83805 
MLLELALGLFVLALFLHLRPTPSAKSKALRHLPNPPSPKPRLPFIGHLHLLXDKLLHYALIDLSKKHG
PLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYDSSVAMVPFGPYW
KFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEELLKWTNSTIS
MMMLGEAEEIRDIAREVLKIFGEYSLTDFIWPLKHLKVGKYEKRIDDILNKFDP
VVERVIKKRREIVRRRKNGEVVEGEVSG
VFLDTLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVL 
EKAREEVYSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYV 
IPEGALILFNVWQVGRDPKYWDRPSEFRPERFL 
ETGAEGEAGPLDLRGQHFQLLPFGSGRRMCPGVNLATSGMATLLASLIQCFDLQVLGPQGQIL
KGGDAKVSMEERAGLTVPRAHSLVCVPLARIGVASKLLS*

Rank 4>CON_001_12945 lcl|85644
            Length = 719

ASTADVVKLFLEPTGPLT*RMVAPLCHRTPHLRQPMWPWIPSDLTWKLVTNLMMIDLMNATTGIKLR
LRTQQIRKLLRAMGQTVQAHKPMDATYDLLRGTDSTLSMKXAQPRHDADHETYDREGLKI
FGEYRLTDLMWAWKSLKDG*HARTIDDIVNKAEPGAERVIRYAARSVIIEKERIS
AVAGEASWDFLDTLLEFAEDETMEIKITKEXIKGLVVDFFSAGTDST


Rank 2>CON_001_02478 lcl|75177
            Length = 721
            
  Score =  123 bits (307), Expect = 1e-29
  Identities = 59/149 (39%), Positives = 99/149 (65%), Gaps = 4/149 (2%)
 
 Query: 1   VFLDTLLEF---AEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVL 57
            V LD LLEF    +DE    K+++  IK  +++ F AGT++T+ +  WAL EL+ +P+ +
 Sbjct: 11  VRLDVLLEFEGTGKDEPA--KLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQAM 184
 
 Query: 58  EKAREEVYSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLP-VVKRKCTEECEINGYV 116
             + + E+  VVG +   +E D +NLPY++A++KE+ R+HPPLP ++ R+  ++ +  G+ 
 Sbjct: 185 AEVKTEISKVVGLNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHD 364
 
 Query: 117 IPEGALILFNVWQVGRDPKYWDRPSEFRPERFL 149
            + +G  +L N W +GRDP+ WD P   +P RFL
 Sbjct: 365 VLKGTHVLVNAWAIGRDPECWDDPLSLKPYRFL 463
 
 
Rank 3>CON_001_06635 lcl|79334
            Length = 706
            
  Score =  119 bits (295), Expect = 3e-28
  Identities = 59/146 (40%), Positives = 92/146 (62%), Gaps = 1/146 (0%)
 
 Query: 3   LDTLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKARE 62
            +D LL+    ET     T   IKGL +     GTDS+    EW+L+ L+N+P+VL+KAR+
 Sbjct: 247 IDHLLKL--QETQPQYYTDQIIKGLALAMLFGGTDSSTGTLEWSLSNLLNHPEVLKKARD 420
 
 Query: 63  EVYSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLPV-VKRKCTEECEINGYVIPEGA 121
            E+ + VG+DRL++E D   LPY+R I+ ET R++PP P+ +    +E+  I G+ IP   
 Sbjct: 421 ELDTQVGQDRLLNESDLPKLPYLRKIILETLRLYPPAPILIPHVSSEDITIEGFNIPRDT 600
 
 Query: 122 LILFNVWQVGRDPKYWDRPSEFRPERF 148
            +++ N W + RDP+ W+  +  +PERF
 Sbjct: 601 IVIINGWGMQRDPQLWNDATCXKPERF 681
 
 
Rank 4>CON_001_05303 lcl|78002
            Length = 658
            
  Score =  100 bits (247), Expect = 1e-22
  Identities = 48/112 (42%), Positives = 69/112 (60%), Gaps = 1/112 (0%)
 
 Query: 25  KGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAREEVYSVVGKDRLVDEVDTQNLPY 84
            K   ++    GTDSTAV   WAL+ L+ NP  L KA+EE+   +GKD  + E D   L Y
 Sbjct: 284 KATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESDISKLVY 463
 
 Query: 85  IRAIVKETFRMHPPLPVVK-RKCTEECEINGYVIPEGALILFNVWQVGRDPKY 136
            ++AIVKET R++PP P    R+ TE C + GY I +G  ++ N+W++  DP +
 Sbjct: 464 LQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHXDPMF 622
 
 
Rank 5>CON_002_03058 lcl|75757
            Length = 664
            
  Score = 83.1 bits (202), Expect = 2e-17
  Identities = 35/80 (43%), Positives = 54/80 (66%), Gaps = 1/80 (1%)
 
 Query: 70  KDRLVDEVDTQNLPYIRAIVKETFRMHPPLPVVK-RKCTEECEINGYVIPEGALILFNVW 128
            KDR + E D  NL Y++A+VKETFR++ P P+   R+  E+C + GY + +G  ++ N+W
 Sbjct: 10  KDRCICESDISNLVYLQAVVKETFRLYAPGPLSSPREFAEDCTLGGYHVKKGTRLITNIW 189
 
 Query: 129 QVGRDPKYWDRPSEFRPERFL 149
            ++  DP  W  P EF+P+RFL
 Sbjct: 190 KIHTDPNVWSDPFEFKPDRFL 252
 
 
Rank 6>CON_001_08105 lcl|80804
            Length = 751
            
  Score = 80.8 bits (196), Expect = 1e-16
  Identities = 36/101 (35%), Positives = 60/101 (58%)
 
 Query: 2   FLDTLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAR 61
            F+D +L F   E  E +I + +IK +++D      D++A   EW L+EL+ NP+V++K +
 Sbjct: 437 FVDVMLGFVGSEEYEYRIERPNIKAILLDMLLGSMDTSATVIEWTLSELLKNPRVMKKVQ 616
 
 Query: 62  EEVYSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLPVV 102
             E+ +VVG  R V E D   L Y+  ++KE  R+H   P++
 Sbjct: 617 MELETVVGMQRKVKESDLDKLEYLDMVIKENMRLHXVAPLL 739
 
 

Rank 7>CON_002_03183 lcl|75882
            Length = 827
            
  Score = 77.3 bits (187), Expect = 1e-15
  Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 
 Query: 82  LPYIRAIVKETFRMHPPLPVVK-RKCTEECEINGYVIPEGALILFNVWQVGRDPKYWDRP 140
            L Y++AIVKET R++PP P    R+ TE C + GY I +G  ++ N+W++ RDP  W  P
 Sbjct: 14  LVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSDP 193
 
 Query: 141 SEFRPERFL 149
             EF+PERFL
 Sbjct: 194 LEFKPERFL 220
 
 

Rank 10>CON_001_11558 lcl|84257
            Length = 754
            
  Score = 72.2 bits (174), Expect = 4e-14
  Identities = 35/101 (34%), Positives = 62/101 (60%), Gaps = 1/101 (0%)
 
 Query: 18  KITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAREEVYSVVGKDRLVDEV 77
            +I +D++  +V +   A  ++T  + EW +AEL+N+P++ +K R+E+  V+     V E 
 Sbjct: 447 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLEAGHQVTEP 626
 
 Query: 78  DTQNLPYIRAIVKETFRMHPPLP-VVKRKCTEECEINGYVIP 118
            D Q LPY++A+VKET R+   +P +V      + ++ GY IP
 Sbjct: 627 DIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIP 752
 
 
Rank 11>CON_001_01574 lcl|74273
            Length = 721
            
  Score = 57.4 bits (136), Expect = 1e-09
  Identities = 21/39 (53%), Positives = 30/39 (76%)
 
 Query: 111 EINGYVIPEGALILFNVWQVGRDPKYWDRPSEFRPERFL 149
            ++ GY IP+G+++  NVW +GRDPK W  P +FRPERF+
 Sbjct: 37  KVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFI 153
 
 
Rank 12>CON_001_02222 lcl|74921
            Length = 732
            
  Score = 56.2 bits (133), Expect = 3e-09
  Identities = 21/56 (37%), Positives = 35/56 (62%)
 
 Query: 94  RMHPPLPVVKRKCTEECEINGYVIPEGALILFNVWQVGRDPKYWDRPSEFRPERFL 149
            R+ PP+P++  +  EE  ++GY IP  + ++ N + +GRD   W+ P  F+P RFL
 Sbjct: 4   RVRPPIPLLLHETAEESTVSGYYIPAKSHVIINSFAIGRDKNSWEDPDSFKPSRFL 171
 
 

Rank 13>CON_002_03426 lcl|76125
            Length = 860
            
  Score = 55.8 bits (132), Expect = 4e-09
  Identities = 45/130 (34%), Positives = 75/130 (57%), Gaps = 17/130 (13%)
 
 Query: 5   TLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAREEV 64
            ++L  +ED T E  + KD +  + +    AG D+T  AT W +  L  NP+V  K R E+
 Sbjct: 221 SILLDSEDATGEPVLPKD-VFNISLAGVLAGKDTTGDATSWLMHLLHENPRVENKLRAEL 397
 
 Query: 65  YSVVGK---DRL----VDEVDTQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEI-NGYV 116
             + V K   D      ++E+D   + Y+ A ++E+ R+ PP P V + CT++    +G  
 Sbjct: 398 LAKVPKLAEDESYVPPMEELDA--ITYLEATIRESLRLKPPAPCVTQHCTQDTVFPDGTF 571
 
 Query: 117 IPEG---------ALILFNVWQVGRDP 134
            +P+G         + +L +VW  G DP
 Sbjct: 572 VPKGMDTTLLYHASALLPSVW--GPDP 646
 
 
Rank 14>CON_001_12625 lcl|85324
            Length = 648
            
  Score = 54.7 bits (129), Expect = 8e-09
  Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 1/59 (1%)
 
 Query: 90  KETFRMHPPLPV-VKRKCTEECEINGYVIPEGALILFNVWQVGRDPKYWDRPSEFRPERF 148
            +ET R++PP P+ +    +E+  I G+ IP   +++ N W + RDP+ W+  + F+PERF
 Sbjct: 11  EETLRLYPPAPILIPHVSSEDITIEGFNIPRDTIVIINGWGMQRDPQLWNDATCFKPERF 190
 
 
Rank 15>CON_001_07041 lcl|79740
            Length = 678
            
  Score = 48.0 bits (112), Expect = 8e-07
  Identities = 18/40 (45%), Positives = 26/40 (65%)
 
 Query: 109 ECEINGYVIPEGALILFNVWQVGRDPKYWDRPSEFRPERF 148
            + ++ GY IP  + IL N W +  +P +W +P EFRPERF
 Sbjct: 51  DAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF 170
 
 
Rank 16>CON_001_06134 lcl|78833
            Length = 371
            
  Score = 40.6 bits (93), Expect = 1e-04
  Identities = 18/43 (41%), Positives = 26/43 (59%)
 
HERTVSNMLSLYLDAIARSSGTDEQLYDPVHLRDVVVNFLVAGRDTTAQALSWFFFCVSQ
NPRVESKLRREIYKKLPELMTAESCVPT 
 

Rank 17>CON_001_05188 lcl|77887
            Length = 621
            
  Score = 34.4 bits (77), Expect = 0.011
  Identities = 20/72 (27%), Positives = 34/72 (46%), Gaps = 1/72 (1%)
 
 Query: 3   LDTLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKARE 62
            +  LL   E +T+E       IK  V+    AGT+++     WA   ++NNP V +  ++
 Sbjct: 339 MSVLLSLLEGKTIEGMNVDIXIKSFVLTVIQAGTEASITTLIWATRLILNNPSV*KNLKQ 518
 
 Query: 63  E-VYSVVGKDRLV 74
               + +  KD  V
 Sbjct: 519 N*TFKLXKKDTYV 557

Rank 3>CON_001_06635 lcl|79334
            Length = 706
            
  Score =  111 bits (274), Expect = 9e-26
  Identities = 50/148 (33%), Positives = 88/148 (58%)
 
 Query: 5   LDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQAMAEVK 64
            +D LL+ + T   +P   ++  IK   L +   GT++++ ++ W+L+ LL HP+ + + +
 Sbjct: 247 IDHLLKLQET---QPQYYTDQIIKGLALAMLFGGTDSSTGTLEWSLSNLLNHPEVLKKAR 417
 
 Query: 65  TEISKVVGLNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKG 124
             E+   VG +    ESD+  LPY++ ++ E+LRL+PP P LIP  + +D    G ++ + 
 Sbjct: 418 DELDTQVGQDRLLNESDLPKLPYLRKIILETLRLYPPAPILIPHVSSEDITIEGFNIPRD 597
 
 Query: 125 THVLVNAWAIGRDPECWDDPLSLKPYRF 152
            T V++N W + RDP+ W+D    KP RF
 Sbjct: 598 TIVIINGWGMQRDPQLWNDATCXKPERF 681
 
 
Rank 4>CON_001_05303 lcl|78002
            Length = 658
            
  Score =  100 bits (247), Expect = 1e-22
  Identities = 49/111 (44%), Positives = 71/111 (63%)
 
 Query: 28  KVFILELFLAGTETTSSSV*WALTELLRHPQAMAEVKTEISKVVGLNNKFEESDIENLPY 87
            K   LEL L GT++T+ ++ WAL+ LLR+P A+ + K EI   +G +    ESDI  L Y
 Sbjct: 284 KATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESDISKLVY 463
 
 Query: 88  MQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDP 138
            +QA++KE+LRL+PP PF  PRE  ++    G+ + KGT ++ N W I  DP
 Sbjct: 464 LQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHXDP 616
 
 
Rank 5>CON_001_08105 lcl|80804
            Length = 751
            
  Score = 84.3 bits (205), Expect = 1e-17
  Identities = 39/105 (37%), Positives = 69/105 (65%)
 
 Query: 5   LDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQAMAEVK 64
            +DV+L F G+ + E  ++    IK  +L++ L   +T+++ + W L+ELL++P+ M +V+
 Sbjct: 440 VDVMLGFVGSEEYE-YRIERPNIKAILLDMLLGSMDTSATVIEWTLSELLKNPRVMKKVQ 616
 
 Query: 65  TEISKVVGLNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRE 109
             E+  VVG+  K +ESD++ L Y+  V+KE++RLH   P LIP +
 Sbjct: 617 MELETVVGMQRKVKESDLDKLEYLDMVIKENMRLHXVAPLLIPHQ 751
 
 
Rank 6>CON_001_11558 lcl|84257
            Length = 754
            
  Score = 82.3 bits (200), Expect = 4e-17
  Identities = 36/101 (35%), Positives = 62/101 (60%)
 
 Query: 21  KLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQAMAEVKTEISKVVGLNNKFEES 80
            +++E  +   +  + +A  ETT  S+ W + EL+ HP+   +V+ EI +V+   ++  E 
 Sbjct: 447 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLEAGHQVTEP 626
 
 Query: 81  DIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDV 121
            DI+ LPY+QAV+KE+LRL   +P L+P   + D K  G+D+
 Sbjct: 627 DIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDI 749
 
 
Rank 7>CON_002_03058 lcl|75757
            Length = 664
            
  Score = 81.5 bits (198), Expect = 7e-17
  Identities = 38/75 (50%), Positives = 46/75 (60%)
 
 Query: 79  ESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDP 138
            ESDI NL Y+QAV+KE+ RL+ P P   PRE  +D    G+ V KGT ++ N W I  DP
 Sbjct: 28  ESDISNLVYLQAVVKETFRLYAPGPLSSPREFAEDCTLGGYHVKKGTRLITNIWKIHTDP 207
 
 Query: 139 ECWDDPLSLKPYRFL 153
              W DP   KP RFL
 Sbjct: 208 NVWSDPFEFKPDRFL 252
 
 
Rank 8>CON_002_03183 lcl|75882
            Length = 827
            
  Score = 79.6 bits (193), Expect = 3e-16
  Identities = 35/69 (50%), Positives = 46/69 (65%)
 
 Query: 85  LPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECWDDP 144
            L Y+QA++KE+LRL+PP PF  PRE  ++    G+ + KGT ++ N W I RDP  W DP
 Sbjct: 14  LVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSDP 193
 
 Query: 145 LSLKPYRFL 153
            L  KP RFL
 Sbjct: 194 LEFKPERFL 220
 
 

Rank 9>CON_001_12625 lcl|85324
            Length = 648
            
  Score = 61.7 bits (147), Expect = 7e-11
  Identities = 25/60 (41%), Positives = 38/60 (62%)
 
 Query: 93  KESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRF 152
            +E+LRL+PP P LIP  + +D    G ++ + T V++N W + RDP+ W+D    KP RF
 Sbjct: 11  EETLRLYPPAPILIPHVSSEDITIEGFNIPRDTIVIINGWGMQRDPQLWNDATCFKPERF 190
 
 
Rank 10>CON_001_02222 lcl|74921
            Length = 732
            
  Score = 57.4 bits (136), Expect = 1e-09
  Identities = 25/57 (43%), Positives = 39/57 (67%)
 
 Query: 97  RLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRFL 153
            R+ PP+P L+  ET +++   G+ +   +HV++N++AIGRD   W+DP S KP RFL
 Sbjct: 4   RVRPPIPLLL-HETAEESTVSGYYIPAKSHVIINSFAIGRDKNSWEDPDSFKPSRFL 171
 
 
Rank 11>CON_001_01574 lcl|74273
            Length = 721
            
  Score = 49.6 bits (116), Expect = 3e-07
  Identities = 20/47 (42%), Positives = 30/47 (63%)
 
 Query: 107 PRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRFL 153
            P     + K  G+++ KG+ V VN WA+GRDP+ W +PL  +P RF+
 Sbjct: 13  PHMAGNNVKVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFI 153
 
TRPHMAGNNVKVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFIEEDVDMKGHDY
KLLPFGAGRRICPGMNLAVNLVTSMLPHLLHHFVWALPNGVKAEDVDMMESPVTTTYMHP
PLPVAPTPRLSILLYHTCST*

 
Rank 12>CON_002_03426 lcl|76125
            Length = 860
            
  Score = 47.6 bits (111), Expect = 1e-06
  Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 7/114 (6%)
 
 Query: 36  LAGTETTSSSV*WALTELLRHPQAMAEVKTEISKVVGLNNKFEE-----SDIENLPYMQA 90
            LAG +TT  +  W +  L  +P+   +++ E+   V    + E       +++ + Y++A
 Sbjct: 302 LAGKDTTGDATSWLMHLLHENPRVENKLRAELLAKVPKLAEDESYVPPMEELDAITYLEA 481
 
 Query: 91  VLKESLRLHPPLPFLIPRETIQDTKFM-GHDVLKGTHVLVNAWAIGRDPECW-DDPLSLK 148
             ++ESLRL PP P  + +   QDT F  G  V KG    +   A    P  W  DPLS  
 Sbjct: 482 TIRESLRLKPPAP-CVTQHCTQDTVFPDGTFVPKGMDTTLLYHASALLPSVWGPDPLSST 658
 
 Query: 149 P 149
            P
 Sbjct: 659 P 661
 
 
Rank 13>CON_001_07041 lcl|79740
            Length = 678
            
  Score = 46.5 bits (108), Expect = 3e-06
  Identities = 18/51 (35%), Positives = 28/51 (54%)
 
 Query: 102 LPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRF 152
            +P L+P   + D K  G+D+   + +LVNAW +  +P  W  P   +P RF
 Sbjct: 18  IPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF 170
 
 
Rank 14>CON_001_11106 lcl|83805
            Length = 542
            
  Score = 41.0 bits (94), Expect = 1e-04
  Identities = 15/31 (48%), Positives = 20/31 (64%)
 
 Query: 123 KGTHVLVNAWAIGRDPECWDDPLSLKPYRFL 153
            +G  +L N W +GRDP+ WD P   +P RFL
 Sbjct: 14  EGALILFNVWQVGRDPKYWDRPSEFRPERFL 106
 
 
Rank 15>CON_001_13238 lcl|
            Length = 717
            
  Score = 39.9 bits (91), Expect = 3e-04
  Identities = 20/65 (30%), Positives = 38/65 (57%), Gaps = 3/65 (4%)
 
 Query: 6   DVLLEFEGT---GKDEPAKLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQAMAE 62
            D L E E     G+  P   ++ EI  ++ +   AG + ++SS+ WA+  L  HP+ +A+
 Sbjct: 86  DTLREIEEAKLAGETPPPFSTDAEIGGYLFDFLFAGQDASTSSLLWAVALLESHPEVLAK 265
 
 Query: 63  VKTEISKV 70
            V+ E++ +
 Sbjct: 266 VRAEVAGI 289
 
 
Rank 16>CON_001_10882 lcl|83581
            Length = 620
            
  Score = 33.6 bits (75), Expect = 0.019
  Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 
 Query: 85  LPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGRDPECW-DD 143
            LPY++A ++E+LRL+  +    P +    T   G  + K + V V  +A  R    W DD
 Sbjct: 53  LPYLEAAMRENLRLNTSMTTRSPNQ--DTTLSCGTFIPKNSVVCVCHYASARLKSTWGDD 226
 
 Query: 144 PLSLKPYRFL 153
                KP R+L
 Sbjct: 227 AAEYKPERWL 256
 
 
Rank 17>CON_001_02560 lcl|75259
            Length = 270
            
  Score = 29.7 bits (65), Expect = 0.28
  Identities = 18/53 (33%), Positives = 28/53 (51%)
 
48% to 74A at I-helix to EXXR region
 
RPPGQVQNIPFLVGINMFAGLNAFFPHLFRFVGEAGASLHTQLAKEIRTVIKEEGGAITL
SAINKMSLVKSVVYETLRLRPPVPRPRPR


Rank 18>CON_001_05188 lcl|77887
            Length = 621
            
  Score = 29.7 bits (65), Expect = 0.28
  Identities = 15/59 (25%), Positives = 31/59 (52%)
 
 Query: 27  IKVFILELFLAGTETTSSSV*WALTELLRHPQAMAEVKTEISKVVGLNNKFEESDIENL 85
            IK F+L +  AGTE + +++ WA   +L +P     +K   +  +   + + +SD+  +
 Sbjct: 402 IKSFVLTVIQAGTEASITTLIWATRLILNNPSV*KNLKQN*TFKLXKKDTYVKSDLSKV 578


Rank 2>CON_001_05303 lcl|78002
            Length = 658
            
  Score = 60.1 bits (143), Expect = 9e-10
  Identities = 48/153 (31%), Positives = 74/153 (47%), Gaps = 1/153 (0%)
 
 Query: 328 RDMLDIMLADL-GQATGVYEGDRRRVAADLLFYLLAGYDTTAHSIAWTVHALLDNPEAEA 386
            RD +D+M++ L G   G ++ D    A  L   +L G D+TA ++ W +  LL NP A  
 Sbjct: 209 RDFMDVMISALNGAQIGAFDADTICKATSLEL-ILGGTDSTAVTLTWALSLLLRNPLALG 385
 
 Query: 387 RLVAELKTALPPAGQPITAAHLSAMPYLDAVWKESLRLFPPAPNGTIRKLEADLRLPSNG 446
            +   E+   +    + I  + +S + YL A+ KE+LRL+PPAP  + R+   +  L   G
 Sbjct: 386 KAKEEIDMQIGK-DEYIRESDISKLVYLQAIVKETLRLYPPAPFSSPREFTENCIL--GG 556
 
 Query: 447 NVIPAGTVLHLPIIANHHNPTAYASPLAFDPTRW 480
              I  GT L   +   H +P        F  T W
 Sbjct: 557 YHIKKGTRLIHNLWKIHXDP-------MFGQTHW 637
 
 
Rank 3>CON_001_08105 lcl|80804
            Length = 751
            
  Score = 59.7 bits (142), Expect = 1e-09
  Identities = 36/102 (35%), Positives = 54/102 (52%)
 
 Query: 328 RDMLDIMLADLGQATGVYEGDRRRVAADLLFYLLAGYDTTAHSIAWTVHALLDNPEAEAR 387
            +D +D+ML  +G     Y  +R  + A LL  LL   DT+A  I WT+  LL NP    +
 Sbjct: 431 KDFVDVMLGFVGSEEYEYRIERPNIKAILLDMLLGSMDTSATVIEWTLSELLKNPRVMKK 610
 
 Query: 388 LVAELKTALPPAGQPITAAHLSAMPYLDAVWKESLRLFPPAP 429
            +  EL+T +    + +  + L  + YLD V KE++RL   AP
 Sbjct: 611 VQMELETVV-GMQRKVKESDLDKLEYLDMVIKENMRLHXVAP 733
 
 
Rank 4>CON_002_03426 lcl|76125
            Length = 860
            
  Score = 58.6 bits (139), Expect = 3e-09
  Identities = 53/150 (35%), Positives = 78/150 (51%), Gaps = 7/150 (4%)
 
 Query: 328 RDMLDIMLADLGQATG--VYEGDRRRVAADLLFYLLAGYDTTAHSIAWTVHALLDNPEAE 385
            +D++ I+L D   ATG  V   D   ++   L  +LAG DTT  + +W +H L +NP  E
 Sbjct: 209 KDIVSILL-DSEDATGEPVLPKDVFNIS---LAGVLAGKDTTGDATSWLMHLLHENPRVE 376
 
 Query: 386 ARLVAELKTALPPAGQPIT----AAHLSAMPYLDAVWKESLRLFPPAPNGTIRKLEADLR 441
             +L AEL   +P   +  +       L A+ YL+A  +ESLRL PPAP  T +    D  
 Sbjct: 377 NKLRAELLAKVPKLAEDESYVPPMEELDAITYLEATIRESLRLKPPAPCVT-QHCTQDTV 553
 
 Query: 442 LPSNGNVIPAGTVLHLPIIANHHNPTAYA-SPLAFDP 477
             P +G  +P G    L   A+   P+ +   PL+  P
 Sbjct: 554 FP-DGTFVPKGMDTTLLYHASALLPSVWGPDPLSSTP 661
 
ANHISLERFAVPMWVWKLKRWLNVGSERRLKEDMAVISSFVMSCISDAIERRKQRLEAAA
RGEPVGPVA
KDIVSILLDSEDATGEPVLPKDVFNISLAGVLAGKDTTGDATSWLMHLLHENPRVE 376
NKLRAELLAKVPKLAEDESYVPPMEELDAITYLEATIRESLRLKPPAPCVTQHCTQDTV 553
FPDGTFVPKGMDTTLLYHASALLPSVWGPDAAEFNPERFLDDNGKLLVLPPLKFIA
FRAGPRKCVGRKLAMIEMKVVTACLVSRFHLVEV
TGQDIRGTMGISLGMKNGMKVSVQATPGVAKRA*


Rank 11>CON_001_05919 lcl|78618
            Length = 383
            
  Score = 36.0 bits (81), Expect = 0.006
  Identities = 21/26 (80%), Positives = 21/26 (80%), Gaps = 2/26 (7%)
 
 Query: 213 PDPAEFNPERFW-DNGSLLVLPS-KFIA 238
            P  AEFNPERF  DNG LLVLP  KFIA
 Sbjct: 27  PAAAEFNPERFLDDNGKLLVLPPLKFIA 110



Rank 5>CON_002_03183 lcl|75882
            Length = 827
            
  Score = 51.5 bits (121), Expect = 3e-07
  Identities = 37/122 (30%), Positives = 53/122 (43%)
 
 Query: 413 YLDAVWKESLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPTAYASP 472
            YL A+ KE+LRL+PPAP  + R+   +  L   G  I  GT L   +   H +P+ ++ P
 Sbjct: 20  YLQAIVKETLRLYPPAPFSSPREFTENCIL--GGYHIKKGTRLIHNLWKIHRDPSVWSDP 193
 
 Query: 473 LAFDPTRWLXXXXXXXXXXXXXXQRAARTHFLAFHLGPRACPGQNMAAVEAKAMLSVLFH 532
            L F P R+L               R      L F  G R C G ++        L+ L H
 Sbjct: 194 LEFKPERFLTTHKDVDL-------RGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLH 352
 
 Query: 533 RY 534
             +
 Sbjct: 353 SF 358
 
 
Rank 6>CON_001_07479 lcl|80178
            Length = 716
            
  Score = 50.4 bits (118), Expect = 7e-07
  Identities = 32/123 (26%), Positives = 58/123 (47%)
 
 Query: 359 YLLAGYDTTAHSIAWTVHALLDNPEAEARLVAELKTALPPAGQPITAAHLSAMPYLDAVW 418
            +  AG D+TA +  W +  L++NP+   +   E+ + +    + +       +PY+ A+ 
 Sbjct: 296 FFSAGTDSTAVATEWALAELINNPKVLEKAREEVYSVVGK-DRLVDEVDTQNLPYIRAIV 472
 
 Query: 419 KESLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPTAYASPLAFDPT 478
            KE+ R+ PP P   + K +       NG VIP G ++   +     +P  +  P  F P 
 Sbjct: 473 KETFRMHPPLP---VVKRKCTEECEINGYVIPEGALILFNVWQVGRDPKYWDRPSEFRPE 643
 
 Query: 479 RWL 481
            R+L
 Sbjct: 644 RFL 652
 
 

Rank 7>CON_001_11558 lcl|84257
            Length = 754
            
  Score = 45.7 bits (106), Expect = 2e-05
  Identities = 24/64 (37%), Positives = 38/64 (58%)
 
 Query: 361 LAGYDTTAHSIAWTVHALLDNPEAEARLVAELKTALPPAGQPITAAHLSAMPYLDAVWKE 420
            +A  +TT  SI W +  L+++PE + ++  E+   L  AG  +T   +  +PYL AV KE
 Sbjct: 492 VAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLE-AGHQVTEPDIQKLPYLQAVVKE 668
 
 Query: 421 SLRL 424
            +LRL
 Sbjct: 669 TLRL 680
 
 
Rank 8>CON_001_01574 lcl|74273
            Length = 721
            
  Score = 45.3 bits (105), Expect = 2e-05
  Identities = 29/106 (27%), Positives = 44/106 (41%)
 
 Query: 432 TIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPTAYASPLAFDPTRWLXXXXXXXXXX 491
            T R   A   +   G  IP G+++H+ + A   +P  +  PL F P R++          
 Sbjct: 4   TTRPHMAGNNVKVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFIEEDVD----- 168
 
 Query: 492 XXXXQRAARTHFLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWS 537
                 +      L F  G R CPG N+A     +ML  L H + W+
 Sbjct: 169 ----MKGHDYKLLPFGAGRRICPGMNLAVNLVTSMLPHLLHHFVWA 294
 
 
Rank 9>CON_001_12625 lcl|85324
            Length = 648
            
  Score = 44.1 bits (102), Expect = 6e-05
  Identities = 32/123 (26%), Positives = 49/123 (39%)
 
 Query: 419 KESLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPTAYASPLAFDPT 478
            +E+LRL+PPAP         D+ +   G  IP  T++ +       +P  +     F P 
 Sbjct: 11  EETLRLYPPAPILIPHVSSEDITI--EGFNIPRDTIVIINGWGMQRDPQLWNDATCFKPE 184
 
 Query: 479 RWLXXXXXXXXXXXXXXQRAARTHFLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWSR 538
            R+                       +AF +G RACPG+ MA       L +L   + W R
 Sbjct: 185 RF--------------DVEGEEKKLVAFGMGRRACPGEPMAMQSVSFTLGLLIQCFDWKR 322
 
 Query: 539 VGD 541
            V +
 Sbjct: 323 VSE 331
 
 
Rank 10>CON_001_06635 lcl|79334
            Length = 706
            
  Score = 44.1 bits (102), Expect = 6e-05
  Identities = 26/73 (35%), Positives = 42/73 (56%), Gaps = 2/73 (2%)
 
 Query: 357 LFYLLAGYDTTAHSIAWTVHALLDNPEAEARLVAELKTALPPAGQP--ITAAHLSAMPYL 414
            L  L  G D++  ++ W++  LL++PE   +   EL T +   GQ   +  + L  +PYL
 Sbjct: 319 LAMLFGGTDSSTGTLEWSLSNLLNHPEVLKKARDELDTQV---GQDRLLNESDLPKLPYL 489
 
 Query: 415 DAVWKESLRLFPPAP 429
              +  E+LRL+PPAP
 Sbjct: 490 RKIILETLRLYPPAP 534
 
 
Rank 11>CON_001_10882 lcl|83581
            Length = 620
            
  Score = 41.4 bits (95), Expect = 4e-04
  Identities = 38/134 (28%), Positives = 58/134 (42%), Gaps = 1/134 (0%)
 
 Query: 408 LSAMPYLDAVWKESLRLFPPAPNGTIRKLEADLRLPSNGNVIPAGTVLHLPIIANHHNPT 467
            L  +PYL+A  +E+LRL     + T R    D  L S G  IP  +V+ +   A+    +
 Sbjct: 44  LGRLPYLEAAMRENLRL---NTSMTTRSPNQDTTL-SCGTFIPKNSVVCVCHYASARLKS 211
 
 Query: 468 AYASPLA-FDPTRWLXXXXXXXXXXXXXXQRAARTHFLAFHLGPRACPGQNMAAVEAKAM 526
             +    A + P RWL              ++ +   F+ F   PR C G   A +E + +
 Sbjct: 212 TWGDDAAEYKPERWLDPDTGKL-------RQFSPYQFVTFLAVPRQCIGMRFAMLELRMV 370
 
 Query: 527 LSVLFHRYRWSRVGD 541
             SVL  R+    V D
 Sbjct: 371 ASVLCSRFNIKTVED 415
 
 

Rank 12>CON_001_06134 lcl|78833
            Length = 371
            
  Score = 37.5 bits (85), Expect = 0.006
  Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 2/69 (2%)
 
 Query: 329 DMLDIMLADLGQATGVYEG--DRRRVAADLLFYLLAGYDTTAHSIAWTVHALLDNPEAEA 386
            +ML + L  + +++G  E   D   +   ++ +L+AG DTTA +++W    +  NP  E+
 Sbjct: 34  NMLSLYLDAIARSSGTDEQLYDPVHLRDVVVNFLVAGRDTTAQALSWFFFCVSQNPRVES 213
 
 Query: 387 RLVAELKTALP 397
            +L  E+   LP
 Sbjct: 214 KLRREIYKKLP 246
 
 
Rank 13>CON_001_13238 lcl|85937
            Length = 717
            
63% to 710A1
ARAEMSKTRMRTLGEEPSCLIDYWMQDTLREIEEAKLAGETPPPFSTDAEIGGY
LFDFLFAGQDASTSSLLWAVALLESHPEVLAKVRAEVAGIWSAESDELITADMLREMKY
LMTVAREVVRFRPPATLVPHVAEERLPLTESYTIPKGAIAFTSRFESPVQGVTE
PDRFDPDRVSDERQEDQIFNRHFLAFGTGPPRCTGQRTAVNHLVVLFALFTPVIDVKRDISHRCGEIAYA


Rank 14>CON_001_06449 lcl|79148
            Length = 332
            
  Score = 36.0 bits (81), Expect = 0.016
  Identities = 13/35 (37%), Positives = 22/35 (62%)
 
 Query: 503 FLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWS 537
            F++FH GPR C G   A +E K +L+ +  +Y ++
 Sbjct: 32  FVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHFT 136
 
 
Rank 15>CON_001_08203 lcl|80902
            Length = 619
            
  Score = 36.0 bits (81), Expect = 0.016
  Identities = 13/35 (37%), Positives = 22/35 (62%)
 
 Query: 503 FLAFHLGPRACPGQNMAAVEAKAMLSVLFHRYRWS 537
            F++FH GPR C G   A +E K +L+ +  +Y ++
 Sbjct: 67  FVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHFT 171
 
 
Rank 16>CON_001_05919 lcl|78618
            Length = 383
            
  Score = 33.6 bits (75), Expect = 0.082
  Identities = 13/32 (40%), Positives = 20/32 (61%)
 
 Query: 503 FLAFHLGPRACPGQNMAAVEAKAMLSVLFHRY 534
            F+AF  GPR C G+ +A +E K + + L  R+
 Sbjct: 102 FIAFRAGPRKCVGRKLAMIEMKVVTACLVSRF 197
 
 
Rank 17>CON_001_02222 lcl|74921
            Length = 732
            
PRVRPPIPLLLHETAEESTVSGYYIPAKSHVIINSFAIGRDKNSWEDPDSFKPSRFLKEG
VPDFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAVAHLLHCFTWELPDGMKPSELKMDDI
FGLTAPLANRLVAVPTPRLLCKLH*

Rank 18>CON_001_02560 lcl|75259
            Length = 270
            
  Score = 31.3 bits (69), Expect = 0.42
  Identities = 15/43 (34%), Positives = 25/43 (57%)
 
 Query: 387 RLVAELKTALPPAGQPITAAHLSAMPYLDAVWKESLRLFPPAP 429
            +L  E++T +   G  IT + ++ M  + +V  E+LRL PP P
 Sbjct: 125 QLAKEIRTVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVP 253


Rank 1>CON_001_07479 lcl|80178
            Length = 716
            
  Score = 57.0 bits (135), Expect = 7e-09
  Identities = 32/122 (26%), Positives = 63/122 (51%), Gaps = 2/122 (1%)
 
 Query: 284 GMIVAAMFAGQHTSSITTTWSMLHLMHPANVKHLEALRKEIEEFPAQLNYNNVMD--EMP 341
            G++V    AG  ++++ T W++  L++  N K LE  R+E+     +    + +D   +P
 Sbjct: 281 GLVVDFFSAGTDSTAVATEWALAELIN--NPKVLEKAREEVYSVVGKDRLVDEVDTQNLP 454
 
 Query: 342 FAERCARESIRRDPPLLMLMRKVMADVKVGSYVVPKGDIIACSPLLSHHDEEAFPEPRRW 401
            +     +E+ R  PPL ++ RK   + ++  YV+P+G +I  +      D + +  P  +
 Sbjct: 455 YIRAIVKETFRMHPPLPVVKRKCTEECEINGYVIPEGALILFNVWQVGRDPKYWDRPSEF 634
 
 Query: 402 DPER 405
             PER
 Sbjct: 635 RPER 646
 
 
Rank 2>CON_001_02478 lcl|75177
            Length = 721
            
  Score = 48.8 bits (114), Expect = 2e-06
  Identities = 34/129 (26%), Positives = 62/129 (47%), Gaps = 6/129 (4%)
 
 Query: 277 MSLHEVCGMIVAAMFAGQHTSSITTTWSMLHLMHPANVKHLEALRKEIEEFPAQLNYNNV 336
            +S HE+   I+    AG  T+S +  W++  L+     +H +A+ +   E    +  NN 
 Sbjct: 68  LSEHEIKVFILELFLAGTETTSSSV*WALTELL-----RHPQAMAEVKTEISKVVGLNNK 232
 
 Query: 337 MDE-----MPFAERCARESIRRDPPL-LMLMRKVMADVKVGSYVVPKGDIIACSPLLSHH 390
             +E     +P+ +   +ES+R  PPL  ++ R+ + D K   + V KG  +  +      
 Sbjct: 233 FEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGHDVLKGTHVLVNAWAIGR 412
 
 Query: 391 DEEAFPEPRRWDPER 405
            D E + +P    P R
 Sbjct: 413 DPECWDDPLSLKPYR 457
 
 
Rank 3>CON_002_03183 lcl|75882
            Length = 827
            
  Score = 39.1 bits (89), Expect = 0.002
  Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 10/107 (9%)
 
 Query: 339 EMPFAERCARESIRRDPPL-LMLMRKVMADVKVGSYVVPKGDIIACSPLLSHHDEEAFPE 397
            ++ + +   +E++R  PP      R+   +  +G Y + KG  +  +    H D   + +
 Sbjct: 11  KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSD 190
 
 Query: 398 PRRWDPER------DEKVEG---AFIGFGAGVHKCIGQKFGLLQVKTILATAFRSYD 445
            P  + PER      D  + G     + FG+G   C G   GL  V   LA    S+D
 Sbjct: 191 PLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFD 361
 
 
Rank 4>CON_001_01574 lcl|74273
            Length = 721
            
  Score = 38.3 bits (87), Expect = 0.003
  Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 7/71 (9%)
 
 Query: 367 DVKVGSYVVPKGDIIACSPLLSHHDEEAFPEPRRWDPER----DEKVEG---AFIGFGAG 419
            +VKVG Y +PKG I+  +      D + + EP ++ PER    D  ++G     + FGAG
 Sbjct: 31  NVKVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFIEEDVDMKGHDYKLLPFGAG 210
 
 Query: 420 VHKCIGQKFGLLQVKTIL 437
               C G    +  V ++L
 Sbjct: 211 RRICPGMNLAVNLVTSML 264
 
 
Rank 5>CON_002_03058 lcl|75757
            Length = 664
            
  Score = 37.9 bits (86), Expect = 0.004
  Identities = 29/91 (31%), Positives = 43/91 (46%), Gaps = 9/91 (9%)
 
 Query: 355 PPLLMLMRKVMADVKVGSYVVPKGDIIACSPLLSHHDEEAFPEPRRWDPER------DEK 408
            P  L   R+   D  +G Y V KG  +  +    H D   + +P  + P+R      D  
 Sbjct: 94  PGPLSSPREFAEDCTLGGYHVKKGTRLITNIWKIHTDPNVWSDPFEFKPDRFLTTHKDID 273
 
 Query: 409 VEG---AFIGFGAGVHKCIGQKFGLLQVKTILATAFRSYD 445
            V+G     + FG+G   C G  FGL  V   LA+   S++
 Sbjct: 274 VKGHHFQLLPFGSGRRVCPGISFGLQTVHLALASFLHSFE 393
 
 
Rank 6>CON_002_03426 lcl|76125
            Length = 860
            
  Score = 37.5 bits (85), Expect = 0.005
  Identities = 36/131 (27%), Positives = 59/131 (44%), Gaps = 7/131 (5%)
 
 Query: 274 GTPMSLHEVCGMIVAAMFAGQHTSSITTTWSMLHLMHP----ANVKHLEALRK--EIEEF 327
            G P+   +V  + +A + AG+ T+   T+W ++HL+H      N    E L K  ++ E 
 Sbjct: 251 GEPVLPKDVFNISLAGVLAGKDTTGDATSW-LMHLLHENPRVENKLRAELLAKVPKLAED 427
 
 Query: 328 PAQLNYNNVMDEMPFAERCARESIRRDPPLLMLMRKVMAD-VKVGSYVVPKGDIIACSPL 386
             + +     +D + + E   RES+R  PP   + +    D V      VPKG        
 Sbjct: 428 ESYVPPMEELDAITYLEATIRESLRLKPPAPCVTQHCTQDTVFPDGTFVPKG----MDTT 595
 
 Query: 387 LSHHDEEAFPEPRRWDPE 404
            L +H     P    W P+
 Sbjct: 596 LLYHASALLPSV--WGPD 643
 
 
Rank 7>CON_001_08203 lcl|80902
            Length = 619
            
  Score = 36.7 bits (83), Expect = 0.008
  Identities = 14/34 (41%), Positives = 21/34 (61%)
 
 Query: 413 FIGFGAGVHKCIGQKFGLLQVKTILATAFRSYDF 446
            F+ F AG   C+G +F +L++KT+LA     Y F
 Sbjct: 67  FVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHF 168
 
 
Rank 8>CON_001_06449 lcl|79148
            Length = 332
            
  Score = 36.7 bits (83), Expect = 0.008
  Identities = 14/34 (41%), Positives = 21/34 (61%)
 
 Query: 413 FIGFGAGVHKCIGQKFGLLQVKTILATAFRSYDF 446
            F+ F AG   C+G +F +L++KT+LA     Y F
 Sbjct: 32  FVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHF 133
 
 
Rank 9>CON_001_02403 lcl|75102
            Length = 368
            
  Score = 33.2 bits (74), Expect = 0.095
  Identities = 15/39 (38%), Positives = 21/39 (53%)
 
 Query: 413 FIGFGAGVHKCIGQKFGLLQVKTILATAFRSYDFQLLRD 451
            F  F  G   C+G KF L +VK  LA     +DF+ ++D
 Sbjct: 18  FSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKD 134

Rank 10>CON_001_09482 lcl|82181
            Length = 711
            
  Score =  113 bits (281), Expect = 5e-26
  Identities = 58/151 (38%), Positives = 97/151 (63%), Gaps = 11/151 (7%)
 
 Query: 63  LSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYDSS---V 119
            LS +HGP+  L+ GS+P VVAST E  K FL+THE    N   Q  A++ L YDS     
 Sbjct: 223 LSTRHGPIMQLFLGSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLF 402
 
 Query: 120 AMVPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEEL 179
            A  PFGPYWKF++KL M++LL+   +++  P+R Q+ ++F+  + +   A + +D  +EL
 Sbjct: 403 AFAPFGPYWKFMKKLCMSELLSGRMMDQFLPVRQQETKRFISRVFRKGVAGEAVDFGDEL 582
 
 Query: 180 LKWTNSTISMMML--------GEAEEIRDIAREVLKIFGEYS 213
            +  +N+ +S M L         +AEE++ +   + ++ G+++
 Sbjct: 583 MTLSNNIVSRMTLSQKTSENDNQAEEMKKLVPNIAQLMGKFN 708

MAYQVLLICLVSTIVFAYILWRKQSKKNLPPSPKALPIIGHLHLVSPIPHQDFYK
LSTRHGPIMQLFLGSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLF
AFAPFGPYWKFMKKLCMSELLSGRMMDQFLPVRQQETKRFISRVFRKGVAGEAVDFGDEL
MTLSNNIVSRMTLSQKTSENDNQAEEMKKLVPNIAQLMGKFND

Rank 17>CON_001_05652 lcl|78351
            Length = 752
            
  Score = 80.0 bits (194), Expect = 9e-16
  Identities = 49/169 (28%), Positives = 92/169 (53%), Gaps = 5/169 (2%)
 
 Query: 63  LSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYDSS-VAM 121
            L++K+GPL  L  G + T+V S+P++    ++TH+  +F  R Q  A + + Y ++ +A 
 Sbjct: 235 LARKYGPLMHLQLGEISTLVVSSPKMAMEIMKTHDL-AFVQRPQLLAPQYMAYGATDIAF 411
 
 Query: 122 VPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEELLK 181
             P+G YW+ +RK+   +LL+A  V     +R  + RK ++ +   + A  P+DL+ +L  
 Sbjct: 412 APYGEYWRQMRKICTLELLSAKRVQSFSHIRQDENRKLIQSIQ--SSAGSPIDLSSKLFS 585
 
 Query: 182 WTNSTISMMMLG----EAEEIRDIAREVLKIFGEYSLTDFIWPLKHLKVGKYEK 231
               +T+S    G    + +E   + R+ + + G + L D    LK L +   +K
 Sbjct: 586 LLGTTVSRAAFGNKNDDQDEFMSLVRKAVAMTGGFELDDMFPSLKPLHLLTXQK 747
90% with 81528

MEHSQLSIVITFFVFLLLLRLVKNHKPKSSHKLPPGPWKLPIIGNL
HQVALAASLPHHALQKLARKYGPLMHLQLGEISTLVVSSPKMAMEIMKTHDLAFVQRPQL
LAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKRVQSFSHIRQDENRKLIQSIQSS
AGSPIDLSSKLFSLLGTTVSRAAFGNKNDDQDEFMSLVRKAVAMTGGFELDDMFPSLKPL
HLLTXQKAX

Rank 19>CON_001_00979 lcl|73678
            Length = 717
            
  Score = 77.6 bits (188), Expect = 4e-15
  Identities = 46/134 (34%), Positives = 79/134 (58%), Gaps = 1/134 (0%)
 
 Query: 62  DLSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYD-SSVA 120
            DLS K+GP+  L FGS P VV S+ E+ K+FL+T +  +F  R +T+A +  TY+ S + 
 Sbjct: 179 DLSVKYGPIMQLQFGSFPVVVGSSVEMAKIFLKTMD-INFVGRPKTAAGKYTTYNYSDIT 355
 
 Query: 121 MVPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEELL 180
              P+G YW+  R++ + +L +A  ++    +R Q++   L  +     + KP+ L + L 
 Sbjct: 356 WSPYGSYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNL--NKLSGKPILLKDYLT 529
 
 Query: 181 KWTNSTISMMMLGEA 195
              + + IS M+LGE+
 Sbjct: 530 TLSLNVISRMVLGES 574

Rank 22>CON_002_03124 lcl|75823
            Length = 778
            
  Score = 69.9 bits (168), Expect = 1e-12
  Identities = 41/156 (26%), Positives = 86/156 (54%), Gaps = 9/156 (5%)
 
 Query: 63  LSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYDS-SVAM 121
            LSKK+GPLFSL FG  P +V S+P+L K  ++ ++      R +    ++LTY+   +  
 Sbjct: 54  LSKKYGPLFSLQFGLRPAIVVSSPKLAKEVMKDNDLECCG-RPKLLGQQKLTYNGLDMGF 230
 
 Query: 122 VPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEELLK 181
              +  YW+ +RK+ +  +L++  V     +R  ++++ ++ +++ A + K  +L E L+ 
 Sbjct: 231 SSYDSYWREIRKICVVHVLSSKRVQSFTSIRHFEVKQMIKKISRHASSSKVTNLNEVLIS 410
 
 Query: 182 WTNSTISMMMLG--------EAEEIRDIAREVLKIFGEYSLTDFI 218
              ++ +  ++LG        E      +  E   + G + ++D+I
 Sbjct: 411 LISTIVCRIVLGRRYEEEGSEGSRFHKLFNECEAMLGNFFVSDYI 545

RHLHQLDSPSLHEQLWH
LSKKYGPLFSLQFGLRPAIVVSSPKLAKEVMKDNDLECCGRPKLLGQQKLTYNGLDMGF 230
SSYDSYWREIRKICVVHVLSSKRVQSFTSIRHFEVKQMIKKISRHASSSKVTNLNEVLIS 410
LISTIVCRIVLGRRYEEEGSEGSRFHKLFNECEAMLGNFFVSDYIPFMGWIDKLRGLDAPS 545
LERNFKEMDKFYQEAIDEHMNSKKKTPEEEDLVDVLLQLK

Rank 25>CON_002_03081 lcl|75780
            Length = 716
            
  Score = 59.3 bits (141), Expect = 1e-09
  Identities = 40/148 (27%), Positives = 82/148 (55%), Gaps = 16/148 (10%)
 
 Query: 63  LSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYD-SSVAM 121
            +S+K+G + SL+FGS   VV S+P  ++     H+ T  N R ++ + + + YD ++V  
 Sbjct: 199 MSQKYGNIISLWFGSRLVVVVSSPTAYQECFTKHDVTLAN-RVRSLSGKYIFYDNTTVGS 375
 
 Query: 122 VPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQ-KPLDLTEELL 180
               G +W+ +R++   D+L+   V+    +R+ + ++ +  +A+ +      +++T +  
 Sbjct: 376 CSHGEHWRNLRRITSLDVLSTQRVHSFSGIRSDETKRLIHRLARDSGKDFARVEMTSKFA 555
 
 Query: 181 KWTNSTISMMMLG--------------EAEEIRDIAREVLKIFG 210
              T + I  M+ G              EA+E RD   E+L + G
 Sbjct: 556 DLTYNNIMRMISGKRFYGEESELNNVEEAKEFRDTVNEMLALMG 687

Rank 16>CON_001_00919 lcl|73618
            Length = 717
            
MTFIDLLLFCLIPFLFIFLIKFKKTSKNPISSNHKIPKSYPIIGSYFSLLANQEQ
RIQWISDIILSTPKLTFTLIRPLNFHTIFTANPSNVQHILKTNFSVYQKGHNSNSTLADF
LSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVESVVDIEVSERLIPILANAAAEKKVVD
IQDILQRFAFDNICKIAFGYDPEYLLPNLPEAEFAVAFEDCVRLSSERFILPFPLIW











Rank 2>CON_001_05652 lcl|78351
            Length = 752
            
  Score =  129 bits (320), Expect = 5e-31
  Identities = 67/164 (40%), Positives = 93/164 (55%), Gaps = 3/164 (1%)
 
 Query: 26  LPPGPKPWPIIGNLN---LIGSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMAKIF 82
            LPPGP   PIIGNL+   L  SL H ++  L+ KYGP+M LQ            +MA   
 Sbjct: 145 LPPGPWKLPIIGNLHQVALAASLPHHALQKLARKYGPLMHLQLGEISTLVVSSPKMAMEI 324
 
 Query: 83  LKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYEYIR 142
            +KT D+ FV RP+  A +Y  Y  +DI ++PYG YWRQ R++C +EL SAKR+ S+ +IR
 Sbjct: 325 MKTHDLAFVQRPQLLAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKRVQSFSHIR 504
 
 Query: 143 DQELHSILHNLNKLSGKPILLKDYLTTLSLNVISRMVLGESYLDVSE 189
              E   ++ ++   +G PI L   L +L    +SR   G    D  E
 Sbjct: 505 QDENRKLIQSIQSSAGSPIDLSSKLFSLLGTTVSRAAFGNKNDDQDE 645
 
 
Rank 3>CON_001_09482 lcl|82181
            Length = 711
            
  Score =  121 bits (300), Expect = 1e-28
  Identities = 72/194 (37%), Positives = 108/194 (55%), Gaps = 5/194 (2%)
 
 Query: 20  RQRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMA 79
            +Q K NLPP PK  PIIG+L+L+  + H+  + LS ++GPIMQL             E A
 Sbjct: 124 KQSKKNLPPSPKALPIIGHLHLVSPIPHQDFYKLSTRHGPIMQLFLGSVPCVVASTAEAA 303
 
 Query: 80  KIFLKTMDINFVGRP-KTAAGKYTTYNYSD--ITWSPYGSYWRQARRMCLMELFSAKRLD 136
            K FLKT +INF  RP +  A K   Y+  D    ++P+G YW+  +++C+ EL S + +D
 Sbjct: 304 KEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLFAFAPFGPYWKFMKKLCMSELLSGRMMD 483
 
 Query: 137 SYEYIRDQELHSILHNLNK--LSGKPILLKDYLTTLSLNVISRMVLGESYLDVSENSIVT 194
             +  +R QE    +  + +  ++G+ +   D L TLS N++SRM L +     SEN    
 Sbjct: 484 QFLPVRQQETKRFISRVFRKGVAGEAVDFGDELMTLSNNIVSRMTLSQK---TSEND-NQ 651
 
 Query: 195 PDEFKKNVDELFLLNGALN 213
             +E KK V  +  L G  N
 Sbjct: 652 AEEMKKLVPNIAQLMGKFN 708
 
 
Rank 4>CON_001_08829 lcl|81528
            Length = 740
            
  Score =  108 bits (266), Expect = 1e-24
  Identities = 54/149 (36%), Positives = 83/149 (55%)
 
 Query: 41  LIGSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMAKIFLKTMDINFVGRPKTAAGK 100
            L  SL  +++  L  KYGP+M LQ            +MA   +KT D++FV RP+  A +
 Sbjct: 26  LAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQ 205
 
 Query: 101 YTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNKLSGKP 160
            +  Y  +DI ++PYG YWRQ R++C +EL SAKR+ S+ +IR  E   ++ +++  +G P
 Sbjct: 206 FMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGSP 385
 
 Query: 161 ILLKDYLTTLSLNVISRMVLGESYLDVSE 189
            I L   L +L    +SR   G+   D  E
 Sbjct: 386 IDLSGKLFSLLGTTVSRAAFGKENDDQDE 472
 
 
Rank 5>CON_002_03081 lcl|75780
            Length = 716
            
  Score =  103 bits (254), Expect = 3e-23
  Identities = 65/194 (33%), Positives = 100/194 (51%), Gaps = 6/194 (3%)
 
 Query: 20  RQRKL-NLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEM 78
            R RK+ NLPPGP P PIIGNLNL+    HR    +S KYG I+ L               
 Sbjct: 97  RSRKVRNLPPGPTPLPIIGNLNLVEQPIHRFFLRMSQKYGNIISLWFGSRLVVVVSSPTA 276
 
 Query: 79  AKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSY 138
             +      D+    R ++ +GKY  Y+ + +    +G +WR  RR+  +++ S +R+ S+
 Sbjct: 277 YQECFTKHDVTLANRVRSLSGKYIFYDNTTVGSCSHGEHWRNLRRITSLDVLSTQRVHSF 456
 
 Query: 139 EYIRDQELHSILHNLNKLSGKP---ILLKDYLTTLSLNVISRMVLGES-YLDVSE-NSIV 193
              IR  E   ++H L + SGK    + +      L+ N I RM+ G+  Y + SE N++ 
 Sbjct: 457 SGIRSDETKRLIHRLARDSGKDFARVEMTSKFADLTYNNIMRMISGKRFYGEESELNNVE 636
 
 Query: 194 TPDEFKKNVDELFLLNGALN 213
               EF+  V+E+  L G  N
 Sbjct: 637 EAKEFRDTVNEMLALMGLAN 696
 
MTVITMPPFLSYSLLSLAFFFTLKYLFQ
RSRKVRNLPPGPTPLPIIGNLNLVEQPIHRFFLRMSQKYGNIISLWFGSRLVVVVSSPTA 276
YQECFTKHDVTLANRVRSLSGKYIFYDNTTVGSCSHGEHWRNLRRITSLDVLSTQRVHSF 456
SGIRSDETKRLIHRLARDSGKDFARVEMTSKFADLTYNNIMRMISGKRFYGEESELNNVE 636
EAKEFRDTVNEMLALMGLANKGDHLP

Rank 2>CON_004_04406 lcl|77105
            Length = 723
            
  Score =  297 bits (752), Expect = 1e-81
  Identities = 150/199 (75%), Positives = 173/199 (86%), Gaps = 3/199 (1%)
 
 Query: 23  LKYLFQRSRKVRXXXXXXXXXXXXXXLNLVEQPIHRFFLRMSQKYGNIISLWFGSRLVVV 82
            +K++FQ SRK+R              LNL+EQPIHRFF RMS++YGN++SLWFGSRL VV
 Sbjct: 119 VKFVFQ-SRKLRNIPPGPPPLPIIGNLNLLEQPIHRFFQRMSKQYGNVVSLWFGSRLAVV 295
 
 Query: 83  VSSPTAYQECFTKHDVTLANRVRSLSGKYIFYDNTTVGSCSHGEHWRNLRRITSLDVLST 142
            +SSPTAYQECFTKHDV LANR+ SLSGKYIFY+NTTVGSCSHGEHWRNLRRIT+LDVLST
 Sbjct: 296 ISSPTAYQECFTKHDVALANRLPSLSGKYIFYNNTTVGSCSHGEHWRNLRRITALDVLST 475
 
 Query: 143 QRVHSFSGIRSDETKRLIHR--LARDSG-KDFARVEMTSKFADLTYNNIMRMISGKRFYG 199
            QRVHSFSGIRSDETKRL+ R  LA++S  ++FARVE++S F DLTYNNIMRMISGKRFYG
 Sbjct: 476 QRVHSFSGIRSDETKRLMQRLVLAKNSNEEEFARVEISSMFNDLTYNNIMRMISGKRFYG 655
 
 Query: 200 EESELNNVEEAKEFRDTVNEML 221
            EESE+ NVEEA+EFR+TV  ML
 Sbjct: 656 EESEMKNVEEAREFRETVTXML 721

MGMLLVVVSYAVLFLVLFLG
VKFVFQSRKLRNIPPGPPPLPIIGNLNLLEQPIHRFFQRMSKQYGNVVSLWFGSRLAVV 295
ISSPTAYQECFTKHDVALANRLPSLSGKYIFYNNTTVGSCSHGEHWRNLRRITALDVLST 475
QRVHSFSGIRSDETKRLMQRLVLAKNSNEEEFARVEISSMFNDLTYNNIMRMISGKRFYG 655
EESEMKNVEEAREFRETVTEMLELMGLANKGDHLPFLRWFDFQNVEKRLKSISKRYD
SILNKILHENRASNDRQNSMIDHLLKLQETQPQYYTDQIIKGLALAMLFGGTDSSTGTLE
WSLSNLLNHPEVLKKARDELDTQVGQDRLLNESDLPKLPYLRKIILETLRLYPPAPILIP
HVSSEDITIEGFNIPRDTIVIINGWGMQRDPQLWNDATCFKPERFDVEGEEKK
LVAFGMGRRACPGEPMAMQSVSFTLGLLIQCFDWKRVSEEKLDMTENNWIT
LSRLIPLEAMCKARPLATKIGI*

Rank 6>CON_002_03124 lcl|75823
            Length = 778
            
  Score = 87.4 bits (213), Expect = 2e-18
  Identities = 46/138 (33%), Positives = 75/138 (54%), Gaps = 2/138 (1%)
 
 Query: 47  HRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMAKIFLKTMDINFVGRPKTAAGKYTTYNY 106
            H  +  LS KYGP+  LQ            ++AK  +K  D+   GRPK    +  TYN 
 Sbjct: 36  HEQLWHLSKKYGPLFSLQFGLRPAIVVSSPKLAKEVMKDNDLECCGRPKLLGQQKLTYNG 215
 
 Query: 107 SDITWSPYGSYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNK--LSGKPILLK 164
             D+ +S Y SYWR+ R++C++ + S+KR+ S+  IR  E+  ++  +++   S K   L 
 Sbjct: 216 LDMGFSSYDSYWREIRKICVVHVLSSKRVQSFTSIRHFEVKQMIKKISRHASSSKVTNLN 395
 
 Query: 165 DYLTTLSLNVISRMVLGESY 184
            + L +L   ++ R+VLG  Y
 Sbjct: 396 EVLISLISTIVCRIVLGRRY 455
 
 
Rank 7>CON_004_04406 lcl|77105
            Length = 723
            
  Score = 83.9 bits (204), Expect = 2e-17
  Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 9/183 (4%)
 
 Query: 20  RQRKL-NLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEM 78
            + RKL N+PPGP P PIIGNLNL+    HR    +S +YG ++ L               
 Sbjct: 134 QSRKLRNIPPGPPPLPIIGNLNLLEQPIHRFFQRMSKQYGNVVSLWFGSRLAVVISSPTA 313
 
 Query: 79  AKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSY 138
             +      D+    R  + +GKY  YN + +    +G +WR  RR+  +++ S +R+ S+
 Sbjct: 314 YQECFTKHDVALANRLPSLSGKYIFYNNTTVGSCSHGEHWRNLRRITALDVLSTQRVHSF 493
 
 Query: 139 EYIRDQELHSILH------NLNKLSGKPILLKDYLTTLSLNVISRMVLGES-YLDVSE-N 190
              IR  E   ++       N N+     + +      L+ N I RM+ G+  Y + SE  
 Sbjct: 494 SGIRSDETKRLMQRLVLAKNSNEEEFARVEISSMFNDLTYNNIMRMISGKRFYGEESEMK 673
 
 Query: 191 SIVTPDEFKKNV 202
            ++    EF++ V
 Sbjct: 674 NVEEAREFRETV 709
 
 
Rank 8>CON_002_03707 lcl|76406
            Length = 788
            
  Score = 79.2 bits (192), Expect = 5e-16
  Identities = 53/162 (32%), Positives = 90/162 (54%), Gaps = 5/162 (3%)
 
 Query: 22  RKLNLPPGPKP-WPIIGNLNLI-GSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMA 79
            R L  PP PKP  P IG+L+L+   L H ++ DLS K+GP+  L             E+ 
 Sbjct: 67  RHLPNPPSPKPRLPFIGHLHLLKDKLLHYALIDLSKKHGPLFSLYFGSMPTVVASTPELF 246
 
 Query: 80  KIFLKTMDI-NFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSY 138
            K+FL+T +  +F  R +T+A +  TY+ S +   P+G YW+  R++ + +L +A  ++  
 Sbjct: 247 KLFLQTHEATSFNTRFQTSAIRRLTYD-SSVAMVPFGPYWKFVRKLIMNDLLNATTVNKL 423
 
 Query: 139 EYIRDQELHSILHNL--NKLSGKPILLKDYLTTLSLNVISRMVLGES 183
              +R Q++   L  +     + KP+ L + L   + + IS M+LGE+
 Sbjct: 424 RPLRTQQIRKFLRVMAQGAEAQKPLDLTEELLKWTNSTISMMMLGEA 564
 
 
Rank 9>CON_001_12458 lcl|85157
            Length = 726
            
  Score = 78.0 bits (189), Expect = 1e-15
  Identities = 43/136 (31%), Positives = 68/136 (49%), Gaps = 1/136 (0%)
 
 Query: 20  RQRKLNLPPGPKPWPIIGNLNLIGS-LAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEM 78
            R RK  LPPGP P PI GN   +G  L HR++ DL+ K+G I  L+            E+
 Sbjct: 124 RGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPEL 303
 
 Query: 79  AKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSY 138
            AK  L T  + F  R +       T    D+ ++ YG +WR+ RR+  +  F+ K +  Y
 Sbjct: 304 AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQY 483
 
 Query: 139 EYIRDQELHSILHNLNK 155
             +  + E  +++ ++ K
 Sbjct: 484 RHGWESEAAAVVEDVKK 534
 
MDLLLLEKTLIGLFLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWL
QVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVF
DIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRHGWESEAAAVVEDVKKNPDA
AVSGTVIRRRLQLMMYNNMYRIMFDRRFESEEDPIFQRLRALNGERSRLAQSFEYNYGDF
IPILRPFLKGYLKICKEVKETRLKLFKDYFVDERKK
LGSIKSSNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELV
NHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDA
KLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEES
LVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGG
QFSLHILKHSTIVAKPRSF*

Rank 10>CON_001_12049 lcl|84748
            Length = 525
            
  Score = 77.3 bits (187), Expect = 2e-15
  Identities = 41/116 (35%), Positives = 59/116 (50%), Gaps = 2/116 (1%)
 
 Query: 33  WPIIGNLNLI--GSLAHRSIHDLSVKYGPIMQLQXXXXXXXXXXXXEMAKIFLKTMDINF 90
            WPIIG+L L+      H+++ DL+ KYGPI  ++            EMAK    T DI  
 Sbjct: 164 WPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAV 343
 
 Query: 91  VGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYEYIRDQELHS 148
               P   +     YN S I  +PYG YWRQ R++ + E  S  R++   ++R  E+ S
 Sbjct: 344 SSLPDLISANLLCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQS 517
 
MELVLNSTTIGVGVVSLILLLYLFLRGGSWKSGEEGPPTVAGAWPIIGHLPLLL
GSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAVSSLPDLISANL
LCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSI
 
Rank 11>CON_001_02056 lcl|74755
            Length = 723
            
MAKLANKMTIYSTSLYNNIYFHIQNHYQFPLNNISLGVLPILPLIFYFLYANKSQNT
LPPGPRPVPIFGNWLQVGNDLNHRLLSTMSQTYGPIFLLKLESKNLTVVSNPELTNQVLHTQGVEFGSRT
RNVVLDIFTANGQDTV
SQTYGDHWRTMRRIMTVPFFTNKVGHQYSDMWENEMDLLVDDSKKLKNEGIAIKRRQQLMLYNIMYKMMFDD
ILESLDDPLLIEEP

>_1
                              PRVRKLKKHGQIS*QNDHIFHFSLQ*YLLSYSKSLSVPSQ*HFTWCTPYTSPYFLLPLCQ
                              QIPKHPPSGPTARPDFRQLASSR*RLEP*TPIDHVTNLWSDIFTQTRVKKLNCCIEP*AN
                              *SSPTHTRG*VRVTYHVTLCSIYLRRMDKTRCLTIYGDHWRTMRRIMTVPFFTNKVGHQY
                              SDMWENEMDLLVDDSKKLKNEGIAIKRRQQLMLYNIMYKMMFDDILESLDDPLLIEEP
                              >_2
                              HASAN*KNMAKLANKMTIYSTSLYNNIYFHIQNHYQFPLNNISLGVLPILPLIFYFLYAN
                              KSQNTLPPGPRPVPIFGNWLQVGNDLNHRLLSTMSQTYGPIFLLKLESKNLTVVSNPELT
                              NQVLHTQGVEFGSRTT*RCARYIYGEWTRHGVSQYMVTIGEQ*DVS*QYHFSLIKWGTNI
                              VICGKMKWTYLLMTRKN*KMKELL*RDVSS*CYIILCIR*CSMTY*SL*MILCLLKN
                              >_3
                              TRPQIKKTWPN*LTK*PYIPLLFTIISTFIFKITISSLSITFHLVYSLYFPLFSTSSMPT
                              NPKTPSLRAHGPSRFSAIGFKSVTT*TIDSYRPCHKPMVRYFYSNSSQKT*LLYRTLS*L
                              IKSYTHKGLSSGHVPRNVVLDIFTANGQDTVSHNIW*PLANNETYHDSTIFH**SGAPI*
                              *YVGK*NGPTC**LEKIEK*RNCYKETSAVDAI*YYV*DDVR*HIRVSR*SFAY*RT

Rank 12>CON_001_08284 lcl|80983
            Length = 754
            
MEEAWFIILVSLCVCVLIRVILLFFLHKKTLAT
PPGPPHIPIITSFLWLKKSFIELEPFLRTLAAKHGPIFTLRIGSRPVIFIANRALAHQAL
IQNGSIFSDRPKALPAAKIVSSNQHNINSAPYGATWRALRRNLASEMLHPSRVMSFSGTR
KWVLHTLLTRLKSDSQSNDSIKVINHFQYSMFCLLVFMCFGERLDDGKVRDIERVQRQML
LRFRRFNVLNFWPRVTRVLFFKLWE

 
Rank 13>CON_001_08105 lcl|80804
            Length = 751
            
  Score = 40.2 bits (92), Expect = 3e-04
  Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 
 Query: 123 RMCLMELFSAKRLDSYEYIRDQELHSILHNLNKLSGKPILLKDY---LTTLSLNVISRMV 179
            +MC +EL S  +++S+  +R++EL   +  L + S       D    +  +S +V  RMV
 Sbjct: 14  KMCTLELLSQTKINSFRIVREEELDLSIKLLREASNDGAAAVDISAKVARISADVACRMV 193
 
 Query: 180 LGESYLD 186
            LG+ Y+D
 Sbjct: 194 LGKKYMD 214
 
 
Rank 14>CON_001_12433 lcl|85132
            Length = 750
            
  Score = 37.5 bits (85), Expect = 0.002
  Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 
 Query: 22  RKLNLPPGPKP-WPIIGNLNLIGS-LAHRSIHDLSVKYGPIMQL 63
            R L  PP PKP  P IG+L+L+   L H ++ DLS K+GP+  L
 Sbjct: 573 RHLPNPPSPKPRLPFIGHLHLLXDKLLHYALIDLSKKHGPLFSL 704
 







Rank 2>CON_001_00979 lcl|73678
            Length = 717
            
  Score =  136 bits (340), Expect = 2e-33
  Identities = 81/216 (37%), Positives = 124/216 (56%), Gaps = 4/216 (1%)
 
 Query: 2   AYQVLLICLVSTIVFAYILWRKQSKKNLPPSPKALPIIGHLHLVSPIPHQDFYKLSTRHG 61
            AY  + +  +  ++ +  L  +Q K NLPP PK  PIIG+L+L+  + H+  + LS ++G
 Sbjct: 26  AYAAVFLATLFLLLLSKFL--RQRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYG 199
 
 Query: 62  PIMQLFLGSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLFAFAPFG 121
            PIMQL  GS P VV S+ E AK FLKT +INF  RP +  A K   Y+  D    ++P+G
 Sbjct: 200 PIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFVGRP-KTAAGKYTTYNYSD--ITWSPYG 370
 
 Query: 122 PYWKFMKKLCMSELLSGRMMDQFLPVRQQETKRFISRVFRKGVAGEAVDFGDELMTLSNN 181
             YW+  +++C+ EL S + +D +  +R QE    +  + +  ++G+ +   D L TLS N
 Sbjct: 371 SYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNK--LSGKPILLKDYLTTLSLN 544
 
 Query: 182 IVSRMTLSQK---TSEND-NQAEEMKKLVPNIAQLMGKFN 217
            ++SRM L +     SEN     +E KK V  +  L G  N
 Sbjct: 545 VISRMVLGESYLDVSENSIVTPDEFKKNVDELFLLNGALN 664

HASATWTAYAAVFLATLFLLLLSKFLRQRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYG
PIMQLQFGSFPVVVGSSVEMAKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYG
SYWRQARRMCLMELFSAKRLDSYEYIRDQELHSILHNLNKLSGKPILLKDYLTTLSLN 
VISRMVLGESYLDVSENSIVTPDEFKKNVDELFLLNGALNMEINSLVGFMDLQAMLP




41 accessions 28 contigs at least 15 different C-terminals
beware some of these are from infected soybean hypocotyls not phytophthora
need to check each library

73618 #10 N-terminal
73678 #5 N-terminal 
74273 #11 C-term PKG to end 64% to CYP98A3
74755 #13 N-term
74921 #12 = #3 C-term PKG to end 75% to 84A1
75102 #14 BE775645 C-term Heme to end
75177 #15 C-term half 48% to 76C1
75259 #16 I-helix to EXXR 48% to 74A
75757 #17 EXXR to end
75780 #6 N-term
75823 #9 N-term
75882 #2 = 78002 BE583529.1
76125 #3 C-term half 39% to 94D2
76406 #1 complete 38% to 705As
77105 #7 complete 51% to 81D3
77887 #18 From aa 177 to the I-helix AGTEAS
78002 #2 = 75882 BE583529.1
78351 #19 N-term 90% with 81528
78618 #3 = #12 C-term PKG to end 75% to 84A1
78833 #21 I-helix region
79148 #22 heme to end 
79334 #7 complete 51% to 81D3
79740 #8 complete 84% to 73A5 (contamination with plant cDNA?)
   99% to glycine max CYP73 has to be a contamination
80178 #1 complete 38% to 705As
80804 #23  36% to 71A23 from about 125 to EXXR
80902 #22 heme to end
80983 #24 N-term 238 aa
81528 #20 N-term 90% to 78351
81975 #1 complete 38% to 705As
82181 #4 N-term 218 aa
82729 #25 PERF to end
83581 #26 EXXR to end
83795 #1 complete 38% to 705As
83805 #1 complete 38% to 705As
84257 #8 complete 84% to 73A5 (contamination with plant cDNA?)
84748 #27 N-term to C-helix
85157 #8 complete 84% to 73A5 (contamination with plant cDNA?)
85132 #1 complete 38% to 705As
85324 #7 complete 51% to 81D3
85644 #29 N-term might be a pseudogene many fs and stops
85937 #28 C-term 63% to 710A1

>74273 64% to CYP98A3
TRPHMAGNNVKVGGYNIPKGSIVHVNVWALGRDPKIWKEPLQFRPERFIEEDVDMKGHDY
KLLPFGAGRRICPGMNLAVNLVTSMLPHLLHHFVWALPNGVKAEDVDMMESPVTTTYMHP
PLPVAPTPRLSILLYHTCST*

>74921 = 78618 75% to 84A1
PRVRPPIPLLLHETAEESTVSGYYIPAKSHVIINSFAIGRDKNSWEDPDSFKPSRFLKEG
VPDFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAVAHLLHCFTWELPDGMKPSELKMDDI
FGLTAPLANRLVAVPTPRLLCKLH*

>75102
DPRVLFSVFFGGPRICLGMKFALAEVKITLAKLLSQFDFKTVKDPFDFTYRPSITLQINGPLDVVVSRLNV*

>75177 48% to 76C1
5   PRVRLDVLLEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTSSSV*WALTELLRHPQ 178
179 AMAEVKTEISKVVGLNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKF 352
353 MGHDVLKGTHVLVNAWAIGRDPECWDDPLSLKPYRFLGSLDGKGQPYELILFGARRRM
XPGNLQAPRKTPSPLRIPALMNFYWNFPRRCAPPHPTTTGRISLVLPPRTPTAAGRDDRSTA*
 
>75259 48% to 74A 
RPPGQVQNIPFLVGINMFAGLNAFFPHLFRFVGEAGASLHTQLAKEIRTVIKEEGGAITL
SAINKMSLVKSVVYETLRLRPPVPRPRPR

>75757 58% to CYP82C3
TRKDRCICESDISNLVYLQAVVKETFRLYAPGPLSSPREFAEDCTLGGYHVKKGTRLITN
IWKIHTDPNVWSDPFEFKPDRFLTTHKDIDVKGHHFQLLPFGSGRRVCPGISFGLQTVHL
ALASFLHSFEILNPSTEPLDMTEAFGVTNTKATPLEVLVKPCLSPSCYKSM*

>75882 51% to 82C3 
QRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKK
LLGENVESDRDFMDVMISALNGAQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLL
LRNPLALGKAKEEIDMQIGKDEYIRESDIS
KLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSV
WSDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFD
ILNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPNYYETL* 

>76125 39% to 94D2
ANHISLERFAVPMWVWKLKRWLNVGSERRLKEDMAVISSFVMSCISDAIERRKQRLEAAA
RGEPVGPVA
KDIVSILLDSEDATGEPVLPKDVFNISLAGVLAGKDTTGDATSWLMHLLHENPRVE 376
NKLRAELLAKVPKLAEDESYVPPMEELDAITYLEATIRESLRLKPPAPCVTQHCTQDTV 553
FPDGTFVPKGMDTTLLYHASALLPSVWGPDAAEFNPERFLDDNGKLLVLPPLKFIA
FRAGPRKCVGRKLAMIEMKVVTACLVSRFHLVEV
TGQDIRGTMGISLGMKNGMKVSVQATPGVAKRA*

>80178 38% to 705As
MLLELALGLFVLALFLHLRPTPSAKSKALRHLPNPPSPKPRLPFIGHLHLLXDKLLHYALIDLSKKHG
PLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYDSSVAMVPFGPYW
KFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLDLTEELLKWTNSTIS
MMMLGEAEEIRDIAREVLKIFGEYSLTDFIWPLKHLKVGKYEKRIDDILNKFDP
VVERVIKKRREIVRRRKNGEVVEGEVSG
VFLDTLLEFAEDETMEIKITKDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVL 
EKAREEVYSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYV 
IPEGALILFNVWQVGRDPKYWDRPSEFRPERFL 
ETGAEGEAGPLDLRGQHFQLLPFGSGRRMCPGVNLATSGMATLLASLIQCFDLQVLGPQGQIL
KGGDAKVSMEERAGLTVPRAHSLVCVPLARIGVASKLLS*

>77105 51% to 81D3
MGMLLVVVSYAVLFLVLFLG
VKFVFQSRKLRNIPPGPPPLPIIGNLNLLEQPIHRFFQRMSKQYGNVVSLWFGSRLAVV 295
ISSPTAYQECFTKHDVALANRLPSLSGKYIFYNNTTVGSCSHGEHWRNLRRITALDVLST 475
QRVHSFSGIRSDETKRLMQRLVLAKNSNEEEFARVEISSMFNDLTYNNIMRMISGKRFYG 655
EESEMKNVEEAREFRETVTEMLELMGLANKGDHLPFLRWFDFQNVEKRLKSISKRYD
SILNKILHENRASNDRQNSMIDHLLKLQETQPQYYTDQIIKGLALAMLFGGTDSSTGTLE
WSLSNLLNHPEVLKKARDELDTQVGQDRLLNESDLPKLPYLRKIILETLRLYPPAPILIP
HVSSEDITIEGFNIPRDTIVIINGWGMQRDPQLWNDATCFKPERFDVEGEEKK
LVAFGMGRRACPGEPMAMQSVSFTLGLLIQCFDWKRVSEEKLDMTENNWIT
LSRLIPLEAMCKARPLATKIGI*

>79148 42% to CYP704A2
LMQDPWTGEQTIRPVSAFQFVSFHAGPRTCLGMRFAMLEMKTVLAYMLSKYHFTTRENPK
SYTYDVASLLQVKGPLICKVQRAG* 

>85157 99% to glycine max CYP73 from soybean hypocotyl not phytophthora
MDLLLLEKTLIGLFLAAVVAIAVSTLRGRKFKLPPGPLPVPIFGNWL
QVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVF
DIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRHGWESEAAAVVEDVKKNPDA
AVSGTVIRRRLQLMMYNNMYRIMFDRRFESEEDPIFQRLRALNGERSRLAQSFEYNYGDF
IPILRPFLKGYLKICKEVKETRLKLFKDYFVDERKK
LGSIKSSNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELV
NHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDA
KLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEES
LVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGG
QFSLHILKHSTIVAKPRSF*

>82729 55% to CYP82C3
FKPERFLTTDKDIDMKGQHFQLLPFGGGRRICPVINLGLQTVRLTLASFLHS
FEILNPSTEPLDMTEVFTATNTKATPLEILIKPRLSPTCYESI*

>83581 38% to 86A2
ARGEIDAPSMEQLGRLPYLEAAMRENLRLNTSMTTRSPNQDTTLSCGTFIPKNSVVCVCH
YASARLKSTWGDDAAEYKPERWLDPDTGKLRQFSPYQFVTFLAVPRQCIGMRFAMLELRM
VASVLCSRFNIKTVEDPFSLTYELSTVFPVKGRLMCTVESSGLAVSS* 

>85937 63% to 710A1
ARAEMSKTRMRTLGEEPSCLIDYWMQDTLREIEEAKLAGETPPPFSTDAEIGGY
LFDFLFAGQDASTSSLLWAVALLESHPEVLAKVRAEVAGIWSAESDELITADMLREMKY
LMTVAREVVRFRPPATLVPHVAEERLPLTESYTIPKGAIAFTSRFESPVQGVTE
PDRFDPDRVSDERQEDQIFNRHFLAFGTGPPRCTGQRTAVNHLVVLFALFTPVIDVKRDISHRCGEIAYA

Alignment if the C-terminal parts

16    238
74273      ---------- ---------- ---------- ---------- ---------- 
74921      ---------- ---------- ---------- ---------- ---------- 
75102      ---------- ---------- ---------- ---------- ---------- 
75177      IKVFILELFL AGTETTSSSV -WALTELLRH PQAMAEVKTE ISKVVG---- 
75259      IPFLVGINMF AGLNAFFPHL -FRFVGEAGA SLHTQLAKEI RTVIKE---- 
75757      ---------- ---------- ---------- ---------- ----T----- 
75882      CKATSLELIL GGTDSTAVTL TWALSLLLRN PLALGKAKEE IDMQI----- 
76125      VFNISLAGVL AGKDTTGDAT SWLMHLLHEN PRVENKLRAE LLAKVPKLAE 
80178      IKGLVVDFFS AGTDSTAVAT EWALAELINN PKVLEKAREE VYSVV----- 
77105      IKGLALAMLF GGTDSSTGTL EWSLSNLLNH PEVLKKARDE LDTQV----- 
78618      ---------- ---------- ---------- ---------- ---------- 
79148      ---------- ---------- ---------- ---------- ---------- 
85157      VLYIVENINV AAIETTLWSI EWGIAELVNH PEIQQKVRDE IDRVL----- 
82729      ---------- ---------- ---------- ---------- ---------- 
83581      ---------- ---------- ---------- ---------- ---AR----- 
85937      IGGYLFDFLF AGQDASTSSL LWAVALLESH PEVLAKVRAE VAGIWS---A 

74273      ---------- ---------- ---------- ---TRPHMAG NNVKVGGYNI 
74921      ---------- ---------- -----PRVRP PIPLLLHETA EESTVSGYYI 
75102      ---------- ---------- ---------- ---------- ---------- 
75177      -LNNKFEESD IENLPYMQAV LKESLRLHPP LPFLIPRETI QDTKFMGHDV 
75259      -EGGAITLSA INKMSLVKSV VYETLRLRPP VPRPRPR--- ---------- 
75757      RKDRCICESD ISNLVYLQAV VKETFRLYAP GPLSSPREFA EDCTLGGYHV 
75882      GKDEYIRESD ISKLVYLQAI VKETLRLYPP APFSSPREFT ENCILGGYHI 
76125      DESYVPPMEE LDAITYLEAT IRESLRLKPP APCVTQHCTQ DTVFPDGTFV 
80178      GKDRLVDEVD TQNLPYIRAI VKETFRMHPP -LPVVKRKCT EECEINGYVI 
77105      GQDRLLNESD LPKLPYLRKI ILETLRLYPP APILIPHVSS EDITIEGFNI 
78618      ---------- ---------- -----PRVRP PIPLLLHETA EESTVSGYYI 
79148      ---------- ---------- ---------- ---------- ---------- 
85157      EAGHQVTEPD IQKLPYLQAV VKETLRLRMA IPLLVPHMNL HDAKLGGYDI 
82729      ---------- ---------- ---------- ---------- ---------- 
83581      GEIDAPSMEQ LGRLPYLEAA MRENLRLNTS MTTRSPNQDT --TLSCGTFI 
85937      ESDELITADM LREMKYLMTV AREVVRFRPP ATLVPHVAEE RLPLTESYTI 

74273      PKGSIVHVNV WALGRDPKIW K-EPLQFRPE RFI------- EEDVDMKGHD 
74921      PAKSHVIINS FAIGRDKNSW E-DPDSFKPS RFLK------ EGVPDFKGGN 
75102      ---------- ---------- ---------- ---------- -------DPR 
75177      LKGTHVLVNA WAIGRDPECW D-DPLSLKPY RFLG------ --SLDGKGQP 
75259      ---------- ---------- ---------- ---------- ---------- 
75757      KKGTRLITNI WKIHTDPNVW S-DPFEFKPD RFLTT----- HKDIDVKGHH 
75882      KKGTRLIHNL WKIHRDPSVW S-DPLEFKPE RFLTT----- HKDVDLRGHN 
76125      PKGMDTTLLY HASALLPSVW GPDAAEFNPE RFLD------ DNGKLLVLPP 
80178      PEGALILFNV WQVGRDPKYW D-RPSEFRPE RFLETGAEGE AGPLDLRGQH 
77105      PRDTIVIING WGMQRDPQLW N-DATCFKPE RFDV------ ------EGEE 
78618      PAKSHVIINS FAIGRDKNSW E-DPDSFKPS RFLK------ EGVPDFKGGN 
79148      ---------- ---------- ---------- ---LMQDPWT GEQTIRPVSA 
85157      PAESKILVNA WWLANNPAHW K-KPEEFRPE RFFEE----- ESLVEANGND 
82729      ---------- ---------- ------FKPE RFLTT----- DKDIDMKGQH 
83581      PKNSVVCVCH YASARLKSTW GDDAAEYKPE RWLDP----- DTGKLRQFSP 
85937      PKG---AIAF TSRFESPVQG VTEPDRFDPD RVSD------ -ERQEDQIFN 

74273      YKLLPFGAGR RICPG-MNLA VNLVTSMLPH LLHHFVWALP NGVK------ 
74921      FEFLPFGSGR RSCPG-MQLG LYALEMAVAH LLHCFTWELP DGMK------ 
75102      VLFSVFFGGP RICLG-MKFA LAEVKITLAK LLSQFDFKTV ---------- 
75177      YELILFGARR RMXPG-NLQA PRKTPSPLRI PALMNFYWNF PRRCA----- 
75259      ---------- ---------- ---------- ---------- ---------- 
75757      FQLLPFGSGR RVCPG-ISFG LQTVHLALAS FLHSFEILNP S--------- 
75882      FELLPFGSGR RVCAG-MSLG LNMVHFTLAN LLHSFDILNP S--------- 
76125      LKFIAFRAGP RKCVG-RKLA MIEMKVVTAC LVSRFHLVEV TGQ------- 
80178      FQLLPFGSGR RMCPG-VNLA TSGMATLLAS LIQCFDLQVL GPQGQILKGG 
77105      KKLVAFGMGR RACPG-EPMA MQSVSFTLGL LIQCFDWKRV S--------- 
78618      FEFLPFGSGR RSCPG-MQLG LYALEMAVAH LLHCFTWELP DGMK------ 
79148      FQFVSFHAGP RTCLG-MRFA MLEMKTVLAY MLSKYHFTTR ---------- 
85157      FRYLPFGVGR RSCPG-IILA LPILGITLGR LVQNFELLPP PGQ------- 
82729      FQLLPFGGGR RICPV-INLG LQTVRLTLAS FLHSFEILNP S--------- 
83581      YQFVTFLAVP RQCIG-MRFA MLELRMVASV LCSRFNIKTV ---------- 
85937      RHFLAFGTGP PRCTG-QRTA VNHLVVLFAL FTPVIDVKRD I--------- 

74273      AEDVDMMESP VTTTYMHPPL PVAPTPRLSI LLYHTCST
74921      PSELKMDDIF GLTAPLANRL VAVPTPRLLC KLH-----
75102      KDPFDFTYRP SITLQINGPL DVVVSRLNV- --------
75177      PPHPTTTGRI SLVLPPRTPT AAGRDDRSTA --------
75259      ---------- ---------- ---------- --------
75757      TEPLDMTEAF GVTNTKATPL EVLVKPCLSP SCYKSM--
75882      AEPVDMTEFF GFTNTKATPL EILVKPRQSP NYYETL--
76125      DIRGTMGISL GMKNGMKVSV QATPGVAKRA --------
80178      DAKVSMEERA GLTVPRAHSL VCVPLARIGV ASKLLS--
77105      EEKLDMTENN WITLSRLIPL EAMCKARPLA TKIGI---
78618      PSELKMDDIF GLTAPLANRL VAVPTPRLLC KLH-----
79148      ENPKSYTYDV ASLLQVKGPL ICKVQRAG-- --------
85157      SQIDTSEKGG QFSLHILKHS TIVAKPRSF- --------
82729      TEPLDMTEVF TATNTKATPL EILIKPRLSP TCYESI--
83581      EDPFSLTYEL STVFPVKGRL MCTVESSGLA VSS-----
85937      SHRCGEIAYA ---------- ---------- --------