Medicago truncatula (model legume species)

 

There are 376 sequence pieces here.  Some are duplicates.

Some are from other species for use in assembling  genes

 

They are sorted by clan

 

Last revised Sept. 28, 2006

 

D. Nelson

 

CYP51 clan

 

>CYP51G1 DQ335779                1712 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP51G1 (CYP51G1)

mRNA, complete cds.

CG975178.1 CR300411.1  CR342952.1

CR298898.1  frameshifted version of CYP51G1

MNVFDGNKFLNTLLLLITTLIAAKLISSFIIPKSKKRLPPILQG

WPIIGGLLRFLKGPIILLREEYPKLGGVFTLKIFHKNITFLIGPEVSAHFFKAPESDL

SQQEVYQFNVPTFGPGVVFDVDYSVRQEQFRFFTEALRVNKLKSYVNQMVSEAEDYFS

KWGSSGEVDLKYELEHLIILTASRCLLGREVRDKLFDDVSALFHDLDNGMLPISVLFP

YLPIPAHRRRDNARKKLAEIFANIISSRKIADKSEDDMLQCFIDSKYKDGRPTTESEV

TGLLIAALFAGQHTSSITSTWTGAYLLCNKQYLSAVEEEQKNLMEKHGDRVDHDVLAE

MDVLYRCIKEALRLHPPLIMLLRSSHSDFSVTTREGKEYDIPKGHIVATSPAFANRLP

HIFNDPDKYDPDRFAVGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLR

NFELELVSPFPEIDWNAMVVGVKGKVMVRYKRRELSVNQ

 

CYP71 clan

 

>CYP71A29 AC124952.15  Medicago truncatula clone mth224m24, complete sequence

54% to 71A10 Glycine max, 82% to CG924302.1

Pseudogene 42% to 71A20

        MPPFSRLF

117162  PSPPRLPIIGNYLQLGTLSHRSFQSLSQKYGPLMMLHLGQLPVLVVSSIHMAKEVMQTHG  117341

117342  IVFANRPSTTLTKALFYGGKDIAFSSYGHTWRQKKKLCVNELLSQKRVQSVQFIREE*SA  117521

117522  ALVDKIRKAMSLSSGCCSVNLSEMLIETTNKMICRCIFGRKYDDEGYRLGELGRR  117686

117687  ITSQVLDFSMGDLFPMLGWVDVLTGQI  117767

117769  KKIKDSSEEMDDFLDRVIVEHKMSRRDPKKKDFLDILLQLQDDGLTEFELTQNDLKALLM  117948

118320  NMFLGGSDTTSTTLEWAM

        QLVKNPAIMKKAQEEVRRIVGE

118451  IEDSDVNQMEYMKCVIRETLRMHPAGPLLAPRETTSSVKLGGYGIPDKTTVYINAWVIQR  118630

118631  DPEFWEMPEDFLPERFENNKVNFNGQNFQFIPFG  118732

        SGKRKCPGMAFGLATTEYMLANLLYWFDWKFT  118829

118846  LQDVDKTEKFGITVTKKVPLCLQPIPY  118926

 

>CYP71A30 CG924302.1 Medicago truncatula genomic clone

AQ917284.1 Medicago truncatula BAC

83% to AC124952.15, 55% to 71B23  71clan

812  DMFLAGSDTTSTTVEWAMAELVKNPAIMKKAQEEVRRIVGNKSKIEDSDVNQMEYMICV  636

635  IKETLRMHPAAPLLAPRKTTSSVKLGGYDIPDKTMVYVNTWAIHRDPEFWEMPEEFLPER  456

455  FENNKVDFNGQNFQFIPFGSGRRKCPGMAFGLASTEYMLANLLYWFDWKLAPNGESLQDI  276

275  DMTEKFGITVNKKVPLCLQPI  213

 

>CYP71A31 CG951015.1 Medicago truncatula genomic clone

66% to 71A30, 55% to 71A29 AC124952.15 , 51% to 71A10

ESTs CA920740.1 BI262798.1 AW692831.2

MALKKWSHEQIIGALSSPFC

LSLLFLVSVLFVFKFAIGKSKSKTNPNQLPSPPKLPIIGNLHQLGTLPHRSLRDLSLKYG

DMMLLQLGQKQNPTLVVSSADVTMEIMKNHDRIFSNRPQHIAPKILLYGCDDVGFGLYGE

NWKQKRKLCVSELLNMKSVQSYHFVREEEVDELVNKLREASLNDECVNLSEMIISTSNNI

VCKCTLGRKYEGDNEGNVKELARKVMIYLQAFAVGDYFPSLGWIDVLSGK

IREFKETFRELDSLFDQVIEERLALKKKMENDQFKKKGFVDILLQLQEGGMLGFELSNND

IKALLTDMFVGGTDTASATLEWGMSELMRHPTIMKKAQEEVRRVVGNKSKV EKDDINQMHYLKCVVKXILRFHPATPLMAPRETISSVNLKGYNIPEKTMVYVNSWAIQRDP

 

>CYP71D56P AC137079.9g  Medicago truncatula clone mth227d17, complete sequence

complement(join(42766..43280,43772..43829)) 80% to 71D64

CR334298.1 Medicago truncatula genomic,

New part  is gray (pseudogene)

This seq matches CR352032.1

CR352032.1 Medicago truncatula genomic,

CR336155.1 Medicago truncatula genomic,

CR336110.1 Medicago truncatula genomic,

SYNSSTINLPPGPWTLPLIGNIHHIISSSLPHHCFKILEEKYGPLMHLKLGEVPYIIVSS

PEMAKEIMKTHDITFCDRPNLLLPTILTYNNTDIAFSIIHGEHWRQLRKLCVIELLSAKR

VQSFSSIR

ASEGSVVNLTQKILSTTYGITARATFGKKNIHQEAFKLAMEEALSLMGGFCIVDLYPSIK

FLRWVSRAN*RPNLPDIIDDHKRSHMEESKDEDLIDVLLKIQQESEHS*HP

LTDDNLKAVIQ

DLFTAGGETSSGAVL*GMSEMVKNPKVMEK

AQAEVRRVFDRKGYVVET

ELHQLIYLKSVIKETMRLHPAIPLLIPRESMKPCQINGYDIPAKTRVLVNAWAIGRDP

RYWVEAENFKPERFVNSPIDFNGTDFEYIPFGAGRRMCPGIAFGIPNVELPLAELLYH

FDWKLLNGMKCEELDMTESFGITVGRKHDL *LIPITR

 

>CYP71D57P AC137079.9f  Medicago truncatula clone mth227d17, complete sequence

complement(24593..24991) 86% to 71D64

MLLPRESRESCQINEYDIPAKTRVIVNAWAIGRDPKYWVEAESF

KPERFVNSSIDFKGTDFEYIPFGAGRRMCPGIAFALSNVELPLAELLYNFDWKLPNGM

SHQELDMTESFGLSVGRKHDLCLIPINHHP

 

>CYP71D58P CR954196.1q  Medicago truncatula chromosome 5

89% to 71D64

CR333793

pseudogene

        DLVDVLLKIKQENYHSEHPLTDDNMKSIIQ  128927

128750  DMFTAGTETSSEMVKNPKVMEEAQVEVRRVFDKKG 128646

128641  YVDEMELHLLIYLKFVIKETLRLHPVAPLLVPRESRERCQINRHEIPIKTRVVIIA  128474

128473  WAIGRDPRYWVEAERFKPERFVNSTIEFKGTDFEYIPFGAGRRMCPGIAFALPNIELPLA  128294

128293  QLLYRFDWKLPNKMKNEELDMAESFGITVGRKHDLYLIAINR  128168

 

>CYP71D58P AC137079.9e  Medicago truncatula clone mth227d17, complete sequence

complement(join(18658..19140,19214..19291,19468..19647)) 72% to 71D64

MEKVHKEIYMILQDIIDDHKSIRKEDSNDEDLVDVLLKIKQENY

HSEHPLTDDNMKSIIQDMFTAGTETSSEMVKNPKVMEEAQVEFVIKETLRLHPVAPLL

VPRESRERCQINRHEIPIKTRVVIIAWAIGRDPRYWVEAERFKPERFVNSTIEFKGTD

FEYIPFGAGRRMCPGIAFALPNIELPLAQLLYRFDWKLPNKMKNEELDMAESFGITVG

RKHDLYLIAINRLCNMYYLSKQVQKRCS*

 

>CYP71D58P-de2b  CR954196.1r  Medicago truncatula chromosome 5

pseudogene C-term

128002  PLAELFYEFD*KLPNGMNNEELDMTES  127922

127925  ESFGHTVGRKHDLC  127884

 

>CYP71D59 CR954196.1p  Medicago truncatula chromosome 5

identical to AC137079.9d

CR481333.1   Medicago truncatula genomic,

124085  MELHNHFFNITFISFFIFLLVLFKIVKIWSYNTSTVNLPPGPWKLPFIGNLHQIISRSLP  123906

123905  HHRFKFLADKYGPLMYLKLGGVPYVIVSSPEIAKEIMKTHDLNFSGRPNLLLSTIWSYNA  123726

123725  TDVIFSIYGERWRQLRKICVIELLSAKRVQSFRSIREDEVTNLVKSITASEGSVVNLTQK  123546

123545  ILSTTYGITARAAFGKRSKHQEVFRSAIEEVASLLGGVCIVDLFPSIKLLQCLSRAKTKM  123366

123365  EKLHKELDMTLQDIIDDHKSIHKEESNDEDLVDVLLKIQQENYHSQHPLTDDNIKSIIQ  123189

122977  DMFGAGTETSSEAVIWAMSAMVKNSNVMEQAQAEVRRVFDKKGYVDETELYQLIYLKS  122804

122803  VIKETLRLYPVAPLLVPRESRERCQINGYEIPAKTRVAVNAWAIGRDPRYWVEAESFKPE  122624

122623  RFVNSPIDFKGTDFEFIPFGAGRRMCPGIAFALPNVELPLAKLLYHFDWKLPNGMKNEEL  122444

122443  DMTESFGITAGRKHDLCLIPIPRR  122372

 

>CYP71D59 AC137079.9d  Medicago truncatula ABE81447 (CYP71D60)

complement(join(12905..13516,13728..14717)) 72% to 71D64

MMMYLEAFLLYLLHIYHHLGISFFPSGSSYLMELHNHFFNITFI

SFFIFLLVLFKIVKIWSYNTSTVNLPPGPWKLPFIGNLHQIISRSLPHHRFKFLADKY

GPLMYLKLGGVPYVIVSSPEIAKEIMKTHDLNFSGRPNLLLSTIWSYNATDVIFSIYG

ERWRQLRKICVIELLSAKRVQSFRSIREDEVTNLVKSITASEGSVVNLTQKILSTTYG

ITARAAFGKRSKHQEVFRSAIEEVASLLGGVCIVDLFPSIKLLQCLSRAKTKMEKLHK

ELDMTLQDIIDDHKSIHKEESNDEDLVDVLLKIQQENYHSQHPLTDDNIKSIIQDMFG

AGTETSSEAVIWAMSAMVKNSNVMEQAQAEVRRVFDKKGYVDETELYQLIYLKSVIKE

TLRLYPVAPLLVPRESRERCQINGYEIPAKTRVAVNAWAIGRDPRYWVEAESFKPERF

VNSPIDFKGTDFEFIPFGAGRRMCPGIAFALPNVELPLAKLLYHFDWKLPNGMKNEEL

DMTESFGITAGRKHDLCLIPIPRRF

 

>CYP71D60P AC137079.9c  Medicago truncatula clone mth227d17, complete sequence

complement(8062..8574) 72% to 71D64

MEHHNHLSNITFISFIIFLLVLFKIVKIWSYNTSTVNLPPGPWK

LPFIGNLHQIISRSLPHHLFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDL

NFCDRPNLLLSTIFSYNATDVIFSMYREWWRELRKICVIELLSAKRIQSFRSIREDEV

TNLVKSITFK"

 

>CYP71D60P CR954196.1n  Medicago truncatula chromosome 5

pseudogene, identical to AC137079.9c

118035  MEHHNHLSNITFISFIIFLLVLFKIVKIWSYNTSTVNLPPGPWKLPFIGNLHQIISRSLP  117856

117855  HHLFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDLNFCDRPNLLLSTIFSYNA  117676

117675  TDVIFSMYREWWRELRKICVIELLSAKRIQSFRSIREDEVTNLVKSIT  117532

117527  SEGSVVNLSEKIFSMTYGITARAVFGKRNRHQDVFIPALEKVVVLLGRFEIADLYPSIKL  117348

117347  LQWMTREKTK  117318

 

>CYP71D61 CR954196.1m  Medicago truncatula chromosome 5

identical to AC137079.9b

116016  MELHNPFSNIIFMLSFLILLVLFKIVKRWSFNNSTTKLPPGPWELPLIGNLHQIISRSLP  115837

115836  HHRFKILADKYGPLMHLKLGEVPYIIVSSPEIAKEIMKTHDLTFSDRPNLLLATILTYNA  115657

115656  TDVIFSKYGERWRQLRKICVVELLSAKRVQSFRSTREDEVSNLATSITASEGSIVNLTHK  115477

115476  IFSMTYGITTRAAFGKRSKHQQSFKSAVEEIVSLLGGICIVDLYPSIKLLQCVSRAKAKM  115297

115296  EKLHKEIDMILQDIIDDHKSIHKEDSNEEYLVDVLLKIQQENYHSQHPLTDDNIKSIIQ  115120

114913  DIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIYLKSVI  114734

114733  KETMRLHPTVPLLLPRESRERCQINGYEIPAKTRVMVNAWAIGRDPRYWVDAESFKPERF  114554

114553  VNSPIDFKGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKNEELDM  114374

114373  TESFGITAGRKHNLCLIPITRR  114308

 

>CYP71D61 AC137079.9b  Medicago truncatula ABE81444 (CYP71D59)

complement(join(4841..5452,5659..6555)) 76% to 71D64

MELHNPFSNIIFMLSFLILLVLFKIVKRWSFNNSTTKLPPGPWE

LPLIGNLHQIISRSLPHHRFKILADKYGPLMHLKLGEVPYIIVSSPEIAKEIMKTHDL

TFSDRPNLLLATILTYNATDVIFSKYGERWRQLRKICVVELLSAKRVQSFRSTREDEV

SNLATSITASEGSIVNLTHKIFSMTYGITTRAAFGKRSKHQQSFKSAVEEIVSLLGGI

CIVDLYPSIKLLQCVSRAKAKMEKLHKEIDMILQDIIDDHKSIHKEDSNEEYLVDVLL

KIQQENYHSQHPLTDDNIKSIIQDIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEV

RRVFDRKGFVDETELHQLIYLKSVIKETMRLHPTVPLLLPRESRERCQINGYEIPAKT

RVMVNAWAIGRDPRYWVDAESFKPERFVNSPIDFKGTDFEYIPFGAGRRMCPGIAFAL

PNVELPLASLLYHFDWKLPNKMKNEELDMTESFGITAGRKHNLCLIPITRRL"

 

>CYP71D62 AC137079.9a  Medicago truncatula ABE81443 (CYP71D58)

complement(join(864..1475,1761..2657)) 76% to 71D64

MELQNPFSNIIFILSFLILLVLFKIVQRWSFNNSTTKLPPGPWK

LPLIGNLHQIISRSLPHHLFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDL

NFCDRPNLLLSNIYSYNATDIAFAAYGEHWRQLRKICVIELLSAKRVQSFRSIREDEV

SNLVKSITASEGSVVNLTRKIFSMTNGITARAAFGKRNRHQDVFIPALEKVVVLLGRF

EIADLYPSIKLLQWMTREKTKMEKLHTEIDMIAQDIIDDHRSIHKEASNDEDLVDVLL

KIQQENYHSEHPLTDDNMKSIIQDMFLAGTETSSQVLLWAMSEMVKNPKVMEEAQDEV

SRVFDKKEYVDETELHQLIYLKSVIKETLRLHPVAPLLVPRESRERCQINGYEIPAKT

RVMVNAWAIGRDSRYWVEAESFKPERFVNSPIDFKGTDFEFIPFGAGRRMCPGISFAI

PNVELPLAKLLYHFDWKLPNGMSHQELDMTEFFGITVGRKHDLCLIPTTRRL"

 

>CYP71D62 CR954196.1i  Medicago truncatula chromosome 5

identical to AC137079.9a

112118  MELQNPFSNIIFILSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNLHQIISRSLP  111939

111938  HHLFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDLNFCDRPNLLLSNIYSYNA  111759

111758  TDIAFAAYGEHWRQLRKICVIELLSAKRVQSFRSIREDEVSNLVKSITASEGSVVNLTRK  111579

111578  IFSMTNGITARAAFGKRNRHQDVFIPALEKVVVLLGRFEIADLYPSIKLLQWMTREKTKM  111399

111398  EKLHTEIDMIAQDIIDDHRSIHKEASNDEDLVDVLLKIQQENYHSEHPLTDDNMKSIIQ  111222

110936  DMFLAGTETSSQVLLWAMSEMVKNPKVMEEAQDEVSRVFDKKEYVDETELHQLIYLKSVI  110757

110756  KETLRLHPVAPLLVPRESRERCQINGYEIPAKTRVMVNAWAIGRDSRYWVEAESFKPERF  110577

110576  VNSPIDFKGTDFEFIPFGAGRRMCPGISFAIPNVELPLAKLLYHFDWKLPNGMSHQELDM  110397

110396  TEFFGITVGRKHDLCLIPTTRR  110331

 

>CYP71D62-de2b  CR954196.1j  Medicago truncatula chromosome 5

pseudogene Cterminal

110197  MCPSIAFGLANVELRLAELLYDFD*KLSNGMNNEEQSFGLTVGRKHDLCSFPIT  110036

 

>CYP71D63 CR954196.1g  Medicago truncatula chromosome 5

CR488091.1 Medicago truncatula genomic,

89% to to AC137079.9a

108105  MELQNPFSNIIFMLSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNLHQIISRSLP  107926

107925  HHLFKKLAEKYGPLMHLKLGEVPYVIVSSPEMAKEVMKTHDLTFCDRPNLLLSTIWSYNA  107746

107745  TNIVFATYCEHWRQVRKICVIELLSAKRVQSFRSIREDEVTNLVKSITASEGSVVNLTRK  107566

107565  IFSMTNGITARAAFGKRNRNQDVFISAMEKVLVLLGGFEIADLYPSIKMLQCMSREKTKM  107386

107385  EKIHRELDMIMQDIIDDHRSIHKEASNDEDLVDVLLKIQQENYYSEHPLTDDNMKSIIQ  107209

107003  DMFIAGTETSSEVLLWAMSEMVKNPKVLEEAQIEVRRVFDKKGYVDESELHQLIYLKSVV  106824

106823  KETLRLHPVAPLLIPRESMKPCQINGYEIPAKTRVMVNAWAIGRDSRYWVEAESFKPERF  106644

106643  VNSTIEFKGTDFEFIPFGAGRRMCPGIAFALPNIELPLAQLLCHFDWKLPNKMKNEELDM  106464

106463  TESFGITVGRKHDLCLIPITRR  106398

 

>CYP71D63-de2b  CR954196.1h  Medicago truncatula chromosome 5

pseudogene Cterm

106282  PLAELFYEFD*KLPNGMNNEELDMIES  106202

 

>CYP71D64

DQ335785                1789 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP726B1

(CYP726B1) mRNA, complete cds.

CR954196.1 genomic seq

63% to 71D10 Glycine max

52% to 71D9 Glycine max

MELQNPFSNIIFMLSFLILLVLFKIVQRWSFNNSTTKLPPGPWK

LPLIGNIHQISGSSPPHHLFKKLAEKYGPLMHLKLGEVPYVVVSSPEMAKEIMKTHDI

TFCDRPNVLLPRVFTYNARDIAFSTYGELWRQLRKICVVELLSAKRVQSFSFIREEEV

SDLVKSISANEGSIVNLSKSIFSMTYGIVARSAFGKKNRHQQLFKSTIEEALGLLGEI

CIADLYPSIKILQKGSRVKTRVERLQGEIDRIFARHQSMIIETITVKQARMKDLVDVL

LKVQHENVHSQQPLTDENIKSVIQDLFIAGSETSSGIVLWAMSEMIKNPIVMEEAQVE

VRRVFDKKGYVDETELQQLTYLKCVIKETFRLHPTVPLLVPRESRERCEINGYEIPAK

TRVAVNVWAIGRDPKYWVEAESFKPERFVNSSIDFKGTDFELIPFGAGRRMCPGIAFA

LPNVELPLAKLLYHFDWKLPNGMSHQELDMTESFGLTVGKKHDVCLIPITRRP

 

>CYP71D64 CR954196.1e  Medicago truncatula chromosome 5

= CYP71D64 yellow differs from mRNA seq

103176  MELQNPFSNIIFMLSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNIHQISGSSPP  102997

102996  HHLFKKLAEKYGPLMHLKLGEVPYVVVSSPEMAKEIMKTHDITFCDRPNVLLPRVFTYNA  102817

102816  RDIAFSTYGELWRQLRKICVVELLSAKRVQSFSFIREEEVSDLVKSISANEGSIVNLSKS  102637

102636  IFSMTYGIVARSAFGKKNRHQQLFKSTIEEALGLLGEFCIADLYPSIKILQKVSRVKTRV  102457

102456  ERLQGEIDRILQDIINDHRNNHSKTSKDEDLVDVLLKVQHENVHSQQPLTDENIKSVIQ  102280

102196  DLFIAGSETSSGIVLWAMSEMIKNPIVMEEAQVEVRRVFDKKGYVDETELQQLTYLKC  102023

102022  VIKETFRLHPTVPLLVPRESRERCEINGYEIPAKTRVAVNVWAIGRDPKYWVEAESFKPE  101843

101842  RFVNSSIDFKGTDFELIPFGAGRRMCPGIAFALPNVELPLAKLLYHFDWKLPNGMSHQEL  101663

101662  DMTESFGLTVGKKHDVCLIPITRRP  101588

 

>CYP71D64-de2b  CR954196.1f  Medicago truncatula chromosome 5

pseudogene EXXR Khelix

101321  ETELHQLLYLKFIIKKH*ETLRLHPPPPL  101235

 

>CYP71D65P  CR954196.1d  Medicago truncatula chromosome 5

pseudogene

81087  MELHNFFTNITFIFSFLFVLFKIVKTLSANNSTVNLPPGPWTMPLVGNLHQIISSSLL  80914

80086  HHHLKNLAEKYGLLMHLKLGDQVPYIIVSPPEIAKEIMKTHDLTFGDRPNLLLATILTYN  79907

79906  NTDIAY  79889

79895  CIYGEHWRQLRKLCVTELLS  79836

 

>CYP71D66 CR954196.1c  Medicago truncatula chromosome 5

77% to AC137079.9d

73925  MELHNLFTNITFIFSFLFLLVLFKVVKTLSANNSIVNLPPGPWTMPLIGNIHQIITSSLP  73746

73745  HHHLKKLAEEYGPLMHLKLGEVPYIIVSSPEIAKEIMKTHDINFCDRPKLLLSTIFSYNA  73566

73565  TDIAFSTHGENWRQLRKICVEELLSAKRVESFRSIREEEVSNLVKSITASEGSVVNLTQM  73386

73385  ILSLTIGMTARAAFGKKNKHQEVFKSAMKEIFKLLGGFSFADLYPSIKILQMLSWPRKKL  73206

73205  EKLHRETDMILQEIIDDHKSSHKKARKNDDLVDVLLKIQRVNHSQHPLTDDNIKSVIQ  73032

72824  DMFVGGTQSSSEAVLWTMSEMVKNPMVMEAAQVEVRRVFDKKGYVNETELHQLIYLKS  72651

72650  VIKETMRLHPSIPLLIPRESTKPCQINRYDIPAKTRVIVNAWAIGRDPRYWVDAKSFKPE  72471

72470  RFLNSRIDFKGTDFEYIPFGAGRRMCLGIAFALPNIELPLAQLLYHFDWKLPNGMKNEEL  72291

72290  DMTESFGLAVGRKHDLCLIPFIRRP  72216

 

>CYP71D67P  CR954196.1b  Medicago truncatula chromosome 5

pseudogene 72% to 71A54

70519  MELDNLYSNITFISSFLFIFLLLKIVKRWRCNYSTINLPPGPWTLPLTGNIHQIISSSLP  70340

70339  HHCFKNLAKKYGPLMHLKLGEISCIIVSSPEMAKEILKTHDLTFCNRPNLLL  70184

70181  HNAKDISFSEYGEHWRQLRKICVVELLNAKRVQSFRSIREEEVSSLVKSISTGEALVVDL  70002

70001  NDILEFKSAMEESIKLLEGFCIADLYPSIKILQRVSRAK  69885

69884  TKMEKLQRKA*YYIARY  69834

69773  SSNDFKGIDFEYIPFDAGRRMCPGIMFGLPNVELPLASLLYHFDWKLPNEMKNEELDMTE  69594

69593  SFGITAVRKYDLCLIPIIRR  69534

 

>CYP71D68P  CR954196.1a  Medicago truncatula chromosome 5

pseudogene

8873  KEVMKTQDLNFCDRPNLLLSTIFTYNDTNIAFCPDYWRQLQKIY

8737  VTELLSSKCVQSFQSIREEEVSKLVKSICTCEGSIVNLTRNIFSMTHEITSRTVFGKRTK  8558

8557  HQQVFITAMEEIVSLLGDFVLL

      FCIADLYPSVRILLQSVSNAKTGREKLCRETDTIL

8392  SSMIIKTVTKKK  8357

      EDLLDVLLKFQQDNNNHLQNQLTDDNIK  8277

7762  DLFSAGTETSSVVVLWAMSEMAKNPNVMEEAQAEVRRVFDMKGYVDETELH*LIYLKSII  7583

7582  KETLK  7568

 

>CYP71D69v1 AC145061.27a  Medicago truncatula

seq runs off the end 84% to 71D70

711  MELGFHLLISTILGFLLFMVIKITKKSKAKKINSKLPPGPRKLPLIGNIHQLGTLPHQSLAKLAQEYG  508

507  PLMHMQLGELSCIVVSSQDMAKEIMKTHDLNFANRPPLLAAEIITYGYKGMTFSPHGSYW  328

327  RQMRKICTMELLTQKRVESFRLQREEELSNLVKDIILSEGSPINISEKVDSLAYGLTSRT  148

147  AFGSQVEGKERYRKLMKDVSKMAGGFSLADLYPSIGILKVLTGLRQGIE  1

 

>CYP71D69v2 CG964663.1 Medicago truncatula genomic clone

98% to AC145061.27a (4 aa diffs)

698  LLISTILGFLLFMVIKITKTSKAKKINSKLPPGPRKLPLIGNIHQLGTLPHQSLAKLAQ  522

521  EYGPLMHMQLGELSCIVVSSQDMAKEIMKTHDLNFANRPPLLAAEIITYRYKGMTFSPHG  342

341  SYWRQMRKICTMELLTQKRVESFRLQREEELSNLVKDIILSEGSPINISEKVDSLAYG  168

167  LTSRTASGSQVEGKERYRKLMKDVSKMAGGSSLADLYP  54

 

>CYP71D70   Medicago truncatula

AC145061.27b 28221 31127

CG934862.1 Medicago truncatula genomic clone

DQ335805 OLD 71AY1

752 bp    mRNA    linear   PLN 04AUG2006

cytochrome P450 monooxygenase CYP726C1

(CYP726C1) mRNA, partial cds. cyan, new seq is yellow

51% to 71D10 new subfam in CYP71, 49% to 71D9, 50% to 71D11

28221  MGFEFSNILISTILGFLLFMVIKFIWRSKTKKTTYKLPPGPRKLPLIGNIHQLGTLPHQAL  28403

28404  AKLAQEYGSLMHMQLGELSCIVVSSQEMAKEIMKTHDLNFANRPPLLSAEIVTYGYKGMT  28583

28584  FSPHGSYWRQMRKICTMELLSQNRVESFRLQREEELANFVKDINSSEGSPINLSEKLDSL  28763

28764  AYGLTSRTAFGANVEDEDKEKYRKIIKDVLKVAGGFSLADLYPSIRILQVLTGLRQRIEK  28943

28944  LHGETDKILENIVRSHRKKNLETKAKEEKWEDLVDVLLKLQTNSDLEHPISNNVLKATI (0)  29120

30507  SDIFGAGSDTTFTTLEWA MSELIKNPQVMKKAQAEVRSVYNEKGYVDEASLHKLKYLKSVI  30689

30690  TETLRLHAPIPLLLPRQCSEKCEINGYEIPAKSKVIVNAWSICRDSRYWIEAEKFFPERF  30869

30870  IDSSVDYKGVDFQFIPFGAGRRMCPGMTSGIASLEISLANLLFHFDWRMPNGNNADDLDM  31049

31050  DESFGLAVRRKHDLRLVPTAYHSSG*  31127

 

>CYP71D71P AC145061.27c  Medicago truncatula

82% to 71D70

pseudogene

34034  NDYWIKPFILLFIVIKIIGRSKTKQTNSKLPPGPRKLPLIGNIHQLEALPHQSLAKLA  33861

33860  QQYGPLMHMRLGEISCIVVSSQEMAKEVI  33774

33404  DHLSAGSQTTFTTLEWAMSELIKNPQVMEKAQAEVRSVYKEKGYVDESSLHKLKYLKSII  33225

33224  KETFRLHAPSPLLLPRQCSEKCEINGYEIPAKSKVIVNSCSICRDSRYWIEAEKFYPERL  33045

33044  IDCSVDYKGVDFEFIPFGAGRRICPGIIFGIANIEISLANLLFHFDWKMPNGNNADELDM  32865

32864  IESFGLAVRRKHDLWLVPTTYHS*  32793

 

>CYP71D72 AC145061.27d  Medicago truncatula ABE87847 (CYP71D61)

60% to AC142507.13, 68% to 71D9, 56% to 71D11, 52% to 71D10, 51% to 71D1

40560  MDIQTLYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLP  40730

40731  HHRLRDLSTKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNS  40910

40911  IGLSFSPYGDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWIASKEGSEINLTKE  41090

41091  VNSRIFLITSRVAFGKECKDNKKFISLVWEATRVAGGFNLGDLYPSYKWLQNISGLKPKL  41270

41271  EKLHKQTDVILQNIIDEHRLVDKSRAIEDHSEEVAEDLVDVLLKQDCLS  41417

41418  DNSVKAVI (0) 41441

43135  DMYGGGSETSASTILWAMAEMIKNPRIMKKLQAEVREVFEKERKPNESDMEKLKYLK  43305

43306  CVVKETLRLHPPGAFLLPRECGQACEINGYGIPFKSKVIVNAWAIGRDPNNWDDPERFYP  43485

43486  ERFIDNCVDYYKGNNFEFIPFGSGRRMCPGVTFGLVNIEFSLALLMYHFDWKLPNAMKKE  43665

43666  DLDMSESFGVAVTRKNDLHLIPFTYHP*  43749

 

>CYP71D73 AC145061.27e  Medicago truncatula ABE87848 (CYP71D62)

62% to 71D70

47460  MELNTKNIVSPMFLSFFLFIVFILFFKSKKPKPSNSKLPPGPPTLPIIGNLHQIGS  47293

47292  MPHHSLTKLSQKYGPIMHIKLGEISTIVVSSPEIAKQIMKTHDNKFSDRPHLLAADIITY  47113

47112  GSKGMTFSPYGSYWRQMRKICTFELLTPKRVESFQSIREQEVSNIVKEIGLSEGSCINLS  46933

46932  KMINLFSFGLTSRIALGGKSEDQEAFMVAMKDVLKLVGGFSMVDLFPSFQVLHFLTGVKA  46753

46752  KAEEVHKEIDRILEKILRYHQLDTSLETKKINRKDGEDLVDVLLRLQKQNNLEHPLSDS  46576

46575  IIKA (0) 46564

46189  NMLDIFSAGSGTSAKTSEWAMSELIKNPRVMEKAQAEVRRVFDAKGHVDEANIH  46028

46027  ELKYLKSVIKETFRLHGPVPLLLPRECSESCEINGYEIPAKTKVIVNASAIGMDPNYWNE  45848

45847  PKKFYPERFIDSSVDYKGVDFQFIPFGAGRRMCPGITFGIANVEILLANLLFHFDWKMVD  45668

45667  GNKAEELDMTESFGLSVRRKHDLCLIPIMYHSSPKL*  45557

 

>CYP71D74 AC145061.27f  Medicago truncatula ABE87853 (CYP71D63)

60% to AC142507.13

CG922703.1 Medicago truncatula genomic clone

60892  MDIQILYFTSIFIFMFIVNKIVTKKSNSSTPNLPPGPLKLPFIGNIHNLIGSLPHHRLRDLST  60704

60703  KYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPYG  60524

60523  DYWRQLRKICALELLSSKRVQSFQPIRAEEMTNLIKWIASKEGSEINLTKEVFSRIFLIT  60344

60343  SRVAFGKECKDNKKFISLVWESTRSAGGFNLGDLYPSYKWLQNLSGLKPKLEKLHKQTDV  60164

60163  ILQNIIDEHRLVNKSRAIKDHSEEDLVDVLLKQDCLSDNSVKAVI  60029

59322  DMYGGGSETSASTIIWATAEMIKNPRIMKKLQAEVREVFEKERKPNESDMEKLKYLKCVV  59143

59142  KETLRLHPPGAFLLPRECGQACEINGYGIPFKSKVIVNVWAIGRDPNNWDDPERFYPERF  58963

58962  IDNCVDYYKGNNFEFIPFGSGRRMCPGVTFGLVSVEFSLALLMYHFDWKLPGAVKKEDLD  58783

58782  MCESFGTAVIRKNDLHLIPYAYHP*  58708

 

>CYP71D75 AC145061.27g  Medicago truncatula ABE87854 (CYP71D56)

61% to AC142507.13

65967  MDLQIICFTSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIGSLPHHRLRD  66155

66156  LSTKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFA  66335

66336  PYGDYWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWISSKEGSQINFTKEVFSTIS  66515

66516  TITSRTAFGKKCKENQKFISIVRDAIKIAGGFDLGDLYPSCRLLQNISGLKPKLEKLHKQ  66695

66696  ADLIMQNIIDEHREVNKSRVNENQGEEVEEDLVDVLLKQDGLNDNSVKAVI (0)  66848

67838  DMYGGGSETSATTITWAMAEMIKNPKIMEKVQAEVREVFDKERNPNESDMEKLTYLK  68008

68009  YVVKETLRLHPPAAFLLPRECGQACEINGYDIPFKSKVIVNAWAIGRDPNHWDDPERFYP  68188

68189  ERFIESCVDYKGNNFEFIPFGAGRRMCPGVTFGLVNVEYPLALLMYHFDWKLPNEMKNED  68368

68369  LDMSETFGSAVTRKDDLYLIPVMYHP*  68449

 

>CG922887.1 Medicago truncatula genomic clone

89% to CYP71D75 AC145061.27g

854  ILKDMYGGGSETSATTITWAMAEMIKNPKIMEKVQAEVR  738

724  KERKPNESDMEKLKYLKCVVKETLRLHPPSTFLLPRECGKACEINGYDIPFKSKVIVNAW  545

544  AIGRDPNHWDDPERFYPERFIDSCVDYKGNNFEFIPFGAGRRMFPAVTFGLVNVEYPLAL  365

364  LMYHFDWKLLNETKNEDMGMSETIG*SVTRKDDLYLIPV  248

 

>CYP71D76P AC145061.27h  Medicago truncatula

pseudogene 50% to AC137079.9d

70063  MDLQTIFPLALFSIFLLLIIVTINQKKKTDSIPNIPPGPTKLPIIYRKH  69917

69927  IGNIHNLFGSPLHRKLGELSKIHGPLMHLQLGEVCFIIVSSAEYAKEIMKTHDVTFSSRP  69748

69747  YSLT  69736

69736  LRKICTVELLSLQRVQSLWPVREQEISNLVKKIASEEGCVLNLSQHVVSMLFSITSRAEF  69557

69556  GKKYMEQDEFVSLVREVLHISGGFYIGDLFPSAKWLQNFSRRRPKLEKLHKKVDRMI  69386

69385  EMIINDHKVKRSRGKE  69338

 

>CYP71D77 AC145061.27i  Medicago truncatula ABE87857 (CYP71D64)

60% to AC142507.13

74666  MDLQTIPPFTLFSIFLLSIIVTLKLKKKIKKIDSISNIPPGPWKLPIIGNIHNLIGS  74496

74495  PPHRKLRELSNKYGPLMHLQLGEVFFIIVSSAEYAMEIMKTHDVIFSSRPSTLTSEIVF  74319

74318  YDSTSIAFSPYGDYWRQLRKICTVELLSIKRVQSLWPIREQEINNLIRRIASEEGRVVNL  74139

74138  SQQVVPMMFSITSRAAFGKKYMEQDEFVSTVREVLQLAGGFYIGDLFPSAKWLQNLTGMR  73959

73958  PRLEKLHEKVDRILELIIDDHKDKKSRSKDDLVEGEEDLIDVLLKFEDSNNSSQEF  73791

73790  SITKRNIKAIL  (0) 73758

73510  DIFTGGSDTAATTINWTLAEMMKDQRVMKKAQAEVRVLFKKRGKIDEIFLSELIYLKAI  73334

73333  IKEVLRMHLPGPLLIPRVCAQACEIDGYHIPINSRVIINAWAIGRDPKYWTDPDKFYPER  73154

73153  FIDSSVDFKGTNFEYIPFGAGRRICPGINYGMANVELTLALLLCHFDWKLPGGMKNEDLD  72974

72973  MTELFGASVIRKDDLYLIPTTYPSLK*  72893

 

>CR500001.1 Medicago truncatula genomic,

CR488224.1 Medicago truncatula genomic,

87% to 71D77 AC145061.27i 71clan

19   EIDGYHIPIKSIVIINAWAIGMDSKYWTDPERFYPERFIDSSIDFKGTNFEYIPFGAGRR  198

199  ICPGMNYGMANVELALALLLYHFDWKLPNGMINEDLDMTELFGAAVVKKDDLYLIPI  369

 

>CYP71D78 AC145061.27j  Medicago truncatula ABE87866 (CYP71D65)

CR503702.1 Medicago truncatula genomic clone

62% to AC142507.13

CR487579.1  CR501986, CR490142

100504  MDLQTIYTLTLFSIFVLSIIVTLKLRKKITKIDSIANIPPGPWKLPIIGNIHNLIGSPP  100328

100327  HRKLRELSTKYGALMHLQLGEVLFTIVSSAEYAKEIMKTHDVIFASRPLTLTSEIMFYGS  100148

100147  TDIAFSPYGDYWRQLRKICTVELLSIKRVQSLWPIREQEIKNLVSRIASDEGRVVNLSQQ  99968

99967   VMSMMFSITSRAAFGKKYKEQDEFISAVRYMLQIAGGFYIGDLFPSAKWLQNFTGRRPKL  99788

99787   EKLHQKVDRILEMIINDHKEKNSGDKEGLVGGEDLTDILLKFEDGSDNNLDFCLTK  99620

99619   NNIKAII (0) 99599

99057   DIFTAGSDTAATTINWAMAEMMKDQRVLKKAQAEVRVLLYKRGKFDETLISELKYLKVI  98881

98880   IKEVLRMHPPGPLLVPRVCGQACEIDGYHIPIKSRVIINAWAIGRDPKYWTDPDKFYPER  98701

98700   FIDSSLDFKGTNFEYIPFGAGRRICPGINYGMANVELTLAFLLSHFDWKLPGGMKCEDLD  98521

98520   MTELFGASVIRKDDMYLIPTNYFTEIVLKNERFLWN* 98410

 

>CYP71D79 AC145061.27k  Medicago truncatula ABE87872 (CYP71D66)

CR319838.1 Medicago truncatula genomic,

CR337215.1   Medicago truncatula genomic,

CG931507.1 Medicago truncatula genomic clone

49% to 71D64, 60% to AC142507.13,

114314  MAHHILNLFTLFTIFMFMIIALKIRSHYKKYASSTKNIPPGP

        WKLPILGNILNLVTTNPPRKLRDLAKKYGPL  114180

114179  MHLQLGEIFFIVVSSPEVAREVLKTHDIIFASRPHLLVLEIVSYNSTDIAFSPYGDYWRQ  114000

113999  LRKICAIELLSTRRVKSLWPKRQKEINSLLNKIDANEGSEFNLTQEVISMLYTFTSKAAF  113820

113819  GKKYLEQEEFLSVVKQLIKLAGGFYLGDLFPSAQWIQTLSGMKPKLKKLSQQVDRILGHI  113640

113639  INDHKEAMSKRAKEGLAEVEEDLIDCLLKFEDSGSDMGFNLTTDNIKAIIL  (0) 113487

113383  DVFAAGSETSASTIIWAMAEMMKDQRVLKKAQAEVREGFDRSGRVDEATIDEFKYLK  113213

113212  AVIKESLRLHPSVPLLLPRECGQACEINGYYIPVKSRVLVNAWAIGRDPKYWNDPDKFYP  113033

113032  ERFIDSSIDFKGTNFEYIPFGAGRRICPGMNYGMANVEQVLALILYHFDWKLPNGIKNEE  112853

112852  LELIEEFGAAMSRKGDLYLIPIISHPLLVT*  112760

 

>CYP71D80P AC145061.27m  Medicago truncatula

pseudogene 48% to 71D64, 55% to AC142507.13,

124493  H*KLRELSKKYGTLMHLQLGEVYLIIVSSAEYAKEIMKTHDVIFVSRPLTLTSEIIFYDS  124314

124313  TNIGFPPYGDL  124281

124281  GDNLERFVP*SFLSIKRVQSLWPIREQEMNNLVKRITSKEGSIM  124150

 

>CYP71D81 CR932040.2d  Medicago truncatula chromosome 5

Like 71D64

59447  MEFHNSFFNSTFIASFLFLLVLLKLVKKWSCNNSNINLPPGPWTLPIIGNLHQIISNSIL  59626

59627  PHQYLKNLAEKYGPLMHLKLGEVSYLIVSSPSMAQEIMKTNDLNFCDRANLLLSTIFSYN  59806

59807  ATSIVFSAYGEHWRQIRKICVLQLLSAKRVQSFRYIREEEVSNLVESISASEGSIVNLSH  59986

59987  KIYAMTSGITTQAAFGKRNKQHQVFRSALKEITSLMGGFCIVDVYPSIKMLQWVSRAKTK  60166

60167  VEKLHKEIDMILQDIIDDHKNIHKEESKDEDLVDTLLKIQQENEHSLNPLTDNNMKAIIX  60343

60515  DMFAAGSETSSGVVLWGISEMVKNPKIMEEAQAEVRNMFDKKGHVDETELHQLIYLKSII  60694

60695  RETLRLHPSAPLLVPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  60874

60875  LNSTIDFKGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDM  61054

61055  TESFGLSVGRKNDLCLIPITRRP  61123

 

>CYP71D81 AC140774.7  Medicago truncatula ABE79660 (CYP71D57)

79% to AC142507.13

complement(join(13822..14439,14665..15564))

MDSPIFYLLALVLFFIFMLVVLTKGRNLKKKSSAPNLPPGPWKL

PIIGHIHHLVSSTPHQKLRDLAKVYGPLMHLQLGEISAIVVSSPEYAREVMKTHDIIF

ASKPKIVAIDILLYGSTDIAFSPYGNYWRQLRKICTIELLTQKRVSSFRPIREEEFTN

LIKSIDSQQGSPINITQAVVTSIMTITTRAAFGNKCKGQEQLVSLANGESVGGGFDIG

ELFPSAKWLQLVSGFRSKIEVLHRQIDLILVNIINEHKEAKSKAKEGEVEEDLVDVLQ

KFQGGNDIDQDICLTDNNIKAIILDIIGAGGETSSTTIVWAMAELVRDPRVMKKAQYE

VRKIFNKKGTVGENYINELEYLKLVVKETLRLHPPTPLLLRECGQACEIEGYHIPAKS

KVIVNAWTIGRDPKYWTEPERFHPERFIGSSIDYKGNNFEYIPFGAGRRICPGITFGL

INVELALALLLYHFDWRLPNGMKGEDLDMTEQFGANVKRKSDLYLIPTIPLPSRI

 

>CYP71D82 CR932040.2c  Medicago truncatula chromosome 5

Like 71D64

24217  MEFHNPFFNSTFICSFLFLFVLLKIVKKWSCNNSSINLPPGPWTLPIIGNMHQLISNSLP  24038

24037  HQCFKNLADTYGPLMHLKLGEVSYLIVSSPSMAKEIMKTHDLNFCDRPNLLLSTIFSYNA  23858

23857  IDIIFSPYGEHWRQLRKICVLQLLSAKRVQSFRYIREEEVSNLVKSISASEGSIVNLSHK  23678

23677  IFLMTSGITTRAAFGKRSKHQEAFKSAIKEIASLLGEFCIADVYPSVKMFQWVSRAKTKV  23498

23497  EKLHKEIDMILQDIIVDHKNIHKEESKDEDLVDTLLKIQQENDHSHNPLTDNNMKAIIX  23324

23117  DMFGAGTETSSGAVLWGISEMVKNPKIMEKAQAEVRKVFDKKGYVDETELHQLIYLKSII  22938

22937  RETLRLHPSVPLLVPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  22758

22757  LNSTIDFKGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDM  22578

22577  TESFGMAIGRKHDLCLIPITRRP  22509

 

>CYP71D82 CT009652.2c  Medicago truncatula chromosome 5

70% to 71D64 same seq as CR932040.2c

102518  MEFHNPFFNSTFICSFLFLFVLLKIVKKWSCNNSSINLPPGPWTLPIIGNMHQLISNSLP  102339

102338  HQCFKNLADTYGPLMHLKLGEVSYLIVSSPSMAKEIMKTHDLNFCDRPNLLLSTIFSYNA  102159

102158  IDIIFSPYGEHWRQLRKICVLQLLSAKRVQSFRYIREEEVSNLVKSISASEGSIVNLSHK  101979

101978  IFLMTSGITTRAAFGKRSKHQEAFKSAIKEIASLLGEFCIADVYPSVKMFQWVSRAKTKV  101799

101798  EKLHKEIDMILQDIIVDHKNIHKEESKDEDLVDTLLKIQQENDHSHNPLTDNNMKAI  101628

101627  IX  101625

101418  DMFGAGTETSSGAVLWGISEMVKNPKIMEKAQAEVRKVFDKKGYVDETELHQLIYLKSII  101239

101238  RETLRLHPSVPLLVPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  101059

101058  LNSTIDFKGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDM  100879

100878  TESFGMAIGRKHDLCLIPITRRP  100810

 

>CYP71D83P CR932040.2b  Medicago truncatula chromosome 5

pseudogene Like 71D64

20685  NPSFNSNFVASFLIFLVLLKIVKRWRCNNSTINLPQGPRTLPIIGNIHQIIRNSLPHQCF  20506

20505  KNLAEKYGPLMHLKLGEVSYLIVSSPSMAKEIMKTHDLNFCDRPNFLLSTIFSYNATGIA  20326

20325  FSTYEEHWRQLRKICTLQLLSAKRV*SFRYIREEEVSNLV  20206

 

>CYP71D83P CT009652.2b  Medicago truncatula chromosome 5

pseudogene same seq as CR932040.2b

98986  NPSFNSNFVASFLIFLVLLKIVKRWRCNNSTINLPQGPRTLPIIGNIHQIIRNSLPHQCF  98807

98806  KNLAEKYGPLMHLKLGEVSYLIVSSPSMAKEIMKTHDLNFCDRPNFLLSTIFSYNATGIA  98627

98626  FSTYEEHWRQLRKICTLQLLSAKRV*SFRYIREEEVSNLV  98507

 

>CYP71D84P CT009652.2a  Medicago truncatula chromosome 5

pseudogene same seq as CR932040.2a

92449  FTTLLFAPFSFSLCYSK*LKKWSCNNSSINLPPGPWTLPVIGNIHQVISNSLLHQCFRN  92273

92272  LAEKYGPLMYLKLGEVSYIIVSSPSMAKEIMKTHDLNFCDRPNLLLSSFGYNATDIAFS  92096

92095  PYGEHWRQLRKICTLQLLSAKHVQSFRYIRE*EVSNLIKSISTSKGSVVNLSHKIFAMTS  91916

91915  AITTRAAFGKRNKHQQVFQSAIKEIASLMGGFCIADVYPSIKMLQRVSGVKTKFEKFHKE  91736

91735  IDMILQDIVDDHKNIHKEESKDEDLVDALIKIQQENDLSHDHTLTDDSMKSIIX  91577

91355  DMFVGGTETSSGVVLWGISEMIKNPKIMKEAQAEVRKVFDKKGHVDETELHHLIYLKSII  91176

91175  KETLRLHPSLPLLIPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  90996

90995  VNSTIDFKGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDM  90816

90815  TESFGLAVVRKHDLCLIPITRR  90750

 

>CYP71D84P CR932040.2a  Medicago truncatula chromosome 5

Like 71D64

14148  FTTLLFAPFSFSLCYSK*LKKWSCNNSSINLPPGPWTLPVIGNIHQVISNSLLHQCFRN  13972

13971  LAEKYGPLMYLKLGEVSYIIVSSPSMAKEIMKTHDLNFCDRPNLLLSSFGYNATDIAFS  13795

13794  PYGEHWRQLRKICTLQLLSAKHVQSFRYIRE*EVSNLIKSISTSKGSVVNLSHKIFAMTS  13615

13614  AITTRAAFGKRNKHQQVFQSAIKEIASLMGGFCIADVYPSIKMLQRVSGVKTKFEKFHKE  13435

13434  IDMILQDIVDDHKNIHKEESKDEDLVDALIKIQQENDLSHDHTLTDDSMKSII  13276

13054  DMFVGGTETSSGVVLWGISEMIKNPKIMKEAQAEVRKVFDKKGHVDETELHHLIYLKSII  12875

12874  KETLRLHPSLPLLIPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  12695

12694  VNSTIDFKGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDM  12515

12514  TESFGLAVVRKHDLCLIPITRR  12449

 

>CYP71D85 AC126779.19c  Medicago truncatula

51% to CR932040.2c

CG948392.1 Medicago truncatula genomic clone

CG937149.1 Medicago truncatula genomic clone

CG970532, CG943143

62913  MEIQLSSFVIPFFLFLTLRLLAKYFKPKTLDYKLPPGPMKLPLIGNLHQIAALGSL  62746

62745  PHRAFKQLAHKYGPIVHLKLGETSAVVISSPKLAKEILKTHDVIFANRPHLQASHIMTYG  62566

62565  SKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYIREDETRNFIKSIQSSEGSSVNLTN  62386

62385  RIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESVGGLEPADLFPSMKSIIQMLTGTKS  62206

62205  KVLKMHKKADKILEIIVRKHQEKQRRAKEGKVSSDEVEQEDLVDVLLRIQESGSLEIPIT  62026

62025  TSNIKAVIF  61999

61222  DAFAAGTDTTTSTIVWAMSELMKNPSVMNKAQAEIREACKGKEIISENDIQELPYLKLVI  61043

61042  KETLRLHSPTPLLLPRECTELTNIDGYDIPKKTKVMINVWAMARDPQYWTDAEMFNPERF  60863

60862  EGSSIDFRGNNFEYLPFGAGRRICPGLQFGIAGIMLPVALLLYHFNWELPNKMKPMDLDM  60683

60682  TEHYGLAIGKKSDLCLIPTVYA*  60614

 

>CYP71D86 AC126779.19b  Medicago truncatula

54% to AC145061.27g

52553  MEFQLSFVIIPF

52517  SIFILLHWLATKYYKPKTIFYKLPPSPRKLPLIGNLHQLAFAGKLPHHGLQKLSQK  52350

52349  YGPLMHLQLGEINAVVVSSSNLAKEVMKTHDVVFANRPKLPSLKILAYGFKDIVFSPYGD  52170

52169  YWRQMRKICVLEILSAKRVQSFSYIREDETKKFIESIKSFAGSKINLTTRIFSVINSIIL  51990

51989  RAALGDKSEDQEEFVSLIRKAVAVSSGLELIDLFPSMKLIHVLTGMKKNVEKIHKRVDKI  51810

51809  LDNVVRKHQEKRARGNEGNKSEIEKEDLVDVLLRVQQSGSLDVQLTINNIKAVIW (0)  51645

51498  DVFVAGTDTSSTTIEWAMSEMMKNPRVREKAQAELRQAFNGKELIYETDV  51349

51348  EKLSYLKLVIKETLRLHPPSPLLVPRLSTELTKIDGYDIPKNTTVFINAWAIGRDPKYWN  51169

51168  DAERFIPERFDDSLIDFKGNNFEYIPFGAGRRMCPGMTFGLASVIFPLALLLYHFNWELP  50989

50988  NQMKSQDLDMIEDFGLTVGRKNELCLIPTVYDV*  50887

 

>CYP71D87 AC126779.19a  Medicago truncatula

54% to CYP71D61, 73% to AC126779.19b, 68% to AC126779.19c

40719  MEAQLSFFVIPFFLLFVLHWLAKYSKTKKSHSKLPPGPMKFPLIGNLPQLAMSKKRP  40549

40548  HHALHELSHKYGPLMHIQLGEISTVIVSSPKLAKEIMKTHDAAFANRPKLLSPEIMAYGS  40369

40368  KDIVFSPYGDFWRQMRKICVFELLSAKRVQSFSYIREDETKKLIQSIQSSTGSTINLTSR  40189

40188  IFSMVSSNISRAAFGDKSKDQDEFVDLVRKVVEMSSGFGVDDLFPSIKPLHILSGMKPKL  40009

40008  EKIHKRVDKIIENIIRQHQEKRERAKEDDNNEVDNEDLLDVLLRVQQSDNLDIKITTNN  39832

39831  IKAVIW  (0) 39814

38728  DVFVAGTDTTSTTIEWAMSEMMKNPSVREKAQAELREAFKGKKIISES  38585

38584  DLNELTYFKLVIKETMRLHPPSPLLVPRECTELTIIDGYEIPKNTKVMINAWAVARDPQY  38405

38404  WTDAEMFIPERFDGSLIDFKGNNFEYIPFGAGRRMCPGMSFGIASVMLPLALLLYHFNWE  38225

38224  LPNQMKPEDLDMTENVGLAVGRENELCLIPNVYVM*  38117

 

>CYP71D88P CR955010.2a  Medicago truncatula chromosome 5

Possible pseudogene, 73% to CR931743.1a, 51% to 71D11, 49% to 71D72

CR505813.1 Medicago truncatula genomic,

CR347018.1 Medicago truncatula genomic,

74766  MEDNFLWFSIFFSLIL*LFFLLKVGKRFKSKSSEIVTSNNLPPGPWKLPIIGSIHHLIGS  74587

74586  LPHQRMRELSQKYGPLMHLKLGETSTIVVSSKEIAKVVMKTNDGTFGQR  74440

74440  TRFLGAEIIAYGSTSIFFSPAGDYWRNIKKICTLELLSAKRAKSFQSIREEELSKLIRY  74264

74263  ISINTGSTINLTDEISSMTYNIISRATFGDKCNDQEAFILFIKECTRVVESVNIPNLFPS  74084

74083  QHWLHVISGMVHKLKTMHRSGDMVLEKIINKAITKTSGDGSLLSCLLNLKDESSQTGF  73910

73909  HLTTN

       FAIIQ (0)

71756  DIIIGGSEPSTTTMEWAFSEMLKNPRILKRAQEEVRHAFVSRGYVDEKDLEELKFLK  71586

71585  AVIKETFRLHPPNPLLLRECAETCEINGYTIPGGTHVLVNTWAIARDQKNWSDGDKFYPE  71406

71405  RFLDSPIDYKGSNFDFLPFGAGKRMCPGILFATPTIELPLAQLLFYFDWQLPFGISHENL  71226

71225  DMTEAFGSVAKKKSELFVIPIPYNQ*  71148

 

>CYP71D89 CR955010.2c  Medicago truncatula chromosome 5

CR931743.1b  Medicago truncatula chromosome 5

CG972888.1 Medicago truncatula genomic clone

92% to CR931743.1a

96163  MENNFLWLYILLSLIVLKLLILNVGKLFKSKSSDKNTTSNLPPGPWKLPIIGSIHHLIGS  96342

96343  LPHHRMRELSQKYGPLMHLQLGETSVIVVSSKEIAQEVLKTNEVIFPQRPRSLGLEIVSY  96522

96523  GCTDIAFSPYGEYWRQVRKICTLELLSVKRVRSFQSIREEEVSKLIRYLSINKGSTINFT  96702

96703  DEILAMTYNIASRASFGDNCKDKEAYILFMKESMSVAESFTIHNLFPSQHWLHVITGMMH  96882

96883  KLKRLHRSGDMFLQNIINNKVTKKTSEDGSLLSYLLNLKHDGSSNPDGFHLTINNIKAVIQ  97065

97356  TMLIGGSEPASLTIQWAFSEMLKNPRVMKKAQEEVRQAFGSRGYVDEKD  97502

97503  LQKLKFLKAVIKETLRLHPSNPIFPRECIETCEINGYTIPAGTQVFVNSWAIGRDEKYWI  97682

97683  EGEKFYPERFLDSPINFRGSNFEFIPFGAGKRMCPGISFAASSIELPLAQLLYSFDWKLP  97862

97863  SGTTHENFDMTESFGATVKRKSDLFVIPIPYNP*  97964

 

>CYP71D89 CR931743.1b  Medicago truncatula chromosome 5

CG972888.1 Medicago truncatula genomic clone

109306  FGSRGYVDEKDLQKLKFLKAVIKETLRLHPSNPIFPRECIETCEINGYTIPAGTQVFVN  109130

109129  SWAIGRDEKYWIEGEKFYPERFLDSPINFRGSNFEFIPFGAGKRMCPGISFAASSIELPL  108950

108949  AQLLYSFDWKLPSGTTHENFDMTESFGATVKRKSDLFVIPIPYNP  108815

 

>CYP71D90 CR955010.2d  Medicago truncatula chromosome 5

Identical to CR931743.1a, runs off the end

103365  MENNFLWFSILLSLIVLKCLILNVGKRLKSKSSDNNTTSKLPPGPWKLPIIGSIHHMIGS  103544

103545  LPHHSMRELSQKYGPLMHLKLGETSAIVVSSKEIAKEVLKTNEITFPQRPRSLGLEIVSY  103724

103725  GCTDIAFSPYGEYWRQLRKICTLELLSVKRVRSYQSIREEEVSKLIRYISINTGSTINLT  103904

103905  DEILSLTYSITSRASFGDNCKDNEAYILFMKESMSVAESFSIHNLFPSQHWLHVISGMVH  104084

104085  KLKRLHRSGDMFLQNIINNKVTKKTSEDGSLLSYLLNLKHDASNPDGFHLTINNIKAVIQ  104264

        TMLIGGSETSSLTIQWAFSEMLKNPRVMKKAQEEVRQA  105004

 

>CYP71D90 CR931743.1a  Medicago truncatula chromosome 5

CR507661.1 Medicago truncatula genomic,

52% to CYP71D64

103411  MENNFLWFSILLSLIVLKCLILNVGKRLKSKSSDNNTTSKLPPGPWKLPIIGSIHHMIG  103235

103234  SLPHHSMRELSQKYGPLMHLKLGETSAIVVSSKEIAKEVLKTNEITFPQRPRSLGLEIV  103058

103057  SYGCTDIAFSPYGEYWRQLRKICTLELLSVKRVRSYQSIREEEVSKLIRYISINTGSTIN  102878

102877  LTDEILSLTYSITSRASFGDNCKDNEAYILFMKESMSVAESFSIHNLFPSQHWLHVISGM  102698

102697  VHKLKRLHRSGDMFLQNIINNKVTKKTSEDGSLLSYLLNLKHDASNPDGFHLTINNI  102527

102526  KAVIQ (0) 102512

101885  TMLIGGSETSSLTIQWAFSEMLKNPRVMKKAQEEVRQAFGSRGYVDEKDLQELKYLK  101715

101714  AVIKETLRVHPPNPVFPRECIETCEINGYTIPAGTQVFVNAWAIGRDQKYWIEGEKFYP  101538

101537  ERFLDSSIDFRGSNFEFIPFGAGKRMCPGISFAASSIELPLAQLLYSFDWKLPSGTTHEN  101358

101357  FDMTESFGATVKRKSDLFVIPIPYNP  101280

 

>CYP71D91P CG942476.1 Medicago truncatula genomic clone

64% to CYP71D90 CR931743.1a

375  DMFVAGSDTSLAIIEWAISEMLKNPTTMIKAQQEVREHFGSKGYIDETSLQGLKYLKAV  551

552  IKETLRLHPPFPLLLPRECRETCEIKGYTIHAGNKVIVNAWAIGRDPKYWSEPEKFIRR  728

729  DFWRVH*L*GF*Y*YIPFGAGRRICPGI  812

 

>CYP71D92 CG955915.1 Medicago truncatula genomic clone

83% to 71D79 AC145061.27k 71clan

CG921977.1 Medicago truncatula genomic

CR509083

CG974446.1 Medicago truncatula genomic

CR507771.1 Medicago truncatula genomic

CG936151.1 Medicago truncatula genomic

CR490095.1 Medicago truncatula genomic

CG961326.1 Medicago truncatula genomic

704  MAFQILSFFTIFMFMIIALKIRNHYKKYDFGKNIPPGPWKLPILGNILHLVATNPPRRLRDLAK  513

512  KYGPLMHLQLGEIFFIVISSPEVAKEVLKTHDIIFASRPHLLATDIASYNSMDIAFSPYG  333

332  DYWRQLRKICAIELLSTRRVKSLWPVRQKEINSLLKKIASNEGSEFNLTEEVMSTMYT  159

 FTSKAAFGKKYL

     EQEEFISVVKQLIKLAGGFYIGDLFPSAQWIQNISGLKPK

3    LEKLSQQVDRILGHIITDHKEKISRRENEGLPEADEDLIDCLLKFVESGSDMDFELTID  179

180  NVKAIIL  (0) 200

428  DVFSAGSETAATTVNWAMAEMIKDPRILKKAQAEVRNGFDRRGMVDEATIAEFKYL  595

596  KSIIKESLRLHPSVPLLLPRESREACEINGYRIPVKSRVLINA

     WAMGRDPKYWNDPDKFYPERFIDSSIDFSGTNFEF  179

180  IPFGAGRRICPGMNYGLANVEQVLALLLYHFDWKLPNGMKNEELELGEEFGVTMARKGDL  359

360  YLIPITSHQSLVI* 374

 

>CR493990.1  CR493990 MTH2 Medicago truncatula genomic

92% to CG955915

231  AGSETAATTVNWAMAEMMKNPRVLKKAQAEVRKGFDRRGMVDEATIGEFKYLKSIIKES  55

54   LRLHPSVPLLL  22

 

>CYP71D93 AC142096.25  Medicago truncatula ABE91764 (CYP71D67)

complement(join(121981..122095,122151..122599,

122731..123627)) assembly wrong at end

wrong assembly at heme due to a frameshift

Identical to AC142507.13

42% to 71B23, 47% to 71K4

MDSKIFALLSFFLFMLVALKIRKNLKKKGSSPNLPPGPWKLPII

GHIHHLVTSTPHQKLRDLAKIHGPLMQLQLGEIFAIVVSSPDYAKEVLKTHDVIFASR

PKILAIEILSYGFTNIGFSPYGNYWRHLRKICTMELLSQKHVSSFHPIREEVFTNLIK

RIGSKQGSSINLTELVVSSTFAILSRAAFGNKCKDQEEFASLGKGESIAGGFDIGELF

PSSKWIQLVSGLRPKLERLHRRIDRILENIIIEHKEANSKAKECQEEAEEDLVDVLLK

YQRRNDNEKDICLTDNNIKAVLLDMFGAGGDTSSTTIVWAMAELVRDERVMKKAQDEV

REMFNTKGIVGENYINELTYLKSVVKETLRLHPPAPLLLPRECEQACEIDGYHIPTKS

KVIVNAWAIGRDPKYWTEPERFYPERFIGSSIDYKGNNFEYIPFGSGR

122175  RICPGITFGLVNVELALALLLYHFDWRLPDGTKGEDLYMTEQFGATVKRKDDL  122017

YLIPTAPLPIW

 

>CYP71D93 AC142507.13  Medicago truncatula, ABE90841 (CYP71D67) correct translation

join(28033..28929,29061..29678)

53% to 71D70

MDSKIFALLSFFLFMLVALKIRKNLKKKGSSPNLPPGPWKLPII

GHIHHLVTSTPHQKLRDLAKIHGPLMQLQLGEIFAIVVSSPDYAKEVLKTHDVIFASR

PKILAIEILSYGFTNIGFSPYGNYWRHLRKICTMELLSQKHVSSFHPIREEVFTNLIK

RIGSKQGSSINLTELVVSSTFAILSRAAFGNKCKDQEEFASLGKGESIAGGFDIGELF

PSSKWIQLVSGLRPKLERLHRRIDRILENIIIEHKEANSKAKECQEEAEEDLVDVLLK

YQRRNDNEKDICLTDNNIKAVLLDMFGAGGDTSSTTIVWAMAELVRDERVMKKAQDEV

REMFNTKGIVGENYINELTYLKSVVKETLRLHPPAPLLLPRECEQACEIDGYHIPTKS

KVIVNAWAIGRDPKYWTEPERFYPERFIGSSIDYKGNNFEYIPFGSGRRICPGITFGL

VNVELALALLLYHFDWRLPDGTKGEDLDMTEQFGATVKRKDDLYLIPTAPLPIW

 

>CYP73A3 Medicago sativa L11046

elicitorinducible cinnamic acid 4hydroxylase mRNA, complete cds.

MDLLLLEKTLLALFIAATIAVTISKLRGKRFKLPPGPIPVPIFGYWLQVGD

DLNHRNLTDYAKRFGEIFLLRMGQRNLVVVSSPELAKEVLHTQCVEFGSRTRNVVFDIFT

GKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWESEAESVVNDVKNNAEASVGG

IVIRKRLQLMMYNIMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPIL

RPFLKGYLKVCKEVKDRRLQLFKDYFVDERKKLESTKSTTSNDGLKCAIDHILDAQKKGE

INDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQDIQNKVREEMDRVLGPGHQVTEPD

LHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDPKLNGFDIPAESKILVNAWWLPNNPAHW

KKPEEFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNVEL

LPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF*

 

>CYP73A3 Medicago truncatula DQ335792 04AUG2006

DEFINITION cytochrome P450 monooxygenase CYP73A3v2

(CYP73A3v2) mRNA, complete cds.

AC141923.27  Medicago truncatula, complete sequence

complement(join(54438..55036,56622..56758,57136..57920))

84% to 73A5 ORTHOLOG

MDLLLLEKTLLALFIAATIAITISKLRGKRFKLPPGPIPVPIFG

NWLQVGDDLNHRNLTDYAKRFGEMFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRT

RNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWESEAESVVND

VKNNAEASIGGIVIRKRLQLMMYNIMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQ

SFEYNYGDFIPILRPFLKGYLKVCKEVKDRRLQLFKDYFVDERKKLESTKSTTSNDGL

KCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQGIQNKVR

EEMDRVLGPGHQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLNGFDIP

AESKILVNAWWLANNPAHWKKPEEFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPG

IILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF

 

>CG947966.1 Medicago truncatula genomic clone

69% to 73A3

383  EKHEIKCAIDHIIDAEKKGEISEDNVTYIVENINVAAIETTLWSMEWAIAELVNHPE  553

554  VQSKIRDEISKVLKGESVTESNLNQLPYLQATLKEILRLHTPIPLLVPHMNLEEAKLG  727

728  EYTIPKESKVVVNAWWLANNPLWWEKPEEFRPERYLEEENGIDAVAGGGKVDFRF  892

893  VPFGVGRRSCPG  928

 

>CR315133.1  CR315133 MTE1 Medicago truncatula genomic

CR350654 54% to 75B1

EEVTRLVNNLASNHSNSKVVNLGQLLNVCTTN  248

249  ALARAVIGRRVFNEGNGDFDPKAGDFKAMVDELMVLGGVFNIGDFIPSLEWLDLQGLQAK  428

429  MKKLHKRFDAFLTNIIDEHKTSISRSEKHKDLLSTLLSLKEETYEDGNQLT  581

 

>CF068371.1 Medicago truncatula cDNA clone

AW267898.1. AW256379.1 BQ165056.1

60% to 75B1 N-term

MSLWFIAIASFTLCILIYRFMKFAKRSSSLPLPPGPKPWPIIGNMPHLGPAPHQSI

AALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPNTGAKYIAYNYQDLV

FAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQ

569  EEVARLTSNLASNYSDTKAVNLGQLLNVCTTNALARVMLGRRVFNDG  709

711  NGGCDPKADEFKEM  752

 

>CYP76E1 From Chris Steele (5/15/98) alfalfa 76E1 A11

searched nr 4/1/2000 94% to DQ335812.1

MDHQTLLLVI TFVSATILIF FLRKSNQTQN STKLPPGPYP LPIIGNILEL

GKNPHKALTK LSKIYGPIMT LKLGSITTIV ISSPQVAKQV LHDNSQIFSN

RTVPHAITAV DHDKFSVGWV PTLNLWKKLR KNCATKVFST KMLDSTKILR

QQKLQELLDY VNEKSHNGEV FDIGETVFIN VLNSISNTLF SMDLAHSTPD

EKSQEFKTII WGIMEEAGKP NISDFFPILR PLDPQGLYAR MTNHMKKLCE

IFDGIIEERI CLKDSKGDYE VCNDVLDSLL NINIGEATSE LSRNEMVHLF

LDLFVAGIDT TSSMIEWIIA ELLRNPDKLT KVRKELCQTI GKGETIEESH

ISKLPFLQAV VKETFRLHPP IPLLLPHKCD ELVNILDFNV PKNAQVLVNV

WAMGRDPAIW DNPNTFVPER FMECDINYKG NNFELIPFGA GKRICPGLPL

AHRTMHLMVA SLLHNFEWNL ADGLIPEHLN MDEQFGLTLK RVQPLRVEAI

SSA

 

>CG946075.1 Medicago truncatula genomic clone

80% to 76E1 N-term

1    PPGPNPFPIIGHILELGKNPHKALTKLSKTYGPIMTLKLGTLTTIVISSPQLAKQVLQEN  180

181  SQIFSNRVVSDAICALDHHKFSIGTLPTLALWKKLRKICATQVFSTKMLDSTKILRQ  351

352  QKLQELLDYVNEKSNKGEVFDIGEAVFNTVLNSISNTLFSIDLAHSTPDEKSQEFKKIIG  531

532  SFMEEAGKPNVSDFFPILRPFDPQGVHAKMTSYMKKLCDIFDGIIEKRISSRSSKVDYVV  711

712  C  714

 

>CYP76E1 ortholog  DQ335808                 761 bp    mRNA    linear   PLN 04AUG2006

Same exact seq as DQ335812

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP76E2 (CYP76E2)

mRNA, partial cds.

CR300436.1 Medicago truncatula genomic,

CR327510

BF647092.1 BF645990.1  BQ140002 BE124120.1 ESTs

94% to 76E1, probable ortholog

mDHQTLLLVISFVSATIL 

IFILRKSNQTQNSTKLPPGPKPLPIIGNILELGKNPHKALTKLSKIYGPIMTLKLGSIT

TIVISSPQVAKQVLHDNSQIFSNRTVPHAISAVDHDKFSVGWVPTLNLWKKLRKSCATKV

FSTKMLDSTRNLRQQKLQELLDYVNEKSNKGEVFDIGEAVFTNVLNSISNTLFSMDLAHS

TVPDEKSQEFKTIIWGIMEEAGKPNISDFFPILRPLDPQGLYARMTNHMKK

LCEIFDGIIEERIRSRSSKVVEVCNDVLDSLLNINIGEATSELSRSE 

MVHLFLDLFVAGIDTTSSIIEWIIAELLRNPDKLTKVRKELCQT

IGKGETIEESHIFKLPFLQAVVKETFRLHPPIPLLLPHKCDELVNILGFNVPKNAQVL

VNVWAMGRDPTIWKNPDMFAPERFLECDINYKGNNFELIPFGAGKRICPGLPLAHRTM

HLMVASLLHNFEWNLADGLIPEQLNMDEQFGLTLKRVQPLRVQAISSA*

 

>CYP76E2 TC107627 76% to 76E1 Medicago sativa, 82% to DQ355808 76E1 partial seq

ESTs CA917001.1 (aa 40-316) CA918016.1 (aa 244-448), GSS seq CG923322.1 (aa 90-289)

2 LISFVSASILILILRKLNQTQNSTKLPPGPKPLPIIGNILQLGKNPHRTLTNLSNIYG 175

176 PIMTLKLGTLTTIVISSPQLAKQVLHENSQIFSNRTVPHAIHALDHNKFSLGWLPTLALW 355

356 KKLRKICATKVFSTKMLDSTKNIRQQKLQVLLDYVKEKCNKGEAFDIGEAVFTTVLNSV 532

533 SNTFFSMDLAHSTPDEKSQVFENILRGLSELSGTSNIADFFPILRPLDPQ   682

RLYAKMAIHLGSLCEIFGGIIEERRASKIDSDQVCNDVLDSLLNNDGETIFDQLSPKEMFHL

871 FPDLFAAGIDTTSSTIEWIMVELLRNPSNMTKARTELSKVIGKDEIIEESDIFKLPFLQA 1050

1051 VVKETFRLHPPAPLLVPHKCDESVNILGFNVPKNAQVIVNVWAMGRDPTIWKNPNMFMPE 1230

1231 RFLECDINYKGNHFELIPFGAGKRICPGLSLAHRNVHFI 1347

 

>76F5 C Steele, June 13, 1997 Medicago sativa (alfalfa)

85% to CAB56741.1 Cicer arietinum 76F1

1  MDMLPGSTLS YLVIIFTFSI LLLIKFLIPT NKTNQKNHSK LPPGPSPLPI

 

51  IGNLLKLGNK PHHSLANLSN IHGPIMTLKL GQVTTIVISS ADIAREVLQT

 

101  HDTLLSNRTV PDALSVLNHD QYSLSFMRVS PRWRDLRKIC NNQLFSNKTL

 

151  DSSQALRRRK LQDLLDDIKK CSEIEEAVDI GRVAFMTTIN LLSNTFFSAD

 

201  FVHSAEEAGE YKEIVVSILK EVGAPNLSDF FPMLKVFDLQ GIRRRSVVSV

 

251  KKVLSIFRSF VGERLKMREG TGSIGNDDVL DALLNISMDD GKIEMDKDEI

 

301  EHLLLNIFVA GTDTTTYTLE WAMAELMHNP EIMSKVQKEL EQVVGKGIAI

 

351  QETDIAKLPY MQAVIKETFR LHPPVPLLLP RKAETDVEIG DYIIPKDAQV

 

401  LVNAWVIGRD PNKWDNANVF VPERFLDSEI DVKGHHFELI PFGSGRRICP

 

451  GLPLAIRMLP MMLGSLVNCF DWKLEDGLNI DDLNKEDEYG ITLEKSQPVR

 

501 IVPIKLTIQ*

 

>CR501618.1 Medicago truncatula genomic,

98% to 76F5

3    LPPGPSQLPIIGNLLKLGNKPHHSLANLSNIHGPIMTLKLGQVTTIVISSADIAKEVLQT  182

183  HDTLLSNRTVPDALSVLNHDQYSLSFMRVSPRWRDLRKICNNQLFANKTLDSSQALRRRK  362

363  LQDLLDDIKKCSEIEEAVDIGRVAFMTTINLLSNTFFSADFVHS  494

 

>CG945573.1 Medicago truncatula genomic clone

95% to 76F5 71clan

825  LLPRKAETDVKVGDYIIPKDAQVLINAWVIGRDPNKWDNANVFVPERFLDSEVDVKGHHF  646

645  ELIPFGSGRRICPGLPLAIRILPMMLGSLVNCFDWKLEDGLNIDDLNKEDEYGITLEKSQ  466

465  PLRIVPIK  442

 

>76F6 Length: 509  July 30, 1997 Medicago sativa (alfalfa)

53% to DQ335810.1

1  MDMLQSSTLS YLVIIFTFSM LLLIKFLIPT NKTNQKNHSK LPPGPSPLPI

 

51  IGNLLKLGNK PHHSLANLSN IHGPIMTLKL GQVTTIVISS ADIAKEVLQT

 

101  HDTLLSNRTV PDALSVLNHD QYSLSFMRVS PRWRDLRKIC NNQLFSNKTL

 

151  DSSQALRRRK LQDLLDDIKK CSEIDEAVDI GRVAFMTTIN LLSNTFFSAD

 

201  FVHSAEEAGE YKEIVVSILK EVGAPNLSDF FPMLTVFDLQ GIRRRSVVSV

 

251  KKVLSIFRRF VGERLKLREG TGSIENDDVL DALLNISLDD GKIEMDKDEI

 

301  EHLLLNIFVA GTDTTTYTLE WAMAELMHNP EIMSKVQKEL EQVVGKGIPI

 

351  QETDIAKLPY MQAVIKETFR LHPPVPLLLP RKAETDVEIG DYIIPKDAQV

 

401  LVNAWVIGRD PNKWDNANVF VPERFLDSEI DVKGHHFELI PFGSGRRICP

 

451  GLPLAIRMLP MMLGSLVNCF DWKLEDGLNI DDLNKEDEYG ITLEKSQPVR

 

501       IVPIKLTIQ

 

>CYP76X1 AB236753                1952 bp    mRNA    linear   PLN 06JAN2006

Trifolium pratense complete cds,

MDYVGSGMLLLLTCIVACFIGSLYARSRKSNYRLPPGPSIFTIM

SHVFELYYKPQQTLAKFAKFYGPVMLIKLCTETTVIISSSDMAKEILHTNDSLFTDRS

VPDNTTTHNHNNFSLVFLPFSPLWQHLRKICHNNLFSNKTLDGSQELRRMKLKDLLND

MHKSSLKGETVDIGRAAFKACINFLSYTFVSQDFVESLDDEYKDIVSTLLSAVGTPNI

ADHFPILKILDPQGIKRHTTKYVAKVFHALDIIIDQRMKLRKSEDYVSKNDMLDSLLD

ISKEDSQKMDKKQIKHLLLDLLVAGTETSAYGLERAMTRLVHDPKAMSKARKELEETI

GLGNPIEESDIDRLPYLNAVIKESLRLHPPAPMLLPRKARVDVEISGYTIPKGAQVLI

NEWAIGRTDIWDDADSFSPERFLGSEIDVKGRHFKLTPFGSGRRICPGSPLAVRMLHL

MLGSLINSFDWKLENNMEAKDMNLDKPLRAIPVALNKVY

 

>CT009653.2  Medicago truncatula chromosome 5

77% to 76X1

probable pseudogene middle region missing

49504  MLLLMTCMVTYFICSLLHARSRKSKLPPGPSIFTIMSHVFELYKK

       PHQTLAKFAKFYGPIMSIKL  49702

49704  CTETTIMISSSDMAKEILNTHDSLCCDRSVPDITTTHDHNNFSIVFLPFSPLLQHLRKTC  49883

49884  HYHLFSNKNLDASQELRRMKLKDLLNEI  49967

51395  AYGLERTMGELIHNPETMLKAKKELRETIGSCKLIEESDIDRLPYLQAVIKESLRLHPPA  51574

51575  PLLLPRKARVDVQIAVYTIPKGAQIRINEWAIGRTNIWDDADLFSPERFLGSEIDIKGRH  51754

51755  FNLTPFGSGRRICPGSPLAIRMMHSMLGSLINSFNWKLENDMEPKKMNLDKSLRAIPVEL  51934

51935  IK  51940

 

>CYP76X2 DQ335810                1359 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP76O1 (CYP76O1)

mRNA, partial cds.

CR970759.1 Medicago truncatula genomic,

CG949252.1 Medicago truncatula genomic clone

CG965111.1

CG929972.1

CG968268, CG965716

AL368565.1 EST for Cterm

MDYGSGAMLFLLTCIVTYFFGSFLGRSKKPNYKLPPGPSFFTIM

SNVVELYNKPQQTLAEFAKLYGPIMRIKLCTETTIIISSSHMAKEILFTNDSLFTDRS

VPDNTTTHNHNNFSLVFLPFSPLWQHLRKICHNNLFSTKTLDGSQELRRRKLKDLLND

MHKSSITGEAVDVGRAAFKACINFLSYTFVSQDFVENLDDEYKNIVSTLLSAVGTPNI

ADHFPVLKIFDPQGIRRHTTLYVSKVFYALDIIIDQRMKMRQSEQYVSKNDMLDALLD

ISKEDNQKMDKRQIKHLLLDLLVAGTETSAYGLERAMSEVVRHPEVMSKAKKELEETI

GLGKPIEESDIDRLPYLNAVIKESLRLHPPAPMLLPRKARVDVEIAGYTIPKGAQVLI

NEWAIGRTDIWDDAHLFSPERFLGSEIDVKGRHFKLTP

FGSGRRICPGSPLAVRMLHLMLGSLINSFDWKLENNMEPKDMNLDKQLRAIPVALNKVY*

 

>CG920638.1 Medicago truncatula genomic clone

1 aa diff to 76X2

966  FSPERFLGSEIDVKSRHFKLTPFGSGRRICPGSPLAVRML  847

846  HLMLGSLINSFD  811

 

>CYP76X3 Medicago truncatula

DQ394573 (1 amino acid difference)

DEFINITION cytochrome P450 monooxygenase CYP76W1 (CYP76W1)

CT027663.2 genomic seq

106191 MATIPYMDFLSYILMFLLIFIVTQVFYSLFATKMRNKTNSKLPPGPFPLPIVGNLFVMNN 106012

106011 KPHKSLAKLAKIYGPILTLKLGQVTTIVISSPDMAKEILQTHDSLLSDRTVPHALTAFNH 105832

105831 DQFGVGFLSLSPLWRE 105784

105783  MRRVCKNQLFSNKSLDASQYLRRGKIDELINYVSQCSLKGEAIDMGKLAFKTSINLLSNT  105604

105603  VFSVDFANNKDLVMDMSETVGSPNMADFFPLLRLIDPQGIKRTYVFYVGKLFGIFDNIID  105424

105423  QKLKLREGDGFVTNNDMLDSLLAEENKKELDREKIQHLLH  105304

104984  DLLVGGTDTTTYTLEWAMAELLHNPNVMSKVKKELEETIGIGNPIEESDVTRLPYLQAII  104805

104804  KETLRLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVWDNPNLFSPERF  104625

104624  LGTKLDIKGQNFQLTPFGSGRRICPGLPLAMRMLHMMLGSLLISFDWKLENGMKPEEIDM  104445

104444  EDAIQGLALRKCESLRVIPTKISN  104373

 

>CYP76X4 89% to DQ394573

CT027663.2 genomic seq

100673 MATIPYMNILSYILIFLLIFIVTQVFYSLFATKMRNKTNSKLPPGPFPLPIVGNLFVMNN 100494

100493 KPHKSLAKLAKIYGPILSLKLGQVTTIVVSSADLAKEILQTHDSLLSDRTVPHALTAFNH 100314

100313 DQFGVGFLPLSPLWRE 100266

100265  MRKVCKNQLFSNKSLDANQCIRRTKIDELIGYVSQRNLKGEAIDMGKVAFRTSINMLSNT  100086

100085  IFSVDFANNSAGTNENKENKDLVMNMAETVGKPNMADFFPLLRLIDPQGIKKTYMFYIGK  99906

99905   LFNVFDNIIDQRLKLREEDGFFTNNDMLDSLLDIPEENRKELDREKIEHLLH  99750

99295  DLLVGGTDTTTYTLEWAMAELLHNPNIMSKVKKELEDTIGIGNPLEES  99152

99151  DITRLPYLQAVIKETLRLHPIAPLLLPRKAKEDVEVNGYTIPKDAQIFVNVWAIGRDPEV  98972

98971  WDNPYLFSPERFLGTKLDIKGQNFQLTPFGSGRRICPGLPLAMRMLHMMLGSLLISFDWK  98792

98791  LENDMKPEEIDMEDAIQGLALRKCESLRVIPTKISN  98684

 

>CYP76X5 98% to DQ394573

CT027663.2 genomic seq

61155 MATIPYMDILSYILIFLLIFIVTQVFYSLFATKMRNKTNSKLPPGPFPLPIVGNLFVMNN 61334

61335 KPHKSLAKLAKIYGPILTLKLGQVTTIVISSPDMAKEILQTHDSLLSDRTVPHALTAFNH 61514

61515 DQFGVGFLSLSPLWRE 61562

61563  MRRVCKNQLFSNKSLDASQYLRRGKIDELINYVSQCSLKGEAIDMGKLAFKTSINLLSNT  61742

61743  VFSVDFANNKDLVMDMSETVGSPNMADFFPLLRLIDPQGIKRTYVFYVGKLFGIFDNIID  61922

61923  QKLKLREGDGFVANNDMLDSLLAEENKKELDREKIQHLLH  62042

62362  DLLVGGTDTTTYTLEWAMAELLHNPNIMSKVKKELEDTIGIGNPIEESDVARLPYLQAII  62541

62542  KETLRLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVWDNPNLFSPKRF  62721

62722  LGTKLDIKGQNFQLTPFGSGRRICPGLPLAMRMLHMMLGSLLISFDWKLENDMKPEEIDM  62901

62902  EDAIQGLALRKCESLRVIPTKISN  62973

 

>CG926069.1 Medicago truncatula genomic clone

100% to 76X5 or 76X4

31   PFGSGRRICPGLPLAMRMLHMMLGSLLISFDWKLENDMKPEEIDMEDAIQGLALRKCESL  210

211  RVIPTKIS  234

 

>CR497953.1 Medicago truncatula genomic,

70% to 76X4, 69% to 76F6 71clan

506  DLFVAGTDTTASTLEWAMTELIRNPEAMLKAKKELGKMIGCSVPLEESDISKLPYLQAI  330

329  IKETLRLHPPVPLLLPRKAERNVDIGGYTIPKDAQVMVNVWTIGRDPTIWLNPTLFSPER  150

149  FLGSDIDVKGRNFELVPFGAGRRICPGLQLANRMLLLMLGSLVNSFDW  6

 

>CR337387.1 Medicago truncatula genomic,

CR482914.1 Medicago truncatula genomic,

54% to 76X4 71clan

462  EMFLAGSETTSSTIEWAMTELLCNRDCMLKLKTELSSVIGTKDVEESDIDKLPYLQGV  289

288  VKETLRLHPPIPLLVPRKAVQDTEFMGYFVPKDTQVFVNTWAIGRDPDVWDEPRVFKPER  109

108  FCDINNKSDYRGQHYEFIPFGAGRRMCAGIPLA  10 HRILHLVLGSLLHRFDWELDCN  368

369  ITPLTMDMKDRLGITMRKFQPLLAVP  446

 

>CR296479.1 Medicago truncatula genomic

76X5 or 76X3

359  LLIFIVTQVFYSLFATKMRNKTNSKLPPGPFPLPIVGNLFVMNNKPHKSLAKLAKIYGPI  538

539  LTLKLGQVTTIVISSPDMAKEILQTHDSLLSDR  637

 

>CR317940.1 Medicago truncatula genomic,

69% to 76X3

751  LHFCYQRKAKIDVKIRGYIVPKGAQVLINEWAIGRNPNIWDNPNLFSPQRFLGSEINFKG  572

571  QNFQLTPFGSGKK  533

537  RRMCPGMPLAIRMLHTMLGSLINCFAWKLQNGDRDID  427

 

>CG956074.1 Medicago truncatula genomic clone

83% to CR336633.1 71clan 51% to 76X3

545  NLFTAGTDTTASTTEWAISELIKNPKLMACIQNELDTVVGRDRLVTEQDLTNLPYLEAV  369

368  VKETLRLHPSTPLSLPRVATQSCEIFNYHIPKGATLLVNVWAISRDPKEWSNPLEFKPER  189

188  FLPGGEKFDVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAKAYDWELENGVSP  9

8    E  6

 

>CR336633.1 Medicago truncatula genomic,

83% to CG956074.1 71clan

81   DDIPNLPYLQAVIKETFRLHPSTPLSLPRIASESCEIFGYHIPKGSTLLVNVWAIARDPK  260

261  EWVDPLEFKPERFLPGGEKCDVDVKGNDFEVIPFGAGRRICPGMSLGLRMVQLLTATLAH  440

441  SFDWELENGLNAGKMNMDEGYGLTLQRAVPLLVHPKPR  554

 

>CYP77A12 DQ335813                 936 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP77A12

(CYP77A12) mRNA, partial cds.

BI266182.1 BI272505.1 CX525885.1 BQ141450.1 BE317512.2

BI271851.1 BI272578.1

CR351365.1

MTSSLFSSSASLSTYYHLIFTVLAFLLSALIFFLTQKTKSKHHN

LPPGPQGWPVVGNLFQVARSGKQFQDYVKDMKAKYGSIFTLKMGTRTMIIITDAKLVH

EAFIQKGALYASRPPENPTRNIFSANKFTVNAAVYGPVWKSLRRNMVQNMLSSTRLKE

FKSVRDKAMDKLINRLKVNAENNNGVVIVVRDARFAVFCILVVMCFGLKMDEEKLERI

DQVMKNVLITLDPRIDDFLPILSVFFSKQRKRALEVRKEQVEFLVPFIEQRRRAFQNP

GSDQTATTFSYL XTLF

DIKVHEGKKSTPSNEELVSLISEFLNGGTDTTATAVEWGIAQLIDNPEIQAKLYQE

INSIVGDKKVEEKDVEKMPYLQAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANV

EVYTAGIGEDPKLWSNPEKFDPERFLSKGEEADITGVTGVKMMPFGVGRRICPGLAIGTV

HIHLMLARMVQEFEWSAYPPGKKIDFSGKMELLV*

 

>CYP77B5 DQ394574                1218 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP77B5 (CYP77B5)

mRNA, partial cds.

AC152499.17 genomic seq complete gene

complement(join(59481..60194,60462..61274))

CG965187.1, CG933006.1

CG936582.1, CR969658

MEFIDVIMFLFALAFLRWWWRRWSKTGGGTKNLPPGVPGWPIVG

NLFQVILQRRPFIYIVRDLRLKYGPIFTMQMGQRTLIIVTEADLIHEALIQRGPQFAS

RPKDSPIRLIFSMGKCAINSAEYGPLWRSLRRNLVTEMISPLRVKQCSWIRKWAMEAH

MRRIQNEAHENGFVEVMSNCRLTICSILICLCFGAKITEERIRDIESVLKEVMLITLP

KLPDFLPVLTPLFRGHVKEAKKLRKKQLELIAPLIRKRKVYVESDGKCGDPEMVSAIG

AAYVDSLFGLEVPSRGILGDEELVTLVSEIISAGTDTSATAIEWALLHLVMDQEIQER

LYREIVDCVGKCGIVMDSDVEKMPYLCAIVKETFRRHPPSHFVLSH

AATEETKLGGYT

IPADASVEFYTAWLSENPNTWKDPDVFRPERFLNGDGVDVDITGTKEMKMMPFGAGRR

ICPAWTLGTLHINMLLAKMVLAFRWLPVPNSPPDPTETFAFTVVMKNPLKAVIVPRSI*

 

>CYP78A29 DQ335794                2099 bp    mRNA    linear   PLN 04AUG2006

CG964690.1 Medicago truncatula genomic clone

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP78F1 (CYP78F1)

mRNA, complete cds.

MSTNIDNLWIFALASKCTQENIAYSLLIMALLWITMTFFYWSHP

GGPAWGKYYYSSNYSTTKTNNKNNLNSSTKPSTTTSSSIFIPGPKGYPLFGSMNLMSS

SLAHHRIASTAKTCKATRLMAFSLGDTRAMVTCNPDVAKEILHSSVFADRPIKESAYS

LMFNRAIGFAPYGVYWRTLRKISTNHLFSPMQIKSSGPQRSEIATQMIDLFRNRHLHG

GFCVRDVLKKASLNNMMCSVFGQRFKIDEVNERMMELSGLVEQGYDLLGGLNWGDHLP

FLKDFDVQKIRFSCSELVPKVNRFVGSIISDHRADKNQTNKDFVHVLLSLQEPDKLSD

SDMIAVLWEMIFRGTDTVAVLIEWILARLVIHPDVQKKVQTELDEVASGESCAITEED

VAAMVYLPAVIKEVLRLHPPGPLLSWARLAITDTTIDGYHVPAGTTAMVNMWAISRDP

DVWRNPLEFNPERFVSEGAEFSVLGSDLRLAPFGSGRRSCPGKNLGLATVTFWVAKLL

HEFEWLPLDEVNGVDLTEVLRLSCEMANPLTVQVRPRR

 

>CR485472.1 Medicago truncatula genomic,

58% to 78A29

719  RLSTSDVQLSNGMVVPTNTTTMVNMWAITHDPNVWTNPFAFKPERFLKNEGGVEMDVRGV  540

539  DLRLAPFGAGRRVCPGRNLGLVTVSLWVARLVHKFQW  429

 

>DQ455098.1  Medicago truncatula

68% to 78B5, 71% to 78A5, 63% to 78A29

CA922946.1, AW686883, AW687610.2

DSPSSKLTLTKGNKSWSSTAVAAALELVDPPGCRNSARG

DIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVHVDKTLVPAGTTAMVNMWAISHDSS

IWEDPLTFNPERFLKEDVSVMGSDLRLAPFGAGRRVCPGRALGLATVHLWLAQLLHNFVW

LPAQVPVDLSESLKLSLEMKNPLKCSVVLRKSMTM*

 

>AC150889.3  Medicago truncatula chromosome 7

Pseudogene 54% to DQ455098.1

48777  RLAVHDVMVGEKHVPKGTTAMVNMWVITHDEKVCNEAKEFKSERXXXX  48908

48922  GSEYNGI*FDVSTFGAGRRVCPGKAMDLASVHLWLAQLLHNFKWVPCDDSPIDLD*C  49092

 

>AC148607 pseudogene fragment like CYP78

RLVVHDVMVGEKHVPKGTTAMVNIWAITHDEKVCNEAKEFKSQRGL

VDLDEYLMLYVEMKKLLVCKVVAR

 

>CR332466.1 Medicago truncatula genomic,

65% to 79A2

259  LVLGGVDNPSHAAEFAIAEMINQPDLLQRATEELDNVVGKQRLVQESDIPNLNYVKA  429

430  CAKEAFRLHPITIFNPPHVAMDNITVSKYMIPKGSHVLLSKQGLGRNPKVWNEPHKFQPE  609

610  RHLKN  624

 

>CYP79D12 AC152421.8  Medicago truncatula

complement(join(80966..81598,82049..83011))

58% TO 79D4 50% to 79B2

MDYFVVSDQLSTTLWYLILMLLVYKLLVKHQRSNQKSEEPKPKL

PPGPTPWPIVGNLPEMLANRPTFRWIQKMMNDLNTDIACIRLGNVHVITISDPEIARE

LCIKQDAIFASRPSSWSNEYVTNGYLTTALTPFGEQWKKVKKVISNELVSPLRHKWLH

DKRVEEADNIVRYVYNKCTKIGGDGIVNVSVAAQYYSGNVIRRLLLNKRYFGNGSEDY

GPGLEEIEYVEAIFTVLQYLFAFSVSDFMPCLRGLDLDGHERIIKKACKIMKKYHDPI

IEDRIQQWKNGKKIEKEDLLDVLISLKDGANNAILTEQEIKSNILELTLAAVDNPSNA

VEWGLAELINQPKLLKKATEELDSVVGKGRLVQEYDFPKLNYVKACAKEAFRRHPICD

FNLPRVAMKDTILANYFIPKGSHVYLRRQGLGTNPRIWEEPLKFNPERHLKIDGSNLS

LADPSLNVITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTWSLPPNQSNIDLSESHGG

TTKAKPLVAVAKPRLEPKIYGLY

 

>CYP79D13 AC152421.8  Medicago truncatula

complement(join(75444..76098,76277..77280))

58% TO 79D4 50% to 79B2

CR327582.1

MEYFIVIDQLSTSLWCLILMLLVYSIKHKRSTQKSEEPKLPPGP

TPWPIVGNLPEMLANRPTFRWIQKMMNDLNTDIACIRLGNVHVITISDPEIARELCIK

QDAIFASRPSSWSNEYVTNGYLTTALTPFGEQWKKVKKVISNELVSPLRHKWLHDKRV

EEADNIVRYVYNKCTKIGGDGIVNVSVAAQYYSGNVIRRLLLNKRYFGNGSEDYGPGL

EEIEYVEAIFTVLQYLFAFSVSDFMPCLRGLDLDGHERIIKKACKIMKKYHDPIIEDR

IQQWKNGKKIEKEDLLDVLISLKDGENNAILTEHEIKSNILELILAAVDNPSNVVEWG

LAELINQPELLKKATEELDSVVGKGRLVQEYDFPKLNYVKACAKEAFRRHPICDFNLP

HVAMKDTTLANYFIPKGSHVYLRRQGLGTNPRIWEEPLKFNPERHLKIDGSNLNLADP

SLDLITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTWSLPPNQPSIDLSESHAGTTKA

KPLVAVAEPRLEPKVYGLY

 

>CYP79D14 AC146720.23  Medicago truncatula

complement(join(55387..55726,55896..56007,56353..57265))

Genbank assembly is wrong

96% to AC152421.8, 52% to 79B2, 58% to 79D4

57265  MEYLVVSDQLSTTLWYLILMLLVYKFLIKHQRSTQKSEKPKPKLPPGPTPWPIVGNLPEM  57086

57085  LANRPTFRWIQKMMNDLNTDIACIRLGNVHVITISDPEIARELCIKQDAIFASRPSSWSN  56906

56905  EYVTNGYLTTALTPFGEQWKKVKKVISNELVSPLRHKWLHDKRVEEADNIVRYVYNKCTK  56726

56725  IGGDGIVNVSVAAQYYSGDVIRRLLLNKRYFGNGSEDYGPGLEEIEYVEAIFTVLQYLFA  56546

56545  FSVSDFMPCLRGLDLDGHERIIKKACKIMKKYHDPIIEDRIQQWKNGKKIEKEDLLDVLI  56366

56365  SLKDGENNAILTEQEIKSNIL  56303

56023  ELTLAAVDNPSNAVEWGLAELINQPELLKKATEELDSVVGKGRLVQEYDFPKLNYVKACA  55844

55843  KEAFRRHPICDFNLPH  55796

55791  VAMKDTTLANYFIPKGSHVYLRRQGLGINPRVWKEPLKFNPERHLKIDGSNLSLADPSL  55615

55614  DLITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTWSLPPNQSDIDLSESHGGTTKAKPLV  55435

55434  AVAEPRLEPNIYGLY  55390

 

>AC125480.33 Medicago truncatula

join(45599..45845,46411..46837,47209..47926)

Genbank entry has poor assembly, like 79D4

57% to 79D3 pseudogene

38400  PWPIVGSLPEMIANRPTLKWIQ  38335

38410  IIENRIQERKNGKKTDKEDLLDILISLKDADNN  38508

38511  NALLTEQEIKSVIL  38552

45539  DLTLAAVDNPSSAVEWGLAEMINQPELIRKAIEELDNVVGTRRLVQESDIPKLDYVKACA  45718

45719  REAFRRHPINDFNLPHMSMENTVVDNYYIPKGSYVILRRQGLGTNPRIWTEPLKFKPDRH  45898

45899  LNKTNGSNLDLEYPTLNVITFST*RRGCPELLLRISMTLMLFARMLHAFIWSVPPGHSSI  46078

46079  DLFESHGGTTKAKPLVALAESRLTSEVYHL  46168

 

>CG957645.1 Medicago truncatula genomic clone

CG943707.1 Medicago truncatula genomic clone

CG923358.1 Medicago truncatula genomic clone

66% to AC146720.23

766  ELMLAFVDNPSNAVEWTLAEMLNQPELFEKAMEELDNIVGKDRMVQESDIPKLNFLKT  593

592  CAREAFRLHPITDFNAPHVSIKDTMVGDYFIPKGSHVLLGRSGLGRNPKVWTEPYKFKPE  413

412  RHLKNDGSNIALTEPELKFITFSIGRRGCPGIMLGSTMTIMLLARLLHGFTWCLPPNT  239

238  TRIKFVESNGVMVLDEPLTVVAKPR  164

 

>CG928199.1 Medicago truncatula genomic clone

97% to CG957645.1

592  ELMLAFVDNPSNAVEWTLAEMLNQLELFEKAMEELDNIVGKDRMVQESDIPKL  434

433  NFLKTCAREAFRLHPITDFNAPHVSIKDTMVGDYFIPKGSHVLLGRSGLGRNPKVWIDPY  254

253  KFKPERHLKN  224

 

>CR966924.1 Medicago truncatula genomic,

89% to CG957645

511  YFIPKGSHVLLGRRGLGRNRNVWAEPYKFKPERHLKNDGSAIALTEPELKFISFSTGRRG  332

331  CPAVMLGSTMTIMLLARLLHGF  266

 

>AC121233.16  Medicago truncatula

2 pseudogene pieces

72779  TSVTLMLFATMLHAFIWSVSP  72841

72853  SIDLSESHVDTMKVNSLVALAKPR  72924

68% to AC152421.8, 54% to 79D4 48% to 79A2

73567  MINQPELLRKSIEELDNVVGKGRLVQEIDIPKLDYVKTCAKEAFRCHPISDFN  73722

73774  MEDAVVGNYYIPKGSYVVLRRQGLGMNPRIWTRPLEFKPKRHFKTNGSNLN  73926

73927  LGYPTLNVVMFSIG  73968

73968  RRGSSGLVLGTSMTLMLFARMLHAFTWSMPPGYSSIDLSESHGGTTKVKPLVALTEPR  74141

 

>CYP81E7 AY278227 Medicago truncatula isoflavone 2'hydroxylase mRNA, complete cds.

MGILSYLCYSLFYLSIFFIIRLLFQSRKFKNLPPGPTSLPIIGN

LHHLKRPLNRTFKALTEKYGNVISLWFGSRLVVVVSSLSEFQECFTKNDVVLANRPRF

LSGKYIFYNYTTLGSTSYGEHWRNLRRITSLDVLSNHRINNFAPIRRDETQRLIKKLA

EDSSTKFAEVELTFRFFDMTFNNIMRMISGKRYYGDDCDISEVQEASQFRDMVSELLQ

LSGANNKTDFMPLLKFLDFENLEKRVKRIGEKNDVFLSGLLQEQRSKKERTNTMIDHL

LNMQESQPEYYTDTIIKGLCLAMLLAGTDSSAVTLEWTMSNILNYPEVLKKVRDEVDT

HVGQDRLVDESDLPKLTYLRNVIYETLRLYTPAPLLLPHSTADECIMGGYKVPRDTIV

LINAWAIHRDPETWSEATTFKPERFDKKGELEKMIAFGMGRRACPGEGLALRAISMTL

ALLVQCFDWKRINDEKIDMSERDGFTMTKLLPLKAMCKTRPVVNKVFK

 

>CG928498.1 Medicago truncatula genomic clone

75% to 81E7

404  MLLAGTDSSAVTLEWALSCVLTHPEVLETARYEIESNVGQDRLLDESDLPKLPYLKNI  231

230  IYETLRLYTPAPLSLPHSSSDECIIGGYKVPRDTILLVNAWAIHRDPKSWSEATSSKPER  51

50   FEKKGEFDKLIAFG  9

 

>CYP81E8v1 AY278229                1577 bp    mRNA    linear   PLN 21NOV2003

DEFINITION  Medicago truncatula CYP81E8 mRNA, complete cds.

MTTFYLSLIISLFFLIITLKVFFNTSRKFKNLPPGPQCLPIIGN

LHQLKQPLHHTFHTLSQKYGQIFSLWFGSRLVVVVSSLTIAQECFTKNDIVLANRPHF

LTGKYIGYNNTTVAQSPYGDHWRNLRRILSIEILSSHRLNSFLEIRRDEIMRLIQKLA

QKSYNGFTEVELRPMFSEMTFNTIMRMVSGKRYYGNDCDVSDVEEARLFRGIIKEVVS

LGGANNVGDFLGFLRWFDFDGLEKRLKKISKRTDAFLQGLIDEHRFGKRNSNTMIDHL

LTQQQSQPEYYTDQIIKGLMVVMLLAGTDTSSVTIEWAMSNLLNHPEIMKKAKNELDT

HIGHDRQVDEHDISKLPYLQSIVYETLRLHAAAPLLVPHLSSEDFSLGGYNIPQNTIL

MVNAWVIHRDPNLWSDPTCFKPERFEKEGEVNKLLSFGLGRRACPGENLSQRTEGLTL

GLLIQCFEWKRIGEEKIDMVEAKGITAGKKTSLNAMCKVRHPLKINDVF

 

>CYP81E8v2 CT573077.2a  Medicago truncatula chromosome 5

81E8 only 5 aa diffs

58510  MTTFYLSLIISLFFLIITLKVFFNTSRKFKNLPPGPQCLPIIGNLHQLKQPLHHTFHTLSQKYG  58701

58702  QIFSLWFGSRLVVVVSSLTIAQECFTKNDIVLANRPHFLTGKYIGYNNTTVAQSPYGDHW  58881

58882  RNLRRILSIEILSSHRLNSFLEIRRDEIMRLIQKLAQKSYNGFTEVELRPMFSEMTFNTI  59061

59062  MRMVSGKRYYGNDCDVSDVEEARLFRGIIKEVVSLGGANNVGDFLGFLRWFDFDGLEKRL  59241

59242  KKISKRTDAFLQGLIDEHRFGKRNSNTMIDHLLTQQQSQPEYYTDQIIKGLM (0) 59397

60622  VMLLAGTDTSSVTIEWAMSNLLNHPEIMKKAKNELDTHIGHDRQVDEHDISKLPYL  60789

60790  QSIVYETLRLHAAAPLLVPHLSSEDFSLGGYNIPQNTILMVNAWVIHRDPNLWSDPTCFK  60969

60970  PERFEKEGEVNKLLSFGLGRRACPGENLAQRTVGLTLGLLIQCFEWKRIGEEKIDMVEAK  61149

61150  GITVGKKTSLNAMCKVRHPLKIKDVF*  61230

 

>CYP81E9 AY278228                1868 bp    mRNA    linear   PLN 21NOV2003

DEFINITION  Medicago truncatula isoflavone 3'hydroxylase mRNA, partial cds.

CR294496.1 CR500517

ALFYYSLLSLSFIITIKILLKITSRRLKNLPPGPPTIPIIGNLH

HLKHPLHRTFTTLSQTYGDIFSLWFGSRLVVVVSSPSLAHECFTKNDIILANRPRFLT

GKYIFYNYTTLGSASYGDHWRNLRRITTIDVLSNNRLNSFLGVRRDETNRLIQKLLKD

VVSEGFGFTKVELRPRLTEMTFNAMMRMISGKRYYGDDGDVSDVEEAKQFREIISEMM

SLLGANNKGDFLPLLRVVDLDNLEKRCKRIAKRSNAFLEGLIEEHRRGNIHSDGGTMI

DHLLKLSESQPEYYSDHLIKGLIQGMLLAGTDTSAVTIEWVMSELLNHPEVLKKAKEE

LDTQIGKNKLVDEQDLSKLPYLQNIISETLRLHPPAPLLLPHYSSEDCTIGEFNVPKD

TIILTNVWGIHRDPKHWNDALSFKPERFEKEEEVNKVMAFGLGRRACPGLSLAQRTVG

FTVGLLIQCFEWERESEEKLDMMEGKGITMPMKIPLRAMCKALPIANDVTK

 

>CYP81E10 CT573077.2b  Medicago truncatula chromosome 5

59% to 81E8

67332  MEQNFLLYIIFSFILLITIKLLFFSRRFKKLPPCPPSFPIIGNLHLLKQPIHRYFHDLSQKYG  67520

67521  PIFTLKFGSQFVAVVSSASIAEECFTKNDVIFANRLTSIKTKYLGFNNTNIITSSYGDHW  67700

67701  RNLRRISSIEILSTHRLNSFSEIRKDENMRLIQKLSENSHKDFTKVELRPLFAELTFNII  67880

67881  MRMVCGKRFYGNESHDAKNFRDVMNEVQQFGLGSNLGDFIPLFRWFDFSGYHKKI  68045

68046  KMVGEKMDALFQGLLDDNRNNRKENKNTMIDHLLSLQESQPDYYSDQIIKGLIM (0)  68207

68345  SLIFAGTETSATTLEWAMSNLLNHPEVVEKEKIELDNHIGQEHLIEEVEATKLKYLQNII  68524

68525  SETLRLHPAAPMLLPHLSTKACTVGGYDVPQNTMLMVNAWAIHRDPNLWADPMSFKPERF  68704

68705  EDGHQGDKHGFIPFGMGRRACPGSGLALRTLSLTLGSLIQCFEWKRIGKEGVDMTEGRGT  68884

68885  LLPMAIPLEAQCKARPIINKLFS*  68956

 

>CG961517.1 Medicago truncatula genomic clone

64% to 81E9

455  MSPLLYYSLLSLSFIFTLKLLLQRRKFKNLPPSPSITLPLIGHLHYINLPLHRSLHNLS  279

278  QKYGNIFSLWFGSRRVVVISSQALLQQCLAKHDVVLSNRPHFLTGKYLFYNYTSLDSAPY  99

98   GDHWRNLRKIITLDILSTQRLNSFRETRRK  9

 

>CYP82A5

AC157489.18h Medicago truncatula

125338  MDLVLNFQNVTTIGFLSLIFLIYLFHFRPSKVVNKGREPPMASGAWPILGHLLVLGGSK  125514

125515  TPHKTLGTMANKYGPLFTIKLGTNRALVLSNWEMAKECYTINDVAVSSRSKLVAIEHIAY  125694

125695  NQASFGFAPYGPYWREMRKIVSIFLSNRRMEQLSHVRVTEVKTSIKELFHVWSNKKNDS  125871

125872  GYMLVEMKQWFTQLVFNI  (1) 125925

126589  VFQTMAGKRYFGETAVVKEKEAQNIVKALREFMHMLGVCTMADAVPILRWMKLGVKA  126759

126760  MKETAKELDIVLDDWLVEHHKNKGLGEKVESDQDFMDMMISMLDGATIGGFDADTINKAT TL  (0) 126945

127949  ALILGATDTSTVTLTWVICLLLRNPHVLAKAKEELNNQIGEERFINDSDINKLVYLQAIVK  128131

128132  ETLRLYPPGPLSAPREFTEDCTLGGYRIKKGTRLITNLWKIQTDPSIWPDPLEFKPERFL  128311

128312  TTHKNVDAKGQHFELLPFGSGRRICPGISFGLHMIHLTLANFLHSFEIVNGSSEPVDMTE  128491

128492  NLGMTNEKATPLEILVKP HFSPKYYETM*  128578

 

>CR965915.1 Medicago truncatula genomic,

68% to 82A5

256  GTRLITNLSKLQRDPMLYSDPHEFRPERFLTTNKDVDVKGQHFELIPFGAGRRICPGISF  77

76   SIQVMQITLATLLHGF  29

 

>CYP82A6

AC157489.18g  Medicago truncatula

= TC101909 does not match (DQ335807 = TC109390)

83% to 82A1 Pisum sativum

94799  MELVLNYLNITTIALISLISLFFFLFRLSKVSHTKNPPTIPGSWPILGHLPLMRNTQT  94626

94625  PHKTLASLADRYGPIFTIKLGATHALVLNNWELAKECFTKNDIVVSSRPKPVAAEIMSYN  94446

94445  QAFIGWAPYGAYWRQLRKIVTMEILSKHRVELLSHIRVSEVQSSIKELVNTWSHQSQASG  94266

94265  QSEPLNDTKSSTNDYVSVELNKWFQQLTLNMVLRMVVGKRCFGEVEERNKEEAAEILENI  94086

94085  RDFMRLIGTFTVGDAVPFLRWLDLGGHEKEMKKCAKKFDIMLSKWLEEHREKKGVGSDDK  93906

93905  VVGERDFMDAMLLVLNDKPIEMFDADTVIKATTM (0)   93804

92685  ELIIGGSDTTAGTLTWAMSLLLKNPHVLKKAKEELNTQIGKENCVRESDVNKLVYLDAIIK  92503

92502  ETLRFYPPAPFSSPREFTEDCTIGGYHIKKGTRLMPNLWKIHRDSRVWSDPLEFKPERFL  92323

92322  TTNKDVDLGGQNFELLPFGSGRRRCAGMSLGLHMLHYILANFLHSFDILNLSPESIDLTE  92143

92142  VLEFTSTKVTPLEVLVKPCLSPKCYEIM*  92056

 

>CYP82A7

AC157489.18f  Medicago truncatula

CG929387

84146  MDFVLSNLINSTTIALLYFIIPLCLFLFGFSKFVHSKTKEAPIAEGAWPILGHLSLFSGTQSPHR  83952

83951  VLGTLADKYGPLFTIKLGSKRALILNNWEMAKECFTTHDMVVSSRPKLVATKHLGYNGAM  83772

83771  FGFGPYGPYWRQLRKIVTLEVLTNRRIEQQQHVRVSEVRASIKELFDVWSTKNNESYSSN  83592

83591  YVLVELDQWFTHLTFNMVLRMVVGKRYFGLITSSEEDESKICVKALKKLMHLFGVITVGD  83412

83411  VIPCLNFCDFGGYVKAMKETSKELDKIVDEWLKEHRHERTNLVEKLDDQGNQDIMDVLLS  83232

83231  LLDGTTIEGFDGDTIIKATIL (0)  83169

82586  TLFAGGSDTTSVTLTWALCLLLNNPLVMEKAKEELDAQIGKERCVCESDINKLTYLQAIV  82407

82406  KETLRLYPPAPLSGPREFSENCTLGGYHVIKGTRLITNLWRINTDPNIWPDPLEFKPERF  82227

82226  LTTHKDVDVRGSNFVLLPFGSGRRICPGISLGLQMLHFILASFLHSFDILNPTPELVDMS  82047

82046  ESFGLTNTKATPLKILIKPHLSINCYEIM*  81957

 

>CYP82A8

AC157489.18e  Medicago truncatula

CG922695

49698  MDLVLSSLINGTTIALLYFIPLCLILFGFSKVVHSKNKEAPIAEGAWPILGHLSLFRGTQSPHR  49507

49506  VLGTLADKYGPLFTIKLGTKHALILNNWEMAKECFTTNDTVVSSRPKLVATEHLGYNGAM  49327

49326  FGLAPYGPYWRQLRKIVTLEVLTNRRVKQQQHVRVPEVQASIKELFNVWTSKNNESYSSN  49147

49146  YVLVELDQWFTHLTFNMVLRMVVGKRYFGLTTSSEEEESKRCVNALKKWMHLLGVITVGD  48967

48966  IIPCLNFFDFGGYVKTMKETSKELDKIFDEWLKERRHKRTLVENLDDQGNQDIMDVLLSL  48787

48786  LDGTTIEGFDGDTIIKATLL  (0) 48727

47781  TMFSGGSDTSSVTLTWALCLLLNNPLVMEKAKEELDAQVGKERCLSEFDINKLIYLQAIV  47602

47601  KETLRLYPPGPLSGPREFSKNCNLGGYQVIKGTRLITNLWKIQTDPSVWPDPLEFKPERF  47422

47421  FTTHKAVDVRGNHFELLPFGSGRRKCPGISFGLQMLHFTLASFLHSFDILNPTPDAVDMS  47242

47241  EAFGSTNSKATPLEILIKPRLSHN CYEFM*  47152

 

>CYP82A9

AC157489.18d  Medicago truncatula

38710  MDLDLSSLINATTIALLISLIPLCLFLFGLSKFSHSKNKEAPIAKGAWPILGHLPIFSGKQPPHR  38516

38515  VLGPLADKYGPIFTIKLGSKHALILNNWEIAKECFTTHDMVVSSRPKLISTEHLAYGGAV  38336

38335  FGFGPYGPYWRELRKIVTLEILTNRRIIQQQHVRVSEVQTSIKELFDVWYSKKKESYPSN  38156

38155  YMLVDLKQWFTHLTFNMVLRMAVGKRYFGAKTIVEEAQRSVKALKEIMRLFGVITVGDV  37979

37978  IPCLKWFDFGGHMKAMDETSTEMDEILGEWLKEHRHKRTLTEKADDQDQDIMDVLISLLD  37799

37798  GKTMEGFDCDTIIKATIL (0)  37745

36386  TLFIGGSDTSSVTLTWAICLLLKNPLVLKKAKEELDTHVGKERLVNESDIGKLV  36225

36224  YLQAIVKETLRLHPPGPLAAPREFSENCTIGGYHVRKGTRLMLNLWKIQTDPSVWSDPLE  36045

36044  FKPERFLTTHKVVDVRGNHFELLPFGSGRRKCPAISFGLQIVHFTLASFLHSFDILNPTP  35865

35864  GLVDMTEEFGLANTKATPLEILIKPHL SLNCYEML*  35757

 

>CYP82A10P pseudogene frameshift and stop codon

AC157489.18c  Medicago truncatula

32059  MDLIHDYLTNGTALAALISIIFMYSLFLHNRTSNGSKSKEAPIVAGAWPILGHLPLLKA  31883

31882  SKAPHRTLGDLADKYGPLFTIKLGSKNALVLSNSEMAKECFTKFDVAISTRPKLVATEH  31706

31705  LAYNGAMLIL*PYGPYWRQVRKIALSEILVNRRIEKLQEICVLEVQTSIKELFNVWKSNN  31526

31525  ESNYVLVELRQWFIELNFNIVLPMIVGKRYFGAMNELDEKEAQKCIKAVEEILRLMGQF  31349

31348  TVGDAIPCLERFDFGGHVKAMKKTSKELDMILNEWLKERRNRTLNEKVDRDQDFMDALLS  31169

31168  LFDGTTIEGF  31139 31137 DADTTIKATML (0) 31105

30070  SLIAGGIDTSAITLTWAICLLLKNPHTLEKAKAELDFHVGRDKCVTKSDINKLVYLQAII  29891

29890  KETLRLYPVGPLSAPREFTENCNIGGYDVIKGTRLILNLWKIQTDHNVWSDPLKFKPERF  29711

29710  LNTYKDVDVRGCHFELLPFGSGRRICPEISFGLEMMHLILANFLHSFEILYSSSEPIDMT  29531

29530  EVFGLTVSKATPLEILVKPCL SVNCYETM*  29441

 

>CYP82A11

AC157489.18b  Medicago truncatula

CR500458

26370  MDLVLDFLSSVTSVALFSIFLFSFLFLYRSYKVSHSKEAPIVQGAWPILGHLPLLRSSQ  26194

26193  SPHRTLGALADKYGPLFTIKLGSKRALVVSNWEMAKECFTKIDLAISNRPKLEATQHLGY  26014

26013  NGAMFALAPYGSCWRQVRKIATSEILSHRHVEQQQYFHTSEVQAWIKELFNVWFSKKNES  25834

25833  SNYALVELKQWFTQLSFNIVLPVLVGKRYFGATNVANEEEAQRCIKALQELMRLLGVFT  25657

25656  IGDAIPFLKWFDFGGHVKAMKATSKELDKILGELLEERRHKRSLSKKIDHDHQDFMDALL  25477

25476  SLLDETPIEGCDSDTTIKATIL  (0) 25411

24755  TLIGGGIETTSVTLTWAICLLLRNPLILKKAKEELDAQVGKERCVRKSDIDKLVYLQAIV  24576

24575  KETLRLYPPGPLSVPREFSENCNLGGYDVRNGTRLILNLWKIHTDPNVWSDPLVFKPERF  24396

24395  LTTHKDIDFRGNHFELLPFGGGRRICPGISLGLQMLHLTLASFLHSFEILNPSSEPIDMN  24216

24215  ETFGLSNTKTTPLEILIKPRL SSNCYEIM* 24126

 

>CYP82A11 AC141109.13a partial same as 82A11 on AC157489.18

3    QELMRLLGVFTIGDAIPFLKWFDFGGHVKAMKATSKELDKILGELLEERRHKRSLSKKI  179

180  DHDHQDFMDALLSLLDETPIEGCDSDTTIKATIL   (0) 281

937  TLIGGGIETTSVTLTWAICLLLRNPLILKKAKEELDAQVGKERCVRKSDIDKLVYLQAIVK  1119

1120  ETLRLYPPGPLSVPREFSENCNLGGYDVRNGTRLILNLWKIHTDPNVWSDPLVFKPERFL  1299

1300  TTHKDIDFRGNHFELLPFGGGRRICPGISLGLQMLHLTLASFLHSFEILNPSSEPIDMNE  1479

1480  TFGLSNTKTTPLEILIKPRLSSNCYEIM  1563

 

>CG975123.1 Medicago truncatula genomic clone

CG938288.1 Medicago truncatula genomic clone

CG965470.1 Medicago truncatula genomic clone

66% to 82A11

39   PILGHLQLLLGSQGPHRTLGALADTYGPLFTIKLGSRNALVLSNWEMAEECFTKIDLAIS  218

219  DRPTLETTQHMTYNGAMFFQAPYGPYLREIKKITNLEILSNHQVEKLQPYRVMVVRTSIK  398

399  ELYNVWCRKENNESSKYLMVEVKQWFTQLNIDLVLPLLVGKRYFGSTNVIDKEEVEICVK  578

579  AIKEMLRLMGVFTVGDALPFLKWFDFGGHVKAMKKATKEMDKIIGDLLEEHQRKR  743

744  SLSDQKEVDGDHQDFMDVMLSLLDGTQLKD  833

 

>CYP82A12 AC157489.18a  Medicago truncatula

62% to 82A3, 61% to 82A4, 55% to 82A5, 48% to 82C4

21766  MDLVLDFLTSATTLALFSILLFYCLFLYRSYKVSHSKEDPIVQGAWPILGHLPLLRSSQ  21590

21589  SPHRTLGALADKYGPLFTIKIGSKRALVLSNWEMAKECFTKIDLAISTRPKGEAYKHMTY  21410

21409  NGAFLGFAPNGSYYREIRKIATSEMLTNRRVEQQQHFHILEVQRWIKELFDVWFSKKNES  21230

21229  SNYVLVEMKQWLTQLSFNIVLPMLVGKQYFGHPTNVINEEEGQRCVKALKKLMHLLGVFT  21050

21049  IGDAIPLLKWFDFGGHVKAMKATSKELDKILGDLLEEHRHKRSLGAKEVDRNHQDFMDVM  20870

20869  LSLFDGTTIEGFDSDTIIKATVL  (0) 20801

19009  NLIAGGVDTTSVTLTWAICLLLRNPLILEKAKEELDTQVGKERCVRETDIDKLVYLQAIVK  18827

18826  ETLRLYPAGPLSAPREFSENCNLDGYDVRKGTRLILNLRKIHTDPNIWSNPLEFKPERFL  18647

18646  TTHKDVDVRGHHFELLPFGGGRRICPGMSFGLQMVHLTLASFLHSFEILNPSSEPIDMTE  18467

18466  TFGLTNTKTTPLEILIKPRL SSNCYEIM* 18380

 

>CYP82A13 AC152936.21  Medicago truncatula clone mth247n14, complete sequence

79% to 82A9

CR340562, CR339782, CG966752, CG939658, CR491880, CR484658, CR481162

48325  MDLVLNSLINATPFTLLIFLISLCLFGFSKFAHSKNKEAPIAKGAWPILGHLPIFCGT  48498

48499  QAPHRILGALGDKHGPIFTIKLGPKHALVLNNWEMAKECFTTNDMIVSSRPKLVATEHLA  48678

48679  YKGAMFGFAAYGPYWRHLRKISNLEILTSRRVEHHQHIRVSEVQTSIKELFNIWSRKKNE  48858

48859  SNPSNYVLVDLKQWFTHVTFNMVLRLVVGKRYFGAKTIVDEEKAQRTVKALNEMMHLSGI  49038

49039  ITVGDVIPCFKWFDFGGHVKAMNETSKELDEILGEMLKERRHKRTLSEKVDGEDQDFMDV  49218

49219  LLSLLDGTTIEGFDCDTMIKATIL  49290

50049  TIFIGGSDTSSGALTWALSLLLKNPIAMEKAKEELDTHVGRERFVNESDIIKLVYLQAIV  50228

50229  KETLRLYPSAPLGGPREFSENCTLGGYHVTKGTRLITNLWKIQTDLSVWPNPLDFKPERF  50408

50409  LTTHKDIDVRGNHFELQPFGSGRRKCPGICFGLQMVHFTLASFLHSFDILNPTPELIDMT  50588

50589  EEFGLTNSKATPLEILIKPRLSLNCYD  50669

 

>CYP82A14 AC135464.13  Medicago truncatula, complete sequence

62% TO 82A5

23913 MDFSQNTIAIGLLSTIFLFIILFHHSKSNKTKQPPMVAGTWPIIGHLPLFSKSQATHHLLGSMA  24104

24105  DKYGPIFTIKLGTATTLAINNWKTAKECYTTNDIAVAYRPNLVAFEHMTYNYAMLGFAPY  24284

24285  GPFWREMRKIVTLNFLSNHQINLLTHICVSEVQTSIKELYNFWKNRKDENGYLLVEM  24455

24456  KKWLNELAFNIVLRMVAGKRYFGESVMVKEEEANRCLNALRDYMRLTGVFPIADAVPFLR  24635

24636  WFDFGGHEKNMKQNFKELDGVITEWLDEHKKKKSEGVDKSKEGQDFMDVMLSTIDGTNIH  24815

24816  GFHSDTVIKATTM  24854

27100  ALVLGATDTSSVTHTWALCLLLNNPHTLEKVKEEIDLHIGKERLCILESDINKL  27261

27262  VYLQAVVKETLRLYPASPLSGIREFREDCQIGGYDVKKGTRLFTNLWKIQTDPSVWPDPL  27441

27442  EFKPERFLTTHKDVDVRGNHFELLPFGSGRRMCPGISFALRSAYLTLANFLHSFEVSKTS  27621

27622  NEPIDMTAVVETTNIKVTPLEVLIKPRLSPNYY* 27723

 

>CG935430.1 Medicago truncatula genomic clone

92% to AC135464.13

566  NTENIMLNLQALVLGATDTSSVTHTWALCLLLNNPHTLEKVKEEIDLHIGKERLCILESD  745

746  INKLVYLQAVVKETLRLYPASPLSGIREFREDCQIGGYDVKKGTRLFTNLWKDPTDPSVW  925

926  PDPLEFSTERF  958

 

>CYP82D1 C Steele, July 30, 1997 13:45. A48 82D1 Medicago sativa (alfalfa)

 

1  MDVTIEYLYT IVAGVICIIL ISYSKFFRGD ARAQPKLPPL ASGGWPLIGH

 

51  LHLLGSSNQP PYITLGNLAD KYGPIFTLRV GVHNAVVVST WELAKEIFTT

 

101  HDVIISSRPK FTAAKILGHD YANFGFSPYG DYWQMMRKVT ASELLSTRRF

 

151  ETLRDIRDSE VKKSLMELCN SGFDGDLKVE MKRFLGDMNL NVIMRMIAGK

 

201  RYSNNESGDE REVRKVRWVF REFFRLTGLF VVGDAIPFLG WLDLGGHVKE

 

251  MKKAAREMDS VVCGWLEDHR HKNVIGETKM EQDFIDVLLS VLHGVHLDGY

 

301  DVDTVIKATC LTLIAGATDT TTVTITWALS LLLNNRHTLK KVQDELDEKV

 

351  GKDRLVNESD INNLVYLQAV VKETLRLYPA GPLSGARQFT KDCTVGGYNI

 

401  RAGTRLILNL WKMHRDPRVW SEPLEFQPER FLNTHKDVDV KGQHYELLPF

 

451  GGGRRSCPGI TFGLQMTNLA LASFLQAFEV TTPSNAQVDM SATFGLTNIK

 

501       TTPLEVIAKP RLPYHLLFVK EH

 

>CYP83D3 AC174315.4c  Medicago truncatula

50% to 83E9

48021  LSLLPILILFIIHIYKIRSTSRASSTPPGPKPLPLIGNLHQLDPSSPHHSLWKLSKHYGP  47842

47841  IMSLQLGYIPTLIVSSAKMAEQVLKTHDLKFASRPSFLGLRKLSYNGLDLAFAPYSPYWR  47662

47661  EMRKLCVQHLFSSQRVHSFRPVRENEVAQLIQKLSQYGGDEKGANLSEILMSLTNTIICK  47482

47481  IAFGKTYVCDYEEEVELGSGQKRSRLQVLLNEAQALLAEFYFSDNFPLLGWIDRVKGTL  47305

47304  GRLDKTFKELDLIYQRVIDDHMDNSARPKTKEQEVDDIIDILLQMMNDHSLSFDLTLDHI  47125

47124  KAVLM  47110

45603  NIFIAGTDTSSAIVVWAMTTLMNNPRVMNKVQMEIRNLYEDKYFINEDDIEKLPYLKA  45430

45429  VVKETMRLFPPSPLLVPRETIENCNIDGYEIKPKTLVYVNAWAIGRDPENWKDPEEFYPE  45250

45249  RFIMSSVDFKGKNFELIPFGSGRRMCPAMNMGVVTVELTLANLLHSFDWKLPHGFDKEQV  45070

45069  LDTKVKPGITMHKKIDLCLFPRKR  44998

 

>CYP83D4 AC174315.4b  Medicago truncatula

66% to 83D1, 52% to 83E1

41232  LLPILIILIIHIHKTKSTRRASSTPPGPKPFPLIGNLHQLDPSSPHHSLWQLSKHYGPIM  41053

41052  SLKLGYIPTLVVSSAKMAEQVLKTHDLKFASRPSFLGFRKLSYNGLDLACAPYSPYWREM  40873

40872  RKLCVHHLFSSQRAHSFRPVRENEVAQLIQKLSQYGGDEKGANLSEILMSLTNTIICKIA  40693

40692  FGKTYVCDYEEGVELGSGQRRSRLQVLLNEAQALLAEFYFSDNFPLFGWIDRVKGTLGR  40516

40515  LDKTFKELDLIYQRVIDDHMDYSARPKTKEQEVDDIIDILLQMMNDHSLSFDLTLDHIKA  40336

40335  VLM  40327

38467  NIFIAGTDTSSAAVVWAMTALMNNPRVMNKVQMEIRNLYEDKDFINEDDIEKLPYLKS  38294

38293  VVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLVYVNAWAIARDPENWNDPEEFYPE  38114

38113  RFIISSVDFKGKNFELIPFGSGRRMCPAMNMGVVTVELTLANLLHSFDWKLPHGFDKEQV  37934

37933  LDTQVKPGITMHKKIDLYLVPKKR  37862

 

>CYP83D5 AC174315.4a  Medicago truncatula

50% to 83E1

34929  LSLLPILILFIIHIHKIKNTRRASSTPPGPKPLPLIGNLHQLDPSSPHHSLWQLSKHYGP  34750

34749  IMSLKLGYIPTLVVSSAKMAEQVLKTHDLKFASRPSFLGLRKLSYNGLDLGFAPYSSYWR  34570

34569  DMKKLCALHLFSPKSLHSFRPIRENEVAELIQKLSQYDGDEKGVNLSEILISFTNAIICK  34390

34389  IAFGKKYVFDYEEEVELGSGERRSRLQVLLNEAQALLTEFYFSDHFPLLGWVDRIKGTL  34213

34212  GRLDKKFKELDLIYQQVIDDHMDNSTKPKTKEQEVADIIDIFLQMMNDNSLSFDLTLDHV  34033

34032  KAVLM  34018

33916  NIFIAGTDTSSAVVVWAMTALMNNPRVMNKVQMEIRNLYEDKDFINEDDIEKLPYLKS  33743

33742  VVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLVYVNAWAIARDPENWNDPEEFYPE  33563

33562  RFIISSVDFKGKNFELIPFGSGRRMCPAMNMGVVTVELTLANLLQSFDWNLPHGFDKEQV  33383

33382  LDTQVKPGITMHKKIDLHLVPMKR  33311

 

>CYP83E1 C Steele, July 30, 1997 13:47. B36 83D2 Medicago sativa (alfalfa)

not in Genbank

76% to DQ335787.1, 58% to DQ335788.1

1  MLPMLLLLVLCLT LPLLMFFHKH KTNTNNPPGP KGLPIIGNLL QLDISNLHLQ

 

51  FSQFSKIYGP LFSLQLGLRP AIVVSSAEIA KEVFKNNDHV FSNRPISYGQ

 

101  NILSYNGSEI VFAPYGDFWR EIRKICAIHI FSSKRVSYYS SIRIFEVKKM

 

151  IKNISVHADS SNVTNLSELL ISLSSTIICR TAFGKSYEDD GIEKSRFHGL

 

201  LHEFQALLAA SFFADYIPFT GWIDKLRGLH GRVDRNFKEF DEFYQEIIDE

 

251  HLDPNREQIT DEEDIVDVLL ELKKKRSFSF DINFDHIKGI LTDMLVAATD

 

301  TTSAASVWAM TALIKNPRVM SKVKGEIRNL GVKKDFLYED DIQNCPYLKA

 

351  VVKETLRLHL PAPLLVPRES IENCTINGYN IPAKTILYVN AWAIQRDPDI

 

401       WINPEEFYPE RFLESSINFI GQDFELIPFG AGRRICPSIP MAVASLELIL

402       451 ANLLYSFDWK LPHGLVKEDI DTSMLPGITQ HKKNPLCLIA KVPK*

 

>CR339849.1 Medicago truncatula genomic,

83% to 83E1 71clan

27   DIQNFPYLKAVIKETLRLHLPTPLLVPRESREKCIISGYKIPANTIVYVNAWAIQRDPSN  206

207  WKNPEEFYPERFLECSTNFLGQDFEFIPFGAGRRICPGISMGVASVELILANLLYSFDWK  386

387  LPHGLVKEDIDTETLPGITQHKKNPLCLV  473

 

>CYP83E8 DQ335787                1679 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP83H2 (CYP83H2)

mRNA, complete cds.

MLSLLLLVLCLTFPLLLFFQKRRRSLNEPHPPGPRGLPIIGNLH

QLDNSILYLQFSKLSKIYGPIFSLQLGLRSAIVVSSAEIAKEIFKNNDQVFSNRPVLY

GQQKLSYNGSDIAFSQYSDFWREIRKLCVIHIFSAKRVSYYSSIRKFEVKQMIKNISN

HAASSNVTNLSEILTSLYSTMICRIAFGKRYEEQGIERSKFHGMLHEFEALMTAFFVS

DYITFMSWIDKLRGLHGRLDRNFKEMDAFYQEVIDEHLDPNRQNTDGEFIVDVLLELM

KQRLFSTDLTFDHIKGVLVDMLVAATDTTSATIVWAMTALIKNPRVMKKVQEEIRGSR

VKKDFLDGDDLQNFVYLKAVIKETLRLYLPAPLLLPRETREKCIVGGYHIPAKTIVYV

NAWSIHRDSEIWKDPEEFYPERFLESSINFLGHDFELIPFGAGRRICPGISVAVASLE

LTLANLLYSFDWELPHGLVKEDIDTEMLPGITQHKKNHLCLVAKVPM

 

>CR323191.1 Medicago truncatula genomic

86% to 83E8

478  LVAATDTTSATLVWAMTVLIKNPAVMKKVQQEIRSSRVKKDFLDEDDIQNFSYLKAVIK  654

655  ETLRLFLPNPLLL  693

 

>CR342389.1  CR342389 MTE1 Medicago truncatula genomic

81% to 83E8

151  DMLVAATDTTAATSVWAITSLIKNPRVMKKVQEEIRNWEVKKN  23

 

>CYP83E8 DQ335787                1679 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP83H2 (CYP83H2)

mRNA, complete cds.

MLSLLLLVLCLTFPLLLFFQKRRRSLNEPHPPGPRGLPIIGNLH

QLDNSILYLQFSKLSKIYGPIFSLQLGLRSAIVVSSAEIAKEIFKNNDQVFSNRPVLY

GQQKLSYNGSDIAFSQYSDFWREIRKLCVIHIFSAKRVSYYSSIRKFEVKQMIKNISN

HAASSNVTNLSEILTSLYSTMICRIAFGKRYEEQGIERSKFHGMLHEFEALMTAFFVS

DYITFMSWIDKLRGLHGRLDRNFKEMDAFYQEVIDEHLDPNRQNTDGEFIVDVLLELM

KQRLFSTDLTFDHIKGVLVDMLVAATDTTSATIVWAMTALIKNPRVMKKVQEEIRGSR

VKKDFLDGDDLQNFVYLKAVIKETLRLYLPAPLLLPRETREKCIVGGYHIPAKTIVYV

NAWSIHRDSEIWKDPEEFYPERFLESSINFLGHDFELIPFGAGRRICPGISVAVASLE

LTLANLLYSFDWELPHGLVKEDIDTEMLPGITQHKKNHLCLVAKVPM

 

>CR323191.1 Medicago truncatula genomic

86% to 83E8

478  LVAATDTTSATLVWAMTVLIKNPAVMKKVQQEIRSSRVKKDFLDEDDIQNFSYLKAVIK  654

655  ETLRLFLPNPLLL  693

 

>CR342389.1  CR342389 MTE1 Medicago truncatula genomic

81% to 83E8

151  DMLVAATDTTAATSVWAITSLIKNPRVMKKVQEEIRNWEVKKN  23

 

>CYP83E9 DQ335788                1953 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP83H1 (CYP83H1)

mRNA, complete cds.

MVSYLHTLLALPLLVFFLFMKYKTNIKNSSSSTFPKGPKGLPII

GNLHQLDTSNLHLQFWNLSKIYGPLFSLQIGFKKAIVVCSSKLAQEILKDHDHDVSSR

PPSHGPKTLSYNGIDMIFSPYNDCWREIRKICVVHFFSSKKISSFAHVRKSEVKLMIE

KISNHVCSSKISNLSEVLMSVSSSIVCRIAFGKSYEHEGGEKSRFHGLLNETQAIFLS

FFVSDYIPFMGWVDKLTGAIARVDNTFKALDEFFEQVLKEHLNPNNRKKDDEEKDIVD

VLLELKNQGRLSIDLTNNHIKAVVMNLLVAATDTSAATSVWVMTGLIKNPRAMKKAQE

EIRNIKKEFIDEDDIQKFVYFKAVIKETLRFYSPAPLAPRETSKSFTLNGYKIEPKTS

VFVSIWSIHRDPETWKDPDEFYPERFLNNDIDFKGQNFEFIPFGAGRRICPGIPLGIA

TVEMITANLLNSFDWEMPEGMTKEDIDTEGLPGLARHKKNHLCLVAKNHM

 

>CYP83E10 AC119411.16  Medicago truncatula

89% to 83E9, runs off the end

105117  MVSYLQILLALPLFVFFLFLKYKTNIKNSSSTFPKGPKGLPIIGNLHQLDTSNLHLQFW  105293

105294  NLSKIYGPLFSLQIGFKKAIVVCSPKLAQEILKDHDHDVSSRPPSYGTQILSYNGMDMIF  105473

105474  SPYNDHWREIRKICIVHFFSSKKISSFSHVRKSEVKQMIEKISNHVHSSEISNLSEILMS  105653

105654  VLSSIVCRIAFGKSYEHEGGEKSRFHNLLHETEAIFLSFFVSDHIPFMGWIDKLTGANAR  105833

105834  VDKTFKALDEFLEQVLQEHLNPNNRKKDEEEKDIVDVLLELKNQGRLSIDLTNDHIKSVLM  106016

106638  NLLVAATDTTSATSVWAMTGLMKNPRAMKKAQEEIRNICGKKEFIDEDDIQ  106790

 

>CYP83E11 CYP83E  CT027664.2  Medicago truncatula chromosome 5 clone

45% to 71B10, 82% to 83E8

59951  MLPFLLVLCLIFPLLLFFLKRSRNINARHPPGPRGLPIIGNLHQLDNSILYLQLSKLS  59778

59777  KIYGPIFSMKLGLRPAIVVSSDKIAKEIFKNNDHVFSNRPMLYGQQRLSYNGSEIVFSQY  59598

59597  SDFWRDIRKFCVIHIFSAKRVSYYSSIRKFEVKQMIKNISNQAASSIVTNLSEILTSLSS  59418

59417  TIICRIAFGRRYEDEGTKRSKFQGMLHEFEAMITAFFISDYIPFTGWIDKLSGLRA  59250

59249  RLERNFKEMDEFYQEVIDEHLDPNRQHEDDEEVIVDVLLQLKKERLFPIDLTFDHIKGVLM 59067

58165  NMLVAATDTTSATTVWAMTALIKNPRVMKKVQQEIRNSKVKKEFIDEDDIQNFSYLKAV  57989

57988  IKETLRLYLPAPLLVPRETREKCTIGGYQIPAKAVVFVNAWAIHTDPNVWKNPEEFYPER  57809

57808  FLESSINFHGQDFELIPFGAGRRICPGMSMAVASLELILANLLYSFDWELPDGLVKEDID  57629

57628  TERLPGLTQHKKNELCL AAKIPM* 57557

 

>CYP83G1v1 DQ335789                1786 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP83G1 (CYP83G1)

mRNA, complete cds.

CT033764.1  Medicago truncatula chromosome 5

CG966211.1 Medicago truncatula genomic clone

67642 MNKNMSPLILLPFALLLFFLFKKHKTSKKSTTLPPGPKGLPFIG

NLHQLDSSVLGLNFYELSKKYGPIISLKLGSKQTVVVSSAKMAKEVMKTHDIEFCNRP

ALISHMKISYNGLDQIFAPYREYWRHTKKLSFIHFLSVKRVSMFYSVRKDEVTRMIKK

ISENASSNKVMNMQDLLTCLTSTLVCKTAFGRRYEGEGIERSMFQGLHKEVQDLLISF

FYADYLPFVGGIVDKLTGKTSRLEKTFKVSDELYQSIVDEHLDPERKKLPPHEDDVID

ALIELKNDPYCSMDLTAEHIKPLIM 66740

66612 NMSFAVTETIAAAVVWAMTALMKNPRAMQKVQE

EIRKVCAGKGFIEEEDVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDIPD

KTLVYVNALAIHRDPEVWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNM

AIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKKRIECV 65998

 

>CYP83G1v1 exact duplicate

CT033764.1  Medicago truncatula chromosome 5

100% identical

81131 MNKNMSPLILLPFALLLFFLFKKHKTSKKSTTLPPGPKGLPFIG

NLHQLDSSVLGLNFYELSKKYGPIISLKLGSKQTVVVSSAKMAKEVMKTHDIEFCNRP

ALISHMKISYNGLDQIFAPYREYWRHTKKLSFIHFLSVKRVSMFYSVRKDEVTRMIKK

ISENASSNKVMNMQDLLTCLTSTLVCKTAFGRRYEGEGIERSMFQGLHKEVQDLLISF

FYADYLPFVGGIVDKLTGKTSRLEKTFKVSDELYQSIVDEHLDPERKKLPPHEDDVID

ALIELKNDPYCSMDLTAEHIKPLIM  80229

80106 NMSFAVTETIAAAVVWAMTALMKNPRAMQKVQE

EIRKVCAGKGFIEEEDVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDIPD

KTLVYVNALAIHRDPEVWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNM

AIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKKRIECV 79488

 

>CYP83G1v2 TIGR contig TC100504

only 1 aa diff from 83G1v1, possible allele

ISYNGLDQIFAPYREYWRHTKKLSFIHFLSVKRVSMFYSVRKDEVTRMIKKISENASSNK

VMNMQDLLTCLTSTLVCKTAFGRRYEGEGIERSMFQGLHKEVQDLLISFFYADYLPFVGG

IVDKLTGKTSRLEKTFKVSDELYQSIVDEHLDPERKKLPPHEDDVIDALIELKNDPYCSM

DLTAEHIKPLIM

NMSFAVTETIAAAVVWAMTALMKNPRAMQKVQEEIRKVCAGKGFIEEE

DVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDIPDKTLVYVNALAIHRDPEV

WKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNMAIATIDLVLSNLLYSFDWE

MPEGAKREDIDTHGQTGLI

 

>CYP83G2 DQ394575                1577 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP83G2 (CYP83G2)

mRNA, complete cds.

CT033764.1  Medicago truncatula chromosome 5

100718  MNKNMSPLILLPFALLLFFLFKKHKTSKKSTTLPPGPKGLPFIGNLHQLDSSALGLNFYE  100539

100538  LSKKYGSLIYLKLGSRQTIVVSSAKMAKQVMKTHDIDFCNRPALISHMKFSYDGLDQFFS  100359

100358  PYREYWRHTKKLSFIHFLSVKRVVMFSSVRKYETTQMITKISEHASSNKVVNLHELLMCL  100179

100178  TSAVVCRTAFGRRFEDEAAERSMFHDLLKEAQEMTISFFYTDYLPFVGGIVDKFTGLMSR  99999

 99998  LEKLFKILDGFFQSVFDEHIDPNRKKLPPHEEDVIDALIELKNDPYCSMDLSAEHIKPLIM  (0) 99816

 98934  NMLLAGTDTIAAAVVWAMTALMKNPRVMQKVQEEIRKAYEGKGFIEEEDVQKLPYFK  98764

 98763  AVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPDKTLVYINAWAIHRDPEAWKDPEEFYP  98584

 98583  ERFIGSDIDLKGQDFELIPFGSGRRVCPGLNMAIATVDLVLANLLYLFDWEMPEGVKWEN  98404

 98403  IDIDGLPGLVQHKKNPLCLIAKKRIECV  98320

 

>CYP84A17 DQ335806                1457 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP84A15

(CYP84A15) mRNA, partial cds.

AC136451.9 genomic seq. Complete gene

97% to DQ222912.1  Medicago sativa ferulate 5hydroxylase

117181 MDSLLKSPIMENLKEEPFLMAIMFIVPLILLLGLVSRILKRPRY

PPGPIGLPIIGNMLMMDQLTHRGLANLAKKYGGIFHLRMGFLHMVAISDADAARQVLQ

VQDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKHAESWQSVR

DEVDYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGSSSREGQDEFIGILQEFSKL

FGAFNISDFVPCFGAIDPQGLNARLVKARKELDSFIDKIIDEHVQKKKSVVDEETDMV

DELLAFYSEEAKLNNESDDLNNSIKLTKDNIKAIIM 118116

119604 DVMFGGTETVASAIEWAMAELM

KSPEDLKKVQQELAEVVGLSRQVEESDFEKLTYLKCALKETLRLHPPIPLLLHETAEE

ATVNGYFIPKQARVMINAWAIGRDANCWEEPQSFKPS

RFLKPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYA

LDLAVAHLLHCFTWELPDGMKPSEMDMSDVFGLTAPRASRLVAIPTKRVLCPLD* 120227

 

>CYP84A18 AC174351.5  Medicago truncatula clone mth27h5, complete sequence

87% to 84A15

24993  MDTLGQFQTTLLLVLPLTLFLLLNLASKFRKRAPYPPGPKGLPLIGNMNMLDKLTHRGLANLAKQY  25190

25191  GGVYHLRMGFIHMVAISNAEAAREVLQLHDSIFSNRPATVAISYLTYNRADMAFAHYGPF  25370

25371  WRQMRKLCVMKLFSRKRAESWQSVKDEVEVVITNVNNNLGKSVNVGELVFNLTKNIIYRA  25550

25551  AFGSCSKEGQDEFISILQEFSKLFGAFNIADFVPCLKWVDPQGFNDRLVKARGALDGFID  25730

25731  KIFDEHVEKKRNMSGDEDSDMVDELLAFYSDEAKVENESDDLHNSIKLTRDNIKAIIM  25904

27992  DVMFGGTETVASAMEWAMSELMRNPEELKRVQQELAVVVGLDRRVEESD  28138

28139  IEKLTYLKCAVKETLRLHPPIPLLLHETAEDATVGGYFVPKGSRVMINVWAIGRDKDSWE  28318

28319  DPEEFRPSRFLDSSAPDFKGSHFEFIPFGSGRRSCPGMQLGLYALDLALAHLLHCFTWEL  28498

28499  PNGMRASEMDTSDVFGLTAPRASRLIAVPAKRVVCPL*  28612

 

>CYP84A18 CYP84A AC146720.23  Medicago truncatula

87% to 84A15

21847  MDTLGQFQTTLLLVLPLTLFLLLNLASKFRKRAPYPPGPKGLPLIGNMNMLDKLTHRGLANLAKQY  21650

21649  GGVYHLRMGFIHMVAISNAEAAREVLQLHDSIFSNRPATVAISYLTYNRADMAFAHYGPF  21470

21469  WRQMRKLCVMKLFSRKRAESWQSVKDEVEVVITNVNNNLGKSVNVGELVFNLTKNIIYRA  21290

21289  AFGSCSKEGQDEFISILQEFSKLFGAFNIADFVPCLKWVDPQGFNDRLVKARGALDGFID  21110

21109  KIFDEHVEKKRNMSGDEDSDMVDELLAFYSDEAKVENESDDLHNSIKLTRDNIKAIIM  20936

18848  DVMFGGTETVASAMEWAMSELMRNPEELKRVQQELAVVVGLDRRVEESD  18702

18701  IEKLTYLKCAVKETLRLHPPIPLLLHETAEDATVGGYFVPKGSRVMINVWAIGRDKDSWE  18522

18521  DPEEFRPSRFLDSSAPDFKGSHFEFIPFGSGRRSCPGMQLGLYALDLALAHLLHCFTWEL  18342

18341  PNGMRASEMDTSDVFGLTAPRASRLIAVPAKRVVCPL*  18228

 

>CT573020.1  Medicago truncatula chromosome 5 clone mth283i12, COMPLETE SEQUENCE

CYP84A pseudogene

30493  QDVEETDIEKLTYIKCVVKETLRLHPPTPLLHETVEDAIVGGYFVPKGSRVMIYMWVIG  30317

30316  RDKDSWEDSEEFRPSRFLNSSVPDFKESHFEFIPFG*GRRSCLDMQLALYTFDLALVHLL  30137

30136  RCFTWELSNGMK  30101

30095  SEIDTSDVFGLTTLRTSRLIAVP  30027

 

>CYP84A19 CYP84Ms1 DQ222911                1904 bp    mRNA    linear   PLN

16NOV2005

DEFINITION  Medicago sativa ferulate 5hydroxylase

97% TO 84A17, 77% TO 84A18

MDSLLKFPIMVNLKEEPFLMAIMVIVPLTLLLGLMSRILKRPRY

PPGPKGLPIIGNMLMMDQLTHRGLANLAKKYGGIFHLRMGFLHMVAISDADAARQVLQ

VQDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKHAESWQSVR

DEVDYAVRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGSSSREGQDEFIGILQEFSKL

FGAFNISDFVPCFGAIDPQGLNARLVKARKDLDSFIDKIIDEHVEKKKSVVDEETDMV

DELLAFYSEEAKLNNESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWVMAELM

KSPEDLKKVQQELAEVVGLSRQVEEPDFEKLTYLKCALKETLRLHPPIPLLLHETAEE

ATVNGYFIPKQARVMINAWAIGRDANCWDEPESFKPSRFLKPGVPDFKGSNFEFIPFG

SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSEMDMSDVFGLTAPRASRLIA

IPTKRVLCPLD

 

>CYP84A20 CYP84Ms2 DQ222912                1885 bp    mRNA    linear   PLN 16NOV2005

DEFINITION  Medicago sativa ferulate 5hydroxylase

97% TO CYP84Ms1 DQ222911

MDSLLKYPIMENFKEEPFLMAIMFILPLILLLGLVSRILKRPRY

PPGPKGLPVIGNMLMMDQLTHRGLANLAKKYGGIFHLRMGFLHMVAISDADAARQVLQ

VQDNIFSNRPATVAIKYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKHAESWQSVR

DEVDHAIRTVSDNIGNPVNIGELVFNLTKNIIYRAAFGSSSREGQDEFIGILQEFSKL

FGAFNISDFVPCFGAIDPQGLNARLVKARKDLDSFIDKIIDEHVQKKKSVVDEETDMV

DELLAFYSEEAKLNNESDDLHNSIKLTKDNIKAIIMDVMFGGTETVASAIEWAMAELM

KSPEDLKKVQQELAEVVGLSRQVEEPDFEKLTYLKCALKETLRLHPPIPLLLHETAEE

ATVNGYFIPKQARVMINAWAIGRDANCWEEPESFKPSRFLKPGVPDFKGSNFEFIPFG

SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPDGMKPSEMDMSDVFGLTAPRASRLIA

IPTKRVLCPLD

 

>CR294554.1 Medicago truncatula genomic,

98% to 89A28 (4 aa diffs)

674  VVSYADTLLELE*PEEKRKLSENEMVNLCSEFLNGGTDTTSTSLEWIMANVVKYPEVKGR  495

494  LVEEIREVMGGDENGEKEEVKEEDLQKLWYLKCVVLEGLRRHPSGKFPLPHAVKEDVVLD  315

314  GYLVPKNGTVNFLLAEMALDRRVWEDPLEFKPERFLKDETFDITGSKEIKMMPFGAGRRI  135

134  CPGLNLALLHLEYFVANLVWNFDWKVPEG  48

 

>CYP89A28 DQ335796                1694 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP89H1 (CYP89H1)

mRNA, complete cds.

MEPWFIVLVTLCIIFLIRAILSLFTTTIPLPPGPLHIPIITNFQ

LLQKSISQLEPFLKTLHAKHGPIITVHIGSRPSIFINDHTLAHHVLVQNSSIFSDRPT

ALPTSKMLSSNQHNINTAYYGPTWRTLRRNLASEMLHPSKLKSFSEIRKWVLRTLINR

LKTASESELTDSIKVMPHFKYAMFSLLVFMCFGERVNDEKISDIERVQRKIMLNFGRF

NKLNFWPKVTRILLRNQWEEFLKLLKDQEDVLLPLIRARKQVKESKLNNINTVVSYAD

TLLELEWPEEKRKLSENEMVNLCSEFLNGGTDTTSTSLQWIMANVVKYPEVQGRLVEE

IREVMGGDENGEKEEVKEEDLQKLRYLKCVVLEGLRRHPSGKFPLPHAVKEDVVLDGY

LVPKNGTVNFLLAEMALDRRVWEDPLEFKPERFLKDETFDITGSKEIKMMPFGAGRRI

CPGLNLALLHLEYFVANLVWNFDWKVPEGGHVDLTEIQEFTMVMKNPVQVHISPRI

 

>CYP89A28 AC130800.23a  Medicago truncatula

38259..39779 82% to 89A29

MEPWFIVLVTLCIIFLIRAILSLFTTTIPLPPGPLHIPIITNFQ

LLQKSISQLEPFLKTLHAKHGPIITVHIGSRPSIFINDHTLAHHVLVQNSSIFSDRPT

ALPTSKMLSSNQHNINTAYYGPTWRTLRRNLASEMLHPSKLKSFSEIRKWVLRTLINR

LKTASESELTDSIKVMPHFKYAMFSLLVFMCFGERVNDEKISDIERVQRKIMLNFGRF

NKLNFWPKVTRILLRNQWEEFLKLLKDQEDVLLPLIRARKQVKESKLNNINTVVSYAD

TLLELEWPEEKRKLSENEMVNLCSEFLNGGTDTTSTSLQWIMANVVKYPEVQGRLVEE

IREVMGGDENGEKEEVKEEDLQKLRYLKCVVLEGLRRHPPGKFPLPHAVKEDVVLDGY

LVPKNGTVNFLLAEMALDPRVWEDPLEFKPERFLKDETFDITGSKEIKMMPFGAGRRI

CPGLNLALLHLEYFVANLVWNFDWKVPEGGHVDLTEIQEFTMVMKNPLQVHISPRI

 

>CYP89A29 AC130800.23b  Medicago truncatula

47878..49392

METWFIVLITLCIIFLIGVILASFTTTVPFPPGPPHIPILTNIQ

LLRKPSSQLEPFLKTLHAKHGPIITLHIGSRPSIFIDDHALAHHVLVQNSDIYSDRPK

AFPTSKMLSSNQHNISSGFYGPTWRTLRRNLASEILHPSKTKSFSEIRKWVLHTLINR

LKTASESADSVTVVSPFRYAMFSLLVFMCFGERVNDENISDIERVQMTIMLNIGRFNI

LNFWPKVTRILLRNRWKEFLKLLKDQEDVLLPLIRARKQVKESKLNNVNTVVSYADTL

LELELPEEKRKLSENEMVNLCSEFLNGGTDTTSTTLQWIMANLVKYPEVQRRLVEEIR

EVMGGDENGEKEEVKEEELQKLRYLKCVVLEGLRRHPPGHFLLPHAVKEDVVLNGYLV

PKNGTVNFMLAEMGWDPRVWEDPMEFKPERFWKDENFDITGSKEIKMMPFEAERRICP

ALNLALLHLEYFVANLVWNFDWKLPEGGYVDLSEKQEFNMVMKNPLQVHISPRI

 

>CYP89A30 AC130800.23c  Medicago truncatula

join(54647..55376,55491..56110)

MLSFFTTTVPLPPGPLHIPIITNFQLLQKSISQLEPFLKTLHAK

HGPIIIVHIGSQPSIFINDHALAHHVLVQNSAIISDRPTALPTSKMLSSNQHNINTAF

YGPTWRTLRRNLAFEMLHPSKLKSFSEIQKWVLRTLINRLKTASESEPTDSIKVMPHF

KYAMFSLLVFMCFGERVNDEKISDIERVQRKIMLNFGRFNKLNFWPKVTRILSRNQWE

EFLKLLKDQEDVLLPLIRARKQVKEKFLNGGTDTTSTSLEWIMANVVKYPEVKGRLVE

EIREVMGGDENGEKEEVKEEDLQKLWYLKCVVLEGLRRHPSGKFPLPHAVKEDVVLDG

YLVPKNGTVNFFLAEMALDRRVWEDPLEFKPERFLKDETFVIPGSKEIKMMPFGAGRR

ICPGLNLALLHLEYFVANLVWNFDWKVPEGGHVDLTEIQEFTMVMKNPVQVHISPRI

 

>CYP89A31 AC130800.23d  Medicago truncatula

65579..66760

METWFIVLVTLCIIFLIRAILSFFTTTVPLPPGPLHIPIITNFQ

LLQKSISQLEPFLKTLHAKHGPIITVHIGSRPSIFINDHALAHHVLVQNSAIFSDRPV

ALPTSIMLSSNQHNISSAFYGPTWRTLRRNLASEMLHPSKTKSFSEIRKWVLHTLINR

LKTASESEDSITVVSHFRYAVFCLLVFMCFGERVNDEKISDIERVQRTILLNISRFNI

LNFWPKGTRILLRNRWEEFLKLLKDQEDVLLPLIRARKQVKESKLNNDNTVVSYADTL

LELELPEEKRKLSENEMVNLCSEFLNGGTDTTSTALQWIMANLVKYPEVQGRLVEEIR

EVMVSDDNGEKEEVKEENLQKLRYLKCVVLEGMRRHPPGAFCVGTHGERGCGFERLFGA

66825..67094

66723  KEDVVLNGYLVPKNGTVNFMLSEMAWDPRVWEDP

MEFKPERFLKDETFDIIGSKEIKMMPFGAGRRICPGLNLALLHL

EYFVANLVWNFNWQLPEGGHVDLSEKDEFTMVMKNPLQVHISPRV

 

>CYP89A32 AC130800.23e  Medicago truncatula

71433..72947

METWFIVLITLCIIFLVKAILSSFTTTVPLPPSPPHIPIITSIQ

WLRKSFSQLEPFLKTLHAKHGPIINLNIGSRPSIYISDRALAHHALVQNSSLFSDRPK

ALPSHKLISSNQHNISAAFYGPTWCTLRRNLASEMLHPSKIKSFSEIRKWVLHTLINR

LKIASESTDYVTVIPHFHYAMFCLLVFMCFGERVNDEKINDIERVQRTLLLKVSRFNI

LHFWPKVAWILLRKQWEELLMLRRDQEDVLLPLIRGRKQVKETKLNNANTVVSYVDTL

LELELPMEKRKLTEDEMVSLCSEFLNAGTDTTSTALHWIMANLVKYPDVQRRLVQEIR

EFMGGDGVVEKEEVKEEDLHKLRYLKCVVLEGLRRHPPGHFVLPHAVSDDVVLNGYLV

PKNGTVNFMVAEMGLDPRVWEDPMEFKPERFLKDETFDITGSKEIKMMPFGAGRRICP

GYNLALLHLEYFVANLVWNFDWKVPEGGHVDLSEKFEFTVVMKNPLQVHISHRI

 

>CYP89A33 AC130800.23f  Medicago truncatula

75136..76662

CG955963.1 Medicago truncatula genomic clone

CG923212.1 Medicago truncatula genomic clone

CG924744.1 CR962937.1

CR483888

87% to 89A29

METWFIALVSLCIIFLIRATLSSISTTKKTTATLPPGPPHIPII

TSIQWLRKSFAQLEPFLRTLHAKHGPIINLNIGSRPSIFIADRALAHHALVQNSSVFS

DRPKALPTNKLMSSNQHNISSAFYGPTWRTLRRNLASEMLHPSKIKSFSEIRKWVLQT

LINRLKTASESEDSVTVVSHFRYAVFCLLVFMCFGERVNDEKINDIERVQRTILLNFS

RFNILNFWPKVTRILLRKRWDELAKLLKDQEDVLLPLIRARKHVKESRLNNINTVVSY

VDTLMELELPQEKRKLSEDEMISLCSEFLNGGTDTTSTALQWIMANLVKYPDVQGKLV

EEITEVMGGDDAGEKEEVKEEDLHKLRYLKCVVLEGLRRHPPGHFVLPHAVSEDVVLN

GYLVPKDGTVNFMVAEMGLDPRVWEDPMEFKPERFLKDETFDITGSKEIKMMPFGAGR

RICPGYNLALLHLEYFVANLVWNFDWKVPEGGRVDLSEKQEFTMVMKNPLQAHISPRI

 

>CYP89A34 AC130800.23g  Medicago truncatula

95436..96968

CR331115.1 Medicago truncatula genomic,

METWFIALVSLCIIFLIRAIFSSLTTTNKTTATLPPGPPHIPII

TSILWLRKSSSQLEPFIKTLHTKYGPIITLKISYRPSIFISDHTLAHHALVQNSAIFS

DRPRALPTAKIISSNQHNISSAFYGATWRALRRNLASEMLHPSKIKSFSEIRKWVLHT

LINRLKTASELETADYIKVMPHFNYAMFCLLVFMCFGERVNDEKISDIERVQRTILLS

VNKFNIINFWPKVTRILFCKRWEELLKLRKDQEDVLLPLIRARKQVKESRLNNVNPVV

SYVDTLLELELPDEKRKLSEDEMVSLCSEFLNAGIDTTSTALQWIMANLVKYPDVQGR

LVDEIREVMGRDGNGEKVEVKEEDLQKLLYLKCVVLEGLRRHPPGHNVLPHAVTEDVL

FNGYLVPKNGTVNFMVAEMGWDPRVWEDPMEFKPERFLKDETFDITGSKEIKMMPFGV

GRRICPGYNLALLHLEYFVANLVWNFDWKVPEGGHVDLSEKQEFTVVMKNPLQVRISP

RI

 

>CYP89A31/CYP89A33  HYBRID SEQ AC130800.23d + AC130800.23f 

CYP89A29 DQ335795                1819 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP89H2 (CYP89H2)

mRNA, complete cds.

Note first part up to KEEN nearly 100% match to AC130800.23d

The part after this starting with LHKL mastches AC130800.23f

Either this is a chimeric seq, or the genomic DNA is assembled incorrectly.

METWFIVLVTLCIIFLIRAILSFFTTTVPLPPGPLHIPIITNFQ

LLQKSISQLEPFLKTLHAKHGPIITVHIGSRPSIFINDHALAHHVLVQNSAIFSDRPV

ALPTSIMLSSNQHNISSAFYGPTWRTLRRNLASEMLHPSKTKSFSEIRKWVLHTLINR

LKTASESEDSITVVSHFRYAVFCLLVFMCFGERVNDEKISDIERVQRTILLNISRFNI

LNFWPKGTRILLRNRWEGVFEVTKDQEDVLLPLIRAGKQVKESKLNNDNTVVSYADTL

LELELPEEKRKLSENEMVNLCSEFLNGGTDTTSTALQWIMANLVKYPEVQGRLVEEIR

EVMVSDDNGEKEEVKEENLHKLRYLKCVVLEGLRRHPPGHFVLPHAVSEDVVLNGYLV

PKDGTVNFMVAEMGLDPRVWEDPMEFKPERFLKDETFDITGSKEIKMMPFGAGRRICP

GYNLALLHLEYFVANLVWNFDWKVPEGGRVDLSEKQEFTMVMKNPLQAHISPRI

 

>CYP92A29 DQ335786                1864 bp    mRNA    linear   PLN 04AUG2006

CG944627.1 Medicago truncatula genomic clone

CR326979.1 Medicago truncatula genomic,

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP75C1 (CYP75C1)

mRNA, complete cds.

MEPVQLLELPSWVTLFATFVILLLFSRRLRRHKYNLPPGPKPWP

IIGNLNLIGSLPHQSLHGLTQKYGPIMHLYFGSKPVIVGATVELAKSFLKTHDATLAG

RPKLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIRKQEMHDFL

HKLFNSKNKTILVKDHLSTLSLNVISRMVLGKKYLEKTDNAVISPDEFKKMLDELFLL

NGILNIGDFIPWIHFLDLQGYVKRMKTLSKKFDRFMEHVLEEHIERRKNVKDYVAKDM

VDVLLQLAEDPNLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELVRKPEIFKKA

TEELDRVIGKDRWVEEKDIANLPYVYAIAKETMRLHPVAPFLVPREAREDCKVDGYDI

PKGTIVLVNTWTIARDSEVWENPYEFMPERFLGKDIDVKGHDFELLPFGAGRRMCPGY

PLGIKVIQTSLANLLHGFNWTLPNNVKKEDLNMEEIFGLSTPKKIPLEIVVEPRLADH

LYSL

 

>CR504674.1 Medicago truncatula genomic,

87% to CYP92A29 71clan

CR501877

752  KYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVF  573

572  LKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMR  393

392  KQELHAFLHELFNSKNKTILLKDHLSTLSLNVISRMVLGKKYLEKSENAIISPEEFKK  219

218  MLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERRKC  48

47   VNDYVAKDMVDVLLK  3

 

>CG927934.1 Medicago truncatula genomic clone

75% to 92A9, 74% to 92A7

694  FPQDLIAGGTESSAVTVEWAISELVRKPEIFKKATEELDRVIGKDRWVEEKDIANLPYVY  873

874  AIAKET  891

 

>CYP93A8 AC141114.14  Medicago truncatula

complement(join(18188..18811,19360..20271))

58% to 93C5

MVDYQGYILLFIIWLVSTIFVKAILTRKYKKSKLPPSPLSLPII

GHLHLIGSIPHQGLHKLSTKYGPIIHLFLGSMPCVVASTPESAKEFLKTHETYFSNRP

QSSAVDYLTYGSQDFSFAPYGPYWKFIKKICMSELLGGNTLSQLLPLRRQETTRFVSF

LLKKGKENEVIDVGRELLKLSNNVISRMIMSQTCSENDGEAEEVRKLVQDTVHLTGKF

NISDFIWFFKNWDVQGFSKGLEEIRDRFDSMMERIIKEHQEVRRRRKEVGGGEGQIKD

LLDILLDILEDESSEIKLKMENIKAFILDIFIAGTDTSALTIEWALAELINNPHMMEI

ARQEINDVVGNNRIVEESDIINLPYLQAIVKETLRIHPTGPLIVRESSEKCTIQGYEI

PAKTQLFVNIWSIGRDPNYWDNPLEFRPERFINEVGNLDVRGQHFHLIPFGSGRRACP

GTSLALHVVQTNLAAMIQCFEWKVKGGNGIVNMEEKPGLTLSRAHPLICVPVPRFNHF

PSM

 

>CR326313.1 Medicago truncatula genomic

73% to 93A8

192  FMAGTDTSAITIEWALAEMINNPHMMERARQEIDAVTENTRLIEESDLPKLPYLHAIIKETLRI  1

 

>CR296317.1 Medicago truncatula genomic,

69% to 93A8

2    IHPTVPILGRESSESCLVYGYEIPAKTILFVNLWSMGRDPKLWENPLEFMPERFMNEEN  178

179  KFDVRGQNFQLMPFGTGRRVCPGASLPLQVVPINLAAMIQCFDWKIDGDGKVNMEEK  349

350  PAMTLPRAHPLMCVPIPRF  406

 

>CL312210.1  mth2124O23_T7 Medicago truncatula BAC end sequences Medicago

61% to 93A8

VQLFPTXTYGSKDFXFAPYGEYWKFIKKICMSELLGGRTLDKFLPLRQKETMRFLRLLQT

KGEAREAVNVGGELLNLTNRIITTMAMSKTCAENDSDVEDIRKMVQDSVELSGRFNLSDF

IWFFKNWDMQGFNKRLKVVMERFDTLMERVIREHQVEMKKRKEKGEGDHVRDLLDILLEM

HENENTEIKLTRE

 

>CR348815.1  CR348815 MTE1 Medicago truncatula genomic

59% to 93F1, 75% to CR326313

381  SESQPEYYSDHLIKGLIQVIIRLPLSINMEFMFTSFIYH  497

224  ILWLMQDIFMAGTDTSAITIEWAIAELINNPHVMEKARQEIDSVTGKSRLIQESDIPNL  48

47   PYIRAIGKK  21

 

>CA991311.1  EST Medicago truncatula cDNA

72% to CL312210, 61% to 93A8

LKTHETSFSNRLINGVVRYLSYGANDFMFAPYGDYWKFMKKICMSELLGGRTLDQFRPLR

QQETLRLLNVLKKNGETGEAVDVGAELLRLTNRIMTRTTITKTCCENGFDVEDIRKLVKD

CSELGGQFNLSDFIWFFKNWDLQGFNKRLKELMNMFDTMIESVIREHQEEMKKRKENGEG

AHVKDLLDILLEIHEDESSEIKLTRKNVKAFIFDMFLSGTDTSSTTIEWALAELINNPHI

MQKARPEIDSLTGKE

 

>AW685151.1 Medicago truncatula cDNA

71% to CL312210

MKDYIQLFLLWLLSTIAVRAIIITRKKKSHLTLPCPLSLPIIGHL

HLISKLPHQSFHKLSTHYGPIVKIFLGSKLCVVTSSPEIAKEFLKTNETYFSNRFRSAAV

DYLSYGSKGFLFATYGEYWKFMKKMCMSELLGGRTLDQLRPLRLQETTRFLRLLHXKGEV

GEVVDVXGELLTLTNSIIARMAMSKPCSENKSDDVEEIR

 

>CYP93B12 DQ335809   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP93H1 (CYP93H1)

mRNA, partial cds.

ESTs BF641863.1 BG457453.1 BG453228.1 BG448899.1

BF639669.1 BQ147624.1  CA923083.1

Genomic CR965706.1

57% to 93B2, 56% to 93B5

CR483822.1 Medicago truncatula genomic,

MISHSFSLAMILLLFLFIFQLLSYLKRNKKLHARLPPHPPSPPA

IPIIGHLHLLKPLIHQAFRHLSDQYGPLISLRLGSSQFIIVNTPSLAKEFLKTHELTY

SHRKMSIAINVVAYDDATFAFAPYGTYWKFIKKLSTTELLGNRTMAQFLPIRTQELHE

FIQTLANKSKAEESVNLTQALIKLSNNIISRMMLSIDCSGTDNQAEQVRALVREVTQI

FGEFNVSDFIGIFKNFDLQGFKK

RALDIHKRYDALLDKIISDREELRREAKLIDGGGENGEEERLKDFLDILLDVYSEKNC

EVNFTRNHIKSLIL (0)

DYFTAATDTTAISVEWAIFKLFNNPRVLKKAQEEVDIVTRKERLVCEEDGPN

LPYIHAIIKETMRLHPPIPMIMRKGMEDCVVDGNMILKGSMVCVNIWAMARDPKIWENPL

EFRPERFLENKDIDMKGHQFELLPFGSGRRGCPGMPLALRQLPTVIGALVQCFEWKMLDS

ECKILDQGKKN*

 

>CR310235 Medicago truncatula related to DQ335809, but not the same seq

FIQTLTNKSKARESLNLTQALLKLSNNIISRMMLSIETSGTDNQAEQARALVREVTQIFG

EFNVSDFIGFFKNFDLQGFKKRALDIHKRYDALLEKIISDREESRRKTKVIEDGSLNGEE

RLKDFLDILLNVFEEKDLEVNFTRSHIKSLIL (0)

 

>CYP93E2 DQ335790                1832 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP93E2 (CYP93E2)

mRNA, complete cds.

MLEIQGYVVLFLLWFISSIFIRSLFKKSVCYKLPPGPPISFPIL

GHAPYLRSLLHKSLYKLSNRYGPLMHIMLGSQHVVVASTAESAKQILKTCEESFTNRP

IMIASENLTYGAADYFFIPYGNYWRFLKKLCMTELLSGKTLEHFVHIREDEIKCFMGT

LLEISKNGKPIEMRHELIRHTNNIISRMTMGKKSSGMNDEVGQLRKVVREIGELLGAF

NLGDIIGFMRPLDLQGFGKRNKDTHHKMDVMMEKVLKEHEEARAKEGAGSDRKKDLFD

ILLNLIEADDGAESKLTRQSAKAFALDMFIAGTNGPASVLEWALAELIRNPHVFKKAR

EEIDSTVGKERLFKESDIPNLPYLQAVVKETLRMHPPTPIFAREATRSCQVDGYDVPA

FSKIFINAWAIGRDPNYWDNPLVFNPERFLQSDDPSKSKIDVRGQYYQLLPFGSGRRS

CPGSSLALLVIQATLASLIQCFDWVVNDGKSHDIDMSEVGRVTVFLAKPLKCKPVPHF

VPFSSA

 

>CYP98A37 DQ335791                1774 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP98A37

(CYP98A37) mRNA, complete cds.

MALFLTIPLSFIAIFLFYTLFQRLRFKLPPGPRPWPVVGNLYDI

KPVRFRCFAEWAQSYGPIISVWFGSTLNVIVSNSKLAKEVLKENDQQLADRHRSRSAA

KFSRDGQDLIWADYGPHYVKVRKVCTLELFSPKRIEALRPIREDEVTAMVESIFNDST

NSENLGKGILMRKYIGAVAFNNITRLAFGKRFVNSEGVMDEQGVEFKAIVANGLKLGA

SLAMAEHIPWLRWMFPLEEEAFAKHGARRDRLNRAIMEEHTQARQKSGGAKQHFVDAL

LTLQEKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDKVI

GFERVMTETDFSSLPYLQCVAKEALRLHPPTPLMLPHRANTNVKIGGYDIPKGSNVHV

NVWAVARDPAVWKDATEFRPERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINMVT

SMLGHLLHHFCWAPPEGVNPAEIDMAENPGMVTYMRTPLQVVASPRLPSELYKRVTADI

 

>CYP93B10     Medicago truncatula

GenEMBL DQ354373 also AC146789.30 compl.(3214734320)

Senthil Subramanian

Submitted to nomenclature committee 4/4/06

76% to 93B1

note AC146789.30 compl.(3214734320) has 5 aa diffs with this seq

with four in the last 39 amino acids

there is a second gene on AC146789.30 compl(4956951789)

that has 7 aa diffs, but they are different genes.

34320  MEPLLLAFTLFLSSLICYIIFQPILNRQKNLPPSPLFKLPIIGHMHMLGPLLHHSFDRLS  34141

34140  QKYGPIFSLNFGSVLCVVASTPHYAKQILQINEHAFNCRNESTAIKRLTYEASLAFAPYG  33961

33960  EYWRFIKKLSMNELLGSRSISSFQHLRLQETHNLLKFFADKAKNYEAVNVTQELLKLSNN  33781

33780  VISKMMLGEAEEARDVVRDVTEIFGEFNVSDFIWLFKKLDLQGFGKRIEDLFMRFDTLVE  33601

33600  RIITKREELRKNKGRKENKGEQGAEFRDFLDILLDCAEDQNSEIKVQRVHIKALIM (0) 33433

32815  DFFTAGTDTTSISTEWALVELMNNPSLLQKAREEIDNIVGKNRLVDESDGPNLP  32654

32653  YIQAIIKETFRLHPPVPMVTRRCVTQCKIENYVIPENSLIFVNNWAMGRNPAYWEKPLEF  32474

32473  NPERFLKNSANSNGVIDVRGQNFQILPFGSGRRMCPGVTLAMQEVPALLGAIIQCFDFNF  32294

32293  VGPKGEILKGRDIVIDVNERPGLTAPRVHDLVCVPVERIGCGGPLQSLG  32147

 

>CYP93B11 58% to 93E1

AC146789.30 compl(4956951789)

76% to 93B1

there is a second gene 93B10 on AC146789.30 compl(3214734320)

that has 10 aa diffs to 93B11 (98%)

CR301448.1 Medicago truncatula genomic,

51789  MEPLLLAFTLFLSSLICYIIFQPILNRHKNLPPSPLFKLPIIGHMHMLGPLLHHSFDRLS  51610

51609  QKYGPIFSLNFGSVLCVVASTPHYAKQILQINEHAFNCRNESTAIKRLTYEASLAFAPYG  51430

51429  EYWRFIKKLSMNELLGSRSISSFQHLRLQETHNLLKLFADKAKNYEAVNVTQELLKLSNN  51250

51249  VISKMMLGEAEEARDVVRDVTEIFGEFNVSDFIWLFKKLDLQGFGKRIEDLFMRFDTLVE  51070

51069  RIISKREELRKNKGRKENKGEQGAEFRDFLDILLDCAEDQNSEIKVQRVHIKALIM (0) 50902

50240  DFFTAGTDTTSISTEWALVELMNNPSLLQKAREEIDNVVGKNRLVDESDGPNLP  50079

50078  YIQAIIKETFRLHPPVPMVTRRCVTQCKIENYVIPENSLIFVNNWAMGRNSAYWDKPLEF  49899

49898  NPERFLKNSTNSNGVIDVRGQNFQILPFGSGRRMCPGVTLAMQEVPALLGAIIQCFDFNF  49719

49718  VGPKGEILKGGDIVIDVNERPGLTAPRVHDLVCVPVERFACGGPLQSLGC  49569

 

>CYP93C7v1 AF195801                1501 bp    mRNA    linear   PLN 16FEB2000

DEFINITION  Medicago sativa isoflavone synthase 2 (ifs2) mRNA, partial cds.

FLHLRPTPTAKSKALRHLPNPPSPKPRLPFIGHLHLLKDKLLHY

ALIDLSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYD

SSVAMAPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQGAEAQKPLD

LTEELLKWTNSTTSMMMLGEAEEIRDIAREVLKIFGEYSLTDFIRPLKHLKVGKYEKR

IDDILNKFDPVVERVIKKRREIVRRRKNGEVVEGEVSGVFLDTLLEFAEDETTEIKIT

KDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAREEVYSVVGKDRLVDEVD

TQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYVIPEGALILFNVWQVGRDSKY

WDRPSEFRPERFLETGAEGEARPLDLRGQHFQLLPFGSGRRMCPGVNLATSGMATLLA

SLIQCFDLQVLGPQGQILKGGDAKVSMEERAGLTVPRAHSLVCVPLARIG

 

>CYP93C8 AF195800                1501 bp    mRNA    linear   PLN 16FEB2000

DEFINITION  Medicago sativa isoflavone synthase 1 (ifs1) mRNA, partial cds.

99% to Glycine max AF195798

FLHLRPTPSAKSKALRHLPNPPSPKPRLPFIGHLHLLKDKLLHY

ALIDLSKKHGPLFSLSFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSATRRLTYD

NSVAMVPFGPYWRFVRKLIMNDLLNATTVNKLRPLRTQQIRKFLRVMAQSAEAQKPLD

VTEELLKWTNSTISMMMLGEAEEIRDIAREVLKIFGEYSLTDFIWPLKYLKVGKYEKR

IDDILNKFDPVVERVIKKRRGIVRRRENGEVVEGEASGVFLDTLLEFAEDETMEIKIT

KEQIKGLVVDLFSAGTDSTAVATEWALAELINNPRVLQKAREEVYSVVGKDRLVDEVD

TQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYVIPEGALVLFNVWQVGRDPKY

WDRPSEFRPERFLETGAEGEAGPLDLRGQHFQLLPFGSGRRMCPGVNLATSGMATLLA

SLIQCFDLQVLGPQGQILKGDDAKVSMEERAGLTVPRAHSLVCVPLARIG

 

>CYP93C AF195802                1501 bp    mRNA    linear   PLN 16FEB2000

DEFINITION  Medicago sativa isoflavone synthase 3 (ifs3) mRNA, partial cds.

FLHLRPTPTAKSKALRHLPNPPSPKPRLPFIGHLHLLKDKLLHY

ALIDLSKKHGPLFSLYFGSMPTVVASTPELFKLFLQTHEATSFNTRFQTSAIRRLTYD

SSVAMVPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKLLRVMAQGAEAQKPLD

LTEELLKWTNSTISMMMLGEAEEIRDIAREVLKIFGEYSLTDFIWPLKHLKVGKYEKR

IDDILNKFDPVVERVIKKRREIVRRRKNGEVIEGEVSGVFLDTLLEFAEDETTEIKIT

KDHIKGLVVDFFSAGTDSTAVATEWALAELINNPKVLEKAREEVYSVVGKDRLVDEVD

TQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYVIPEGALILFNVWQVGRDPKY

WDRPSEFRPERFLETGAEGEARPLDLRGQHFQLLPFGSGRRMCPGVNLATSGMATLLA

SLIQCFDLQVLGPQGQILKGGDAKVSMEERAGLTVPRAHSLVCVPLARIG

 

>CYP93C5 Glycine max AF195798 ortholog 99% to Medicago sativa AF195800

MLLELALGLFVLALFLHLRPTPSAKSKALRHLPNPPSPKPRLPF

IGHLHLLKDKLLHYALIDLSKKHGPLFSLSFGSMPTVVASTPELFKLFLQTHEATSFN

TRFQTSAIRRLTYDNSVAMVPFGPYWKFVRKLIMNDLLNATTVNKLRPLRTQQIRKFL

RVMAQSAEAQKPLDVTEELLKWTNSTISMMMLGEAEEIRDIAREVLKIFGEYSLTDFI

WPLKYLKVGKYEKRIDDILNKFDPVVERVIKKRREIVRRRKNGEVVEGEASGVFLDTL

LEFAEDETMEIKITKEQIKGLVVDFFSAGTDSTAVATEWALAELINNPRVLQKAREEV

YSVVGKDRLVDEVDTQNLPYIRAIVKETFRMHPPLPVVKRKCTEECEINGYVIPEGAL

VLFNVWQVGRDPKYWDRPSEFRPERFLETGAEGEAGPLDLRGQHFQLLPFGSGRRMCP

GVNLATSGMATLLASLIQCFDLQVLGPQGQILKGDDAKVSMEERAGLTVPRAHSLVCV

PLARIGVASKLLS

 

>CYP93C19 AY167424                1572 bp    mRNA    linear   PLN 07JAN2003

Medicago truncatula putative isoflavone synthase mRNA, complete

DX922447

MLVELAVTLLVIALFIHLRPTPTAKSKALRHLPNPPSPKPRLPF

IGHLHLLDNPLLHHTLIKLGKRYGPLYTLYFGSMPTVVASTPDLFKLFLQTHEATSFN

TRFQTSAISRLTYDNSVAMVPFAPYWKFIRKLIMNDLLNATTVNKLRPLRSREILKVL

KVMANSAETQQPLDVTEELLKWTNSTISTMMLGEAEEVRDIARDVLKIFGEYSVTNFI

WPLNKFKFGNYDKRTEEIFNKYDPIIEKVIKKRQEIVNKRKNGEIVEGEQNVVFLDTL

LEFAQDETMEIKITKEQIKGLVVDFFSAGTDSTAVATEWTLAELINNPRVWKKAQEEI

DSVVGKDRLVDESDVQNLPYIRAMVKEVFRLHPPLPVVKRKCTEECEINGYVIPEGAL

ILFNVWQVGRDPKYWEKPLEFRPERFLENASQGEGEAASIDLRGQHFTLLPFGSGRRM

CPGVNLATAGMATLLSSIIQCFDLQVPGPHGQILKGDDVKVSMDERPGLTVPRAHNLM

CVPLARAGVAAKLLS

 

>DX922479.1  CP450  Medicago truncatula Sa27063 Medicago truncatula Sa27063

95% to 93C19

47   EFRPERFLENAGQGEGESAAIDLRGQHFTLLPFGSGRRMCPGVNLATAG  193

194  MATLLSSIIQCFDLQVPGPH  253

 

>CYP93C20 AY939826   94% to 93C19  12AUG2005

DEFINITION  Medicago truncatula isoflavone synthase 1 mRNA, complete cds.

CR299142.1 Medicago truncatula genomic,

MLVELAVTLLLIALFLHLRPTPTAKSKALRHLPNPPSPKPRLPF

IGHLHLLDNPLLHHTLIKLGKRYGPLYTLYFGSMPTVVASTPDLFKLFLQTHEATSFN

TRFQTSAISRLTYDNSVAMVPFAPYWKFIRKLIMNDLLNATTVNKLRPLRSREILKVL

KVMANSAETQQPLDVTEELLKWTNSTISTMMLGEAEEVRDIARDVLKIFGEYSVTNFI

WPLNKFKFGNYDKRTEEIFNKYDPIIEKVIKKRQEIVNKRKNGEIVEGEQNVVFLDTL

LEFAQDETMEIKITKEQIKGLVVDFFSAGTDSTAVSTEWTLSELINNPRVLKKAREEI

DSVVGKDRLVDESDVQNLPYIKAIVKEAFRLHPPLPVVKRKCTQECEIDGYVVPEGAL

ILFNVWAVGRDPKYWVKPLEFRPERFIENVGEGEAASIDLRGQHFTLLPFGSGRRMCP

GVNLATAGMATMIASIIQCFDLQVPGQHGEILNGDYAKVSMEERPGLTVPRAHNLMCV

PLARAGVADKLLSS

 

>CYP701A17  Medicago truncatula (barrel medic)

GenEMBL BI267772.1, BE204943.1, AL386486.1, AW691144.2

BQ138238.1

Missing about 30 aa at the Cterm

MDTLQTLSFGAFSLFFFLFLFLFRFRTRITHKLPHVPAVPGLPLIGNLLQLKEKKPHKTFT

KMAHKYGPIFSIKAGASTIIVLNTAQLAKQAMVTRFPSISTRKLSTALTILTSNKCMVAT

SDYNDFHKMVKKHILANVLGANAQKRHRFHREVMMENMFRQFSEHAKSRPDSAVDFRKIF

VSELFALALKQALGSDVESIYVEELAST

LSREDLYNILVVEFMEGAIEVDWRDFFPYLKWIPNKSLEMKIQKVDLGRKYIMKALINEQ

KKRLASGKEVNCFYDYLISEAKEVSEEQMTMLLWEPIIETSDTTLVTTEWAMYELAKDKN

RQDRLYEEILNVCGHEKVTDDQLSKLPYL

GAVFHETLRKHSPVPIVPLRYVHEDTELGGYHIPAGSEIAINIYG

CNMDSDKWENPQEWIPERFLDEKYDSSDLYKTMA

FGGGKRICAGSLQAMLIACTXIGRFVQEFEWEL

 

>CYP703A8 AC145330 MtrDRAFT_AC145330g15v1

complement(join(89916..90554,90633..91559))

MVLTILALTLLLTILVSKIIRDRHIGKSPSLDKKNNLPPGPPRW

PIVGNLLQLGQLPHRDLASLCDKYGPLVYLKLGNIDAITTNDPDIIREILLSQDDVFA

SRPRTLAAIHLAYGCGDVALAPLGPHWKRMRRICMEHLLTTKRLESFSKHRQEEAQHL

VKDVFARAKSENPINLREILGAFSMNNVTRMLLGKQYFGSKSAGPQEAMEFMHITHEL

FWLLGVIYLGDYLPMWRWIDPHGCEKKMREVEKRVDDFHSKILEEHRKARKDKKGIGK

SDEELDFVDILLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIKHP

HVLHKIQEELDVVVGPNRMVIESDLPNLNYLRCVVRETFRMHPAGPFLIPHESLRPTT

INGYYIPSKTRVFINTHGLGRNTKIWENVDEFRPERHFSTSGSRVEISHGADFKILPF

SAGKRKCPGAPLGVTLVLMALARLFHCFDWNPPKGLNHQDIDTQEVYGMTMPKVHPLI

AVAKPRLASHMYD

 

>CR321277.1 Medicago truncatula genomic

CR321074.1 Medicago truncatula genomic 2 aa diffs

CR330543.1 Medicago truncatula genomic,

CR485198.1 Medicago truncatula genomic,

52% to 71A25, 52% to 71D64 71clan

240  IDHIFVSIQDMFIAGTDTISTLLEWSMTELLRHPNIMKKLQEEVKRVANGRTHITEEDL  416

417  SHMKYLNAVVKETLRLHPSIPLLVPRESRQDIKLNGHHIKAGTRVFINAWAIARDPTHWD  596

597  QPEEFKPERFLNCSIDVKGKDFQVIPFGAGRRGCPGAVYATAVNDLVLANLVHQFNWELP  776

777  GAAEGLDMSESFGFTV  824

 

>CR334389.1 Medicago truncatula genomic,

CR334385.1 Medicago truncatula genomic,

54% to 71A5 71clan

45   NSPPSPPKLPILGNLHQLATFTHHKLQSLAQIYGPLMLLHFGNVPILIVSNSKAACEILKTHDLVF  224

225  CNRPHRKMFNIFWYGSRDIASAPYGHYWRQIRSICVLHLLSAKKVQSFSMVREEESVIMI  404

405  EKIRKWYSNSLLQPMNLTNLLCETTNDIVCRATLGKRYSDEGEGKLREAVAELE  566

567  VLLGACVLGDFVPWLDWV  620

 

>CG937094.1 Medicago truncatula genomic clone

CG972870.1 Medicago truncatula genomic clone

CG953893.1 Medicago truncatula genomic clone

CG939388.1 Medicago truncatula genomic clone

61% to CR334389 71clan

383  TMLLIISSIFAILFLLIKWYSNSTETKNSPPKLPIIGNLHQLGQFPHRSFQSLAKKY  553

554  GPFMRLNFGRVPVLVISSADAAHEIMKTHDHVFANRPPKINYDILLYNFRDVSSAPYGEY  733

734  WRQLRSICVLHLLSAKSVRSFRAVREEETGLMMEKIKHCSSSTS  865

 

>CR497904.1 Medicago truncatula genomic,

54% to CG937094 71clan

92   FLISLFVIIKYWHNSNNSSTTKKNLPPSPPRIPLLGNLHQFGLFPYRTLHTLSHKYGPLM  271

272  LLYFGKVPVLVISSADTARKVMKTHDLVFSDRPYRKMNDILLYGSKDM  415

 

>CYP706A11 AP006082.1  Lotus japonicus genomic DNA, chromosome 4

92603 MIQLSTFLQNLNLKDWYSDTTNLIIATLAISAITWYTWLFFLKPKAQTPPLPPGPPGLPIFGNLLSLDPE  92394

92393 LHTYFAGLARTHGPIFKLWLGSKLGIVVTSPSMARHVLKDHDTVFANRDVPAAGRAATYG  92214

92213 GADIVWNPYGPEWRMLRKVCVLKMLSNTTLDSVYDLRRNEVRKTVGYLRSRAGSPVNVGE  92034

92033 QVFLTVLNVITNMMWGGSVEGAE  RETLGAEFREAVADMTALLGKPNLSDFFPGLARFDLQ  91854

91853 GVEKQMHKVVPRFDRIFEK  MIGERVKMESEGKRSESKDFLQFLLNLKEEGDSKTPLSIT  91677

91676 HVKALLM  91656

91479 DMLAGGSDTSSNTVEFAMAEMMQKPEVMKRVQEELEGVVGRDNMVEESHIHKLPYLLAVM  91300

91299 KETLRLHPVLPLLVPHCPSETTSAGGYTIPKGSRVFVNVWAIHRDPSIWENPLEFDPTRF  91120

91119 LDAKWDFSGNDFNYFPFGSGRRICAGIAMAERSVLYFLATLVHLFDWTVPEGEKLDVSEK  90940

90939 FGIVLKKETPLVAIPTPRLSNHDLYK*  90859

 

>CYP706A12   Medicago truncatula

GenEMBL DQ335807  = TC109390

Li,L.Y. and Yu,D.Y.

Comprehensive analysis of putative P450 genes superfamily in

Glycine max and Medicago truncatula

Unpublished

cytochrome P450 monooxygenase CYP82A (CYP82A)

mRNA, partial cds.

59% to 706A7

CR334758.1 genomic

ESTs BE204327.1 AL386691.1 AL386667.1 AL386324.1

Lower case from lotus japonicus, deleted in one Medicago EST

81% to Lotus japonicus CYP706A11

MVSLTNLKDWYKGDTTTLLIALLTISIITWYLYLYFFKSKTQNL

PPGPPGFPIFGNLLSLDPELHTYFAGLAQAHGPIYKLWLGSKLGIVLTSPSTARQVLK

DHDTVFANRDVPAAGRAATYGGNDIVWTPYGPQWRMLRKICVVKMLSNTTLDSVYELR

RGEVRKTVGYIHDRVGSTVNVGEQVFLTVLNVITNMMWGAGVEGED

retlgaefreavadmtallgkpnlsdffpglarfdlqgvekqmhkvvprfdrif

DWMIGERLKKEEDGKENNGSRDFLQFLLNLKEEGDSKTPFTNTHVKALLMDMVVGGSDTSSNTIEFVMAE

MMNKPEVMRKVQEELETVVGKDNLVEESHIHKLTYLHAVMKETLRLHPALPLLVPHCP

SETTNIGGYTIPEGSRVFINVWAIHRDPYVWENPLEFDP

TRFLDGKWDYKGNDFNYFPFGSGRRICAGIAMAERNVLYFIATLMH

SFDWTIPQGEKLDVLEKYGIILKKKTPLLAIPTPRLSNPDLYK*

 

>CYP712B1 ortholog AC141114.14  Medicago truncatula

CG968571.1 Medicago truncatula genomic clone

complement(join(23136..23768,25190..26098))

CYP712bb, 50% to 712A1

MAFDGATIFFYIFSFLALLIFTLLVNNKRTTNGSSKFRPPPSPR

SLPIIGHLHHIGSVIPKSFQTLSHQYGPLIQLNLGASTSIVVSNAQVAKQVMKTHDLN

FSYRPQFGSSHDYLYKGSYFITAPYGPYWRFMKKICVTKLLSSSQLGRFMHIREQELE

KLLKSLLICSNENRSTDLGLDFTTLTNNILCRMSMGTTCFKKYNIDPEVIQCLVREFM

HVGAKLSMGEVLGPLGKFDLFGYGKKLRKIVGEFDKILEGFLKEHEERINTEDCQGDM

MDILLQVYRNENAEVRLTRNDIKAFFLDIFLAGTDTSSVAMQWTMAEIMNNPKILKKL

RAEINDVVGTNRLVKESDIPKMPYLQSCVKEVLRLHPTAPFALRQSSEDCKINGYDIK

AHTRTLVNVYAIMRDPQSWVNPEEYIPERFLVGEEHEHEHEHVNKMDGDDFRYIPFGF

GRRGCPGSSLALTVIHLTIAGLIQCFEWKIKGGDKIDMEEGSSFSAGLAKPLVCYPVT

CFNPF

 

>CYP736A13 CG954737.1 Medicago truncatula genomic clone

CG967736.1 Medicago truncatula genomic clone

CR971925.1 Medicago truncatula genomic,

CG926869, CG940300

EST for N-term BG647386.1

58% to 736A2, 57% to CYP736A1, 55% to 736A12 (old 764A1) Panax ginseng,

     MLPQTFTLPEILFVIFILILSATIFNSKWNQKNGRKNPPGPKPLPIIGNLHMLGKLPHRSLQLLSQKYG

     PIMSFKLGQVQTIVVSSPQIAELFLKTHDSIFSSRPKAFAADYMTYGKKGIIFTEYGDYWRNMRK

6    LCTIQLLHSSKVEMFAPLRKEEVGLLVKSLRKSATLHEVVNVSKVVAELIENITCKMILG  185

186  RSKDDRFDLKGIVHKAMLLTGKFNLSDYLPWLRPFDLQ  299

627  GIERQIKKTWKQYDELLEQIIKERENQSIEEQKGHNNKDFVDILLSLMNQSIDSKDNKYDIDR  245

246  TNIKAILIDMISAALDTTSVVIDWVLSQLLKHPYAMKKLQQELENVVGMNRQVEETHLA  422

423  KLPYLTMVVKETLRLCPVGPLLVPHECLEDVVVDGYYIKKKTRILINAWTIGRDTNVWSD  602

603  NAETFYPERFEDSDVDIRGHDFQLIPFGFGRRSCPGIQMGLTSVKLVVAQLMHCFNWELP  782

783  DAMSKDELDMSEKFELSMPRCQPLLAMPTYRLVA*  887

 

>AC146330.33  Medicago truncatula

psuedogene 60% to AC126779.19a

KKRIYESDLHELGYLKSVIKETMR

93618  LHPPFTLLPRECREACNIGGYEIPIKTSVIVNAWAIGRDPKY*YDADNFIHKRFQDS  93794

93795  KDFEFNKVNSNNNFEYIPSREGRRMCPGISLGLANIELPLAALLHHFNWELPNGMKPDDL  93974

93975  DKTESLGAATARRNGLYLIPTPH*  94046

 

>CG932383.1 Medicago truncatula genomic clone

65% to AC126779.19a 71clan

48   AGSDTSA*TIDWAMSELMKNPRVMKKAQSEIRETFKGKKSSYDSDLQELSYLNSVIKET  224

225  MRLHPPATLLIRECMEACNIGGYEIPIKTNVLVNAWAM*RDPKYWYDAEKFIPERFHDS  401

402  KYFDFNKLNSNNNNFEYIPFGGGRRMCPVILFGLANIELPLAALLYHFNWELPNGMKPED  581

582  LDMTEAFGAVVARRNNLYLIP  644

 

>CG967249.1 Medicago truncatula genomic clone

81% to CG932383

264  ICGNEQDMFAAGSDTSATVIEWAMSELMKNSRVMKKAQSEIREAVKGKKRIYESDLHELS  85

84   YLKSVIKETMRLHPPFTLLPRESARE  7

 

>CG971582.1 Medicago truncatula genomic clone

57% to CG954737, 71clan, 46% to AC142507.13

821  KSCKKVSKALDEVLEVILTEHEQAANVNKTQKDFVDILLSIMHQTIDIEGEQNLVIDRTN  642

641  IKAILLDMIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRMVNEKDLKKL  465

464  NYLDMVVDETLRLYPVAPLLVPRESRESTTIDGYFIKEKTRLIVNAWAIGRDPNVWSENA  285

284  KEFYPERFVEKKMNYLGQEFESIPFGSGRRRCPGIQLGLITVKLVIAQFIHCFNWELPHN  105

104  ISPSNLNMEEKFGLTIPRAQHLHAIPSYR  18

 

>CR479227.1  CR479227 MTH2 Medicago truncatula genomic

81% to CG971582

59   HEQTTNTDDPKDFVDTVLSIMHQTIDVEGGQDLVIDRTIIKAILLDMIGASIDTSSNVIE  238

239  WALSELLRHPRVMKILQDEIQNEVGNKRMVEEKDLKNFNYLDMVVDETLRLYPVAPLLIP  418

419  R  421

 

>CG966433.1 Medicago truncatula genomic clone

88% to CG971582 71clan

889  ECRESITIDGYFITKKTRVIVNAWAIGRDCNVWSENADEFYPERFIDKKMNYQGHEFESI  710

709  PFGSGRRRCPGIQLGLIIVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLSIPRAQHLQ  530

529  AIPSYR  512

 

>CR313987.1 Medicago truncatula genomic,

87% to CG971582 71clan

538  DILLSIMHQTIDVEGEQNLVIDRSNIKAILLDMIVAAIDTSATSIL  401

399  WALSALLRHPRVMKILQDEIQNEVGNKRMVEEKDLKKLNYLDMVVDETLRLYPVAPLLV  223

222  PPKCRENITIDDYFIKEKTRIMVNAWAIGRDPNVWSENAEEFYPKRFIEKKMNYQRQEFE  43

42   SLPFNYGRRRCPGI  1

 

>CR335566.1 Medicago truncatula genomic,

82% to CG971582.1 71clan

624  KAIDEVLEVILTEHEQTTNVDKNRHEDFVDILLTFMHQTIDLENEENHFIDRTNIKAILL  445

444  DLTVAAIDTSATVIEWALSELLRHPRVMKILQDEIQNEVGNERMIEEKDLENLSYLEMV  268

267  VHETLRLYPVAPLLLPRECRESVTIDGYFIKEKTRVIVNAWAIGRDSNVWSENAEEFYPE  88

87   RFIGKKMNYQGQEFESLPFGSGRRRCPGI  1

 

>CG955745.1 Medicago truncatula genomic clone

CG924463.1 Medicago truncatula genomic clone

76% to AC142507.13 71clan

358  ISLTLLIATLQDIFAAGGETSASTIDWAMVELVKDPRIMKKAQDEVREVFKMKGRVDEN  534

535  CINELNYLKLVVKETLRLHPPAPLLLPRECSQECDINGYHIPIKTKVLVNAWAVARDPNY  714

715  WTEPERFYPERFIDSDIDYKGSNFEYIPFGAGRRICPGSTFGLTNIELVLCMLLYHFDW  891

 

>CR487578.1 Medicago truncatula genomic

91% to CG955745

412  AGGETSASTIDWAMVEMIRDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKSVVKET  588

589  LKL  597

 

>BH760131.1 Medicago truncatula BAC

86% to AC142507.13  71clan

539  LSFDILAFSFQNIVGAGGDTSASTIVWAMSELVRDKRVMKKAQDEVRDIFNMKGNVEEN  363

362  CINELTYLKSVVKETLRLHPPGPLLLPRECGQACEIDGYRIPIKSKVIVNAWAIGRDPKY  183

182  WTEPEKFYPERFIGSSIDYKGNNFEYIPFGAGRRICPGSTFGLINVELALALMLYHFDW  6

 

>CG962121.1 Medicago truncatula genomic clone

78% to CG955745.1 71clan

506  DIFGAGGDTSAITIDWAMAEMIREPRIMKKAQAEVREVFKLNGRVDENYISELNYLKSV  330

329  VKETLRLHPPGPLLLPRECGKACEINGYNIPFKSKVIVNAWAIARDPNYWAEPERFYPER  150

149  FTDSTIDSKGDNFEYIPFGAGRRICPGSIFGLRSVEVALAMLLYHFDW  6

 

>CG962085.1 Medicago truncatula genomic clone

90% to CG962121 71clan

224  SKVIINAWAIARDPNFWTEPERFYPERFTDSTIDYKGGNFEYIPFGAGRRICPGSIFGLR  45

44   NVELALAMLLYHFD  3

 

>CG967527.1 Medicago truncatula genomic clone

CG960924.1 Medicago truncatula genomic clone

92% to CG958679.1 71clan, 65% to AC140774.7

674  FFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLSSQPHQKLRDLAKKYGPVM  495

494  HLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFAPYGNYWRQL  315

314  RKICTLELLSLKRVNSYQPIREEVFFNLAKWIASQVGIPINITEAVRSSIYTIVSRAA  141

140  FGNECKDQDKFISVVKQSIKVAGGFDLGDLFP  45

 

>CG958679.1 Medicago truncatula genomic clone

92% to CG967527 71clan

689  LLAIYFLLYPLNPGSTKDRNKKSYSTYNIPPGPIKLPIIGNIHNLLTSQPHRKLRDLAKK  510

509  YGPLMHLQLGEVSAMVISSPECAGEVMKTHDIHFASRPQILATEIMSYNSTNIAFAPYGN  330

329  YWRQLRKICTLELLSLKRVNSYQPIREEVFSNLVKWIASRDGIPINITEAVRSSIYTI  156

155  VSRAAFGNECKDQDKFISVVKQSIKVAGGFDLGDLFP  45

 

>CR967804.1 Medicago truncatula genomic,

85% to CG958679 71clan

543  P*RCIKLNNKQYGSLMHLQLGEVSTIVISSTEFAREVMKTHDIHFATRPQILATEIMSYN  364

363  STNIAFSPYGNYWRQLRKICTLELLSLKRVNSYQPIREEVFSNLVKTIASQNGSPFNL  190

189  TEAVISSIYTIVSRAAFGNECRDQEKFISVVKQTLKIAGGFNLGDLFKG  43

 

>CG921175.1 Medicago truncatula genomic clone

CR502627.1 Medicago truncatula genomic,

78% to CG967527 71clan

651  LVLYLPYIFSSLLLILIVQKIRKKKSYSTYNIPPGPRKLPIIGNIHNLLSSQPNRRLRDL  472

471  AKKYGPVMHLQLGEVSTIVITSPECAKEVMKTNDINFGSRPHLLSSEIMTYNGTNIAWSP  292

291  YGNYWKQLRKICTLELLSLKRVNSHQPIREEVLSNLVRWIVSQNGSPINLTQAVTSSV  118

117  YTIVSRSAFGNKCKDQEKFISVIKQSKKVSAGFNLGD LFP 7

 

>CG952571.1 Medicago truncatula genomic clone

97% to CR502259.1 71clan 62% to AC140774.7

692  VSLFFSFVLLALLVQKVGKKLKKTDSTFNLPKGPRKLPIIGNIHNLLSSQPHRKLSDLAK  513

512  KYGPVMHLQLGEISTIVISSPDYAREVMKTHDINFATRPQILAVEIMTYNSTNIIFAPYG  333

332  NYWRQVRKICTFELLSLKRVNSYQPIREDVLSDLVKWIASENGSPINLTKALLSSIYT  159

158  IVSRAAFGNKCKDQEKFISVVKQTIRIAGGFDLGDLFP  45

 

>CR502259.1 Medicago truncatula genomic,

97% to CG952571 71clan

547  PRKLPIIGNIHNLVSSHPHRKLSDLAKKYGPVMHLQLGEISTIVISSPDYAREVMKTHDI  368

367  NFATRPQILAVEIMTYNSTNIIFAPYGNYWRQVRKICTFELLSLKRVNSYQPIREDVLSD  188

187  LVKWIASENGSPINLTKAFLSSIYTIVSRAAFGN*CKDQEKFISVVKQTIRI  32

31   AGGFDLGDLF  2

 

>CG952097.1 Medicago truncatula genomic clone

92% to CG952571 71clan

513  VSLFFSFVLLALLVQKVGKKLKKTDTTFNLPKGPRKLPIIGNIHNLLSSLPHRKLSDLAK  334

333  KYGPVMHLQLGEISTIVISSPEYAREVMKTHDINFATRPQILAIEILAYNSTNITFAPYG  154

153  NYHRQVRKICTLELLSLKRVNSYQPIREDVLSNLVKLIASENGSPINLTE  4

 

CYP72 clan includes families 72, 709, 714, 715, 721, 734, 735

 

>CYP72A59 DQ335783                1802 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A59

(CYP72A59) mRNA, complete cds.

CG970960

MATTTTIILFTLMTLSLIWAWRILNWLWLKPKKLEKLLREQGLK

GNSYRLLVGDMNDLLKMRKEATSKPMNLSDDIVPRVYSFVHQSVTKHGKNSFIWFGPT

PRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLANGLVSLEGEQWSKHRKIINPAFHL

EKLKIMLPIFHKSCDDLISKWEKMLSSDGSCEMDVWPFLQNFASDVISRAAFGSSYEE

GKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRER

ALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVL

LVWTMVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIA

LARRVHKDVKLGNLALPAGVQVFLSIIMVHHDIELWGEDAKVFNPERFSEGVLKATNG

RNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPATVITLQPQYG

AHIILHKLEL

 

>CR348679.1 Medicago truncatula genomic

89% to 72A59

139  MATTTAIVLFILMTLSLIWAWKILNWLWLKPKKLEKFLREQGLKGN  2

 

>CYP72A61 DQ335793                1830 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A61

(CYP72A61) mRNA, complete cds.

CR343861, CG935556

MENLGTLLSSLNLQPTKVAIITVITSVLIWWIWSALDWIWFTPK

RIEKRLKQQGLKGNSYRLMVGDIRDMVKMIKEAKSKPMDPYSNDIAPRVLPFVVHTIA

KYGKSSFMWLGPRPRVFIMEPDKIKEMTTKVYDFQKPDTSPLFKLLASGFANYDGDKW

AKHRKIVSPAFNVEKMKMLIPIFCHSCDDMINKLDQVVSSSNGPCELDIWPFVQNVSS

DVLARAGFGSSFEEGKRVFQLQKEMISLTMTLFKFAFIPGYRFLPTYTNRRMKAIDLE

IRTSLMKIINRRLKAIKAGEPTNNDLLGILLESNYKESEKGNGGGGMSLRDVVDEVKL

FYLAGQEANAELLVWTLLLLAKNPEWQAKAREESFQVFGNENPDFEKIGQLKIVSMIL

QESLRLYPPVIMLSRFLRKDTKLGDLTLPAGVELIVPVSMMHQEKEFWGDDAGDFKPE

RFSEGVSKATNGKVSYLPFGWGPRLCIGQNFGLLEAKIAVSMILRQFSLEFSPSYTHA

PSFIITLQPEHGAHLILHKL

 

>CYP72A62 DQ335811                1298 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A62

(CYP72A62) mRNA, partial cds.

MEVFMFPTGTTIIISVLSVLLAVIPWYLLNKLWLKPKRFEKLLK

AQGFQGEPYNLSVFKDKSRQNYMLKLQQEDKSKFIGLSKEAAPSIFTHVHQTVHKYGK

KSFLWEGTTPRVIIADPDQIKEVFNKIEDFPKPILKSIAKYLSVGIIHYEGKKWAKHR

KIANPAFHLEKLKGMLPAFSYSCNEMISKWKELLSSDGTCEVDVWPFLQNFTCDVISR

TAFGSSYAEGEKLFQLLKKQGFLLMTGRQTNNPLWGLLATTTKTKMKEIDREIHDSLE

GIIEKREKALKNGEPTNDDLLGILLQSNHAEKQGHGNSKSNGMTTQDVIDECKLFYIA

GQETTSSLLVWTMVLLGRYPEWQARARQEVLQVFGNQNPNIEGLNQLKIVTMILYEVL

RLFPPLIYFNRALRKDLKLGNVSLPEGTQISLPI

 

>CYP72A62 AC150845.11 genomic seq complete gene

79703  MEVFMFPTGTTIIISVLSVLLAVIPWYLLNKLWLKPKRFEKLLKAQGFQGEPYNLSVFKD  79524

79523  KSRQNYMLKLQQEDKSKFIGLSKEAAPSIFTHVHQTVHKY   () 79404

78012  GKKSFLWEGTTPRVIIADPDQIKEVFNKIEDFPKPILKSIAKYLSVGIIHYEGKKWAKHR  77833

77832  KIANPAFHLEKLK  () 77794

77705  GMLPAFSYSCNEMISKWKELLSSDGTCEVDVWPFLQNFTCDVISRTAFGSSYAEGEK  77535

77534  LFQLLKKQGFLLMTGRQTNNPLWG  77463

77210  LLATTTKTKMKEIDREIHDSLEGIIEKREKALKNGEPTNDDLLGILLQSNHAEKQGHGNS  77031

77030  KSNGMTTQDVIDECKLFYIAGQETTSSLLVWTMVLLGRYPEWQARARQEVLQVFGNQNPN  76851

76850  IEGLNQLKI ()  76824

76738  VTMILYEVLRLFPPLIYFNRALRKDLKLGNVSLPEGTQISLPI LLIHQDHDLWGDDAKEF  76559

76558  KPERFAEGIAKATKGKVSYFPFGWGPRICLGQNFALLEAKIAISLLLQNFSFELSPNYVH  76379

76378  VPTTVLTLTPKNGASIILHKL*  76313

 

>CYP72A63P AC150845.11  92% to 72A62 (possible pseudogene, stop codon)

CR319694  CR479164

73187  MENGKDVYVSLLNLNDPTTLDISLMTFLHNTTRHNPIPRQKHKM

EVFVFPTGTTIIISVLSVLLAVIPWYLLNKLWLKPKRFEKLLKAQGFQGEPYNLSVFK

DKSRQNYMLKLQQEDKSKSIGLSKEAAPSIFTPIHQTVHKYGKNSFLWEGTIPRVIIT

DPDQIKDVFNKIDDFPKPKLRSIAKYLNVGILDHEGKKWAKHRKIANPAFHLEKLK

71318  VMLPAFSHSCNEMISKWKGLLSSDGTCEIDVWPSLQNFTCDVISRTAFGSSYAEGTKLFQL  71136

71135  LKKQGFLLMTGRHTNNPLWG  71076

70504  LLATTTKTKMKEIDREIHDSLEGIIEKREKALKNGETTNDDLLGILLQSNHAEKQGHGNS  70325

70324  KNIGMTTQDVIDECKLFYLAGQETT*SLLVWTMVLLGRYPEWQARAREEVLQVFGNQNPN  70145

70144  NEGLSQLKI  70118

69670  VTMILYEVLRLFPPLIYFNRALRKDLKLGNLLLPEGTQISLPILLIHQDHDLWGDDAKEF  69491

69490  KPERFAEGIAKATKGQVSYFPFGWGPRICLGQNFALLEAKIAVSLLLQNFSFELSPNYVH  69311

69310  VPTTVLTLQPKNGASIILHKL*  69245

 

>CYP72A64 AC150845.11  82% to CYP72A63

CG941666, BZ286618

65617  MEVFVFPTTTTIIIFVLTVLLAVIPWHLFNNFWLKPKRFEKLLK

AQGLQGEPYKLPFFVDNSKQNYMLRLQHEDKSKFIGLSKEAAPSIFSPFHQTLHKYGN

NSFLWEGTIPRVIITDPDQIKDVFNKTEDFPKQKLRPIALYLSVGIVHHEGEKWATHR

KIVNPAFHIEKLK

63957  GMLPAFSHSCNEMISKWNGLLSSDGTCEIDVWPFLQNLTCDVISRTAFGSSYAEGTKLFQ  63778

63777  LLKKQGVLLMKELQTNTPLW  63718

63517  PLPTTNERMMKEIERDIRDLLEGIIRKREKELRNGETTNDDLLGMLLQSNHAENQGHGNSK  63335

63334  SIGMTTQEVIDECKLFYLAGQETTSSLLVWTMVLLGRYPEWQERARQEVLQVFGNQNPNF  63155

63154  EGLSQLKI  63131

62770  VTMILYEVLRLYPPIIGLVRALRKDLKLGNLLLPGGTQVSLPVHLIHQDQDLWGDDAKKF  62591

62590  NPERFSEGIAKATKGQVSYIPFGWGPRICLGQNFALLEAKIAISLLLQNFSFELSPNYVH  62411

62410  VPITVLTLQPKNGASIILHKL*  62345

 

>CYP72A65 DQ335784                1811 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A63

(CYP72A63) mRNA, complete cds.

MEVFVFPTGTTIIICVLSVLLAVLPWHLFNNFWLKPKRLEKLLK

GQGLQGEPYNLSVLKDKSKQNYMLKLQQEDKSKSIGLSKEVAPSIFSTLHEAVHKYGK

NSFLWDGATPSVIITDPDQIKEIFNRMEDFPKSKFRSISKYFGVGIAHQEGEKWAKHR

KIVNPAFHIEKLK

GMLPAFSHSCNEMISKWKGLLSSDGTCELDVWPFLQNLTCDVISR

TAFGSSYAEGAKIFQLLKKQGFILMTAPRTNIPLWR ()

LLPTTAERRMKEIERDIRDSLE

GIIEKREEALKNGEATNDDLLGILLQSNHAEKQGHGNSKNIGMTTHDVIDECKLFYLA

GQETTSSLLVWTMVLLGRYPEWQERARQEVLQVFGNQNPNSEGLSQLKT ()

VTMILYEVL

RLYPPVIYFNRAVQKDLKLGKLLLPTGTNVALPI VLIHHDQDLWGDDAKEFKPERFAE

GIAKATKGQVSYFPFGWGPRICLGQNFTLLEAKIAISLLLQNFSFELSPNYAHLPTMV

LTLMPKNGAIIILHKL

 

>CYP72A65 revised from 72A63 AC150845.11

58563  MEVFVFPTGTTIIICVLSVLLAVLPWDLFNNFWLKPKRLEKLLK

GQGLQGEPYNLSVLKDKSKQNYMLKLQQEDKSKSIGLSKEVAPSIFSTLHEAVHKYGK

NSFLWDGATPSVIITDPDQIKEIFNRMEDFPKSKFISISKYFGVGIAHQEGEKWAKHR

KIVNPAFHIEKLKG

57129  GMLPAFSHSCNEMISKWKGLLSSDGTCELDVWPFLQNLTCDVISRTAFGSSYAEGAKIFQ  56950

56949  LLKKQGFILMTAPRTNIPLWR  56887

56310  LLPTTAERRMKEIERDIRDSLEGIIEKREEALKNGEATNDDLLGILLQSNHAEKQGHGNS  56131

56130  KNIGMTTHDVIDECKLFYLAGQETTSSLLVWTMVLLGRYPEWQERARQEVLQVFGNQNPN  55951

55950  SEGLSQLKT  55924

55535  VTMILYEVLRLYPPVIYFNRAVQKDLKLGKLLLPTGTNVALPIVLIHHDQDLWGDDAKEF  55356

55355  KPERFAEGIAKATKGQVSYFPFGWGPRICLGQNFTLLEAKIAISLLLQNFSFELSPNYAH  55176

55175  LPTMVLTLMPKNGAIIILHKL*  55110

 

>CR323468.1  CR323468 MTE1 Medicago truncatula genomic

54% to 72A65

1    NSFLWEGTNL*KIITNPEQIKEIFNNMNDFQKPKLSPLYKLLGTGLANYEGEKWRMHRKI  180

181  INPAFYTEKLKVI  219

497  FHMLQIMSPIFSQSCDEMIRKWEDISSDGKFEIDAKTFL  613

 

>CYP72A66 DQ335804                1277 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A66

(CYP72A66) mRNA, partial cds. Missing exon 1

CR347049, CR346714, CR294970

XXNSFIWFGIKPRLTLTEPEQIKDVLNKMSD

FPKTNYKIFPLLASGLASYGGEKWSKHRRLINPAFHLEQLK  ()

IMTPAFFTSCNDMISKWEEMLSSDGSCEIDVWPSLQNLASDAISRTAFGSSYEEGKRIFQL

QREQAELITTVVMKSTIPLWMFLPIFVHRKMNEIDKEITSSLKDMINKREKELKAGES

TKNDLLSILLESNHKEIENNNNNKSVGMSLDHVVEECKLFHFAGQETTSVLLVWTMIL

LSRYPDWQTRAREEVLHVFGNKKPDFDGLNNLKI VTMILYEVLRLYPPVMGLARNVVK

DMKLGNLTLPAGVEVFLPILLIHHDCKLWGDDAKMFNPERFSGGISKATNGRVSFFPF

GWGPRICIGQNFSLMEAKMALSMILQHFSFELSSTYAHAPSTVITLQPQYGAHIIIRK

VET

 

>CYP72A67 DQ335780                2199 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A64

(CYP72A67 revised frrom 72A64) mRNA, complete cds.

MEASLAIYYGIILITVTLGLVYTWRVLNWIWLKPKRLEKLLREQ

GCNGNSYRLVLGDLKDSYKMGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWS

GTTPRLILTEPELIKDVLNRTSELQKPKYEIFKFLFSGLIIHEGEKWRKHRRLMNAAF

QLEKLKIMAPSFLTSCIDMISKWESTLSSDGSGEIDIWPSLQNLTSDVISRNAFGSSY

EEGKRIFDLQREQGELVMKNLVKSLIPLWRFIPTATQRRMHEIEKDIDSSLRYIINKR

EKAMKAGEATENDLLGLLLESNHQEIRDHGNNKNMGMSLEDVVGECKLFYLAGQESTS

TMLVWTMILLSRYPDWQERAREEVLQIFGNKKPDYEGLNKLKILPMILYEVLRLYPPA

FGVTRYVGKDIKFGNMEVPAGVEVFLPIILLQHNNELWGDDAKMFNPERFAEGISKAT

NGRFIYFPFGGGPRVCMGQNFSLLEAKMAVSMILQNFYFELSPTYAHTPNLVMTIQPE

KGAHVILRKVKA

 

>CYP72A68 DQ335782                1845 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP72A65

(CYP72A68 revised from 72A65) mRNA, complete cds.

MELSWETKSAIILITVTFGLVYAWRVLNWMWLKPKKIEKLLREQ

GLQGNPYRLLLGDAKDYFVMQKKVQSKPMNLSDDIAPRVAPYIHHAVQTHGKKSFIWF

GMKPWVILNEPEQIREVFNKMSE FPKVQYKFMKLITRGLVKLEGEKWSKHRRIINPAF

HMEKLKIMTPTFLKSCNDLISNWEKMLSSNGSCEMDVWPSLQSLTSDVIARSSFGSSY

EEGRKVFQLQIEQGELIMKNLMKSLIPLWRFLPTADHRKINENEKQIETTLKNIINKR

EKAIKAGEATENDLLGLLLESNHREIKEHGNVKNMGLSLEEVVGECRLFHVAGQETTS

DLLVWTMVLLSRYPDWQERARKEVLEIFGNEKPDFDGLNKLKIMAMILYEVLRLYPPV

TGVARKVENDIKLGDLTLYAGMEVYMPIVLIHHDCELWGDDAKIFNPERFSGGISKAT

NGRFSYFPFGAGPRICIGQNFSLLEAKMAMALILKNFSFELSQTYAHAPSVVLSVQPQ

HGAHVILRKIKT

 

>CYP72A70 CR955010.2b  Medicago truncatula chromosome 5

CR317685, CR317663, 71% to 72A59

82493  MEWYSSIIPIIVTVGLIWAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLKME  82311

82310  KEARSKSMNLTDDIMPRVIPYIQHNVKIH 82227

79506  GKNSFMWFGTKPRVILTEPEQIIDVLNNISDFPKNNHKIFKLLVSGLASLEGEKWSKHRR  79327

79326  LINPAFHSEKLK  79291

79088  VMTPTFFTSCNDLIRKWEEMLSPDGSCEIDIWPSLQNLASDVISRTTFGSSYEEGRRIFQ  78909

78908  LQIEQAELMTKVQMNFYIPLWR  78843

78712  FVPTMVNRRINEIGKDIKSSLKDMINKRVKILKEGGENKNDLLGILIETNHKEIKEHGN  78536

78535  NVNVGMNIEDVIQECKLFYFAGQETTSTLLVWTMVLLSRYPEWQARAREEVLQIFGNKKP  78356

78355  NFDGLNNLKI  78326

77672  VTMILYEVMRLYPPIIELSRNVEKNVKLGNLTLSAGVEVFMPIILLHHDCELWGDDAKMF  77493

77492  NPERFSGGISKATNGRVSFFPFGWGPRICIGQNFSLLEAKMAMTLILQHFSFQLSPAYAH  77313

77312  APATVIALKPQYGAHIILRKLET*  77241

 

>AC146743.11  Medicago truncatula

like 72A seq CR955010.2b, pseudogene N-term and I-helix only

82112  KLVHNLWWRPKRIEQQLR*QGVRGTSYKFWYGDLPQMIKSSREASLSKSLTLNHQNIVPITKH  81924

81898  NIDDCVTIDDVIEECKLFYFAGQETTTDLLTWSIIVLSMHPNWQDKARAEVLEICGTKTPDLEAINRLKI  81719

81718  VSKFI  81704

 

>CYP709B4 CG963508.1  MBEEM55TFB mth2 Medicago truncatula genomic clone 39I13,

53% to 709B2, 48% to 709E1 rice

CX520502 CX535173.1 CX523931.1 ESTs

MGYLIAIAIVTFTI

MMMSKIWRVCVILFWRPYAMTRHFRKQGVIGPPYSLVSGSLHDIKTMMKDAR

NMVMDKHSNDITQRVLPHYQIWSSLYGERFLY

WYGTEPRICISDVELAKEILSNKFGFYAKPKTRPSIVTMIGEGLAIVN

GVEWVRRRRILNPAFSMDKLKVMISRMAACTISMLEEWKKQAIETKEKSKKIEMTEEFRE

LTANIIAHTAFGTSFVHGREAFDAQTQLHKHCVASNSDVFIPGTQYFPTKSNIEIWK

LDRKMKKSLQCIIESRLQNSQSDCSYGDDLLGVMMDTEKTNDHGSKKLKMNEIMD

ECKTFFFAGHETTSNLLNWTVFLLSLHKDWQDKLRQEVQQICGMEIPDADMLSKLKM  (0)

VNMVLLEALRLYCPAIQLERVAS

 

>AJ410089.1 Medicago sativa library (Kalo P) Medicago sativa cDNA

C-term of CYP709B seq, ortholog of CG963508

417  CGMEIPDADMXSKLKM

     VNMVLLEALRLYCPAIQLERVASQDMKLGNLMIPRGTCLTIPIT  238

237  MIHTSKNI  214

214  WGEDANEFNPMRFINGISKASNHPNALLAFSVGPRNCIGQNFAMLEAKTVMTLILQRF  41

FLVSFSL

DYEHAPV

 

>CYP714A4 CX527024.1 Medicago truncatula cDNA,

74% to 714A1 56% to 714E1

614  DRIRTEVAQHCPNGIPDADSLPLLKTVSMVIQEVLRLYPPAAFVSREAYEDIQIGSLNVP  435

434  KGVCLWTLIPTLHRDPEIWGPDSNEFKPERFSEGVSKAIKFPQAYVPFGIGTRLCVGKNF  255

254  AMVELKVVLALIVSKFSFSLSPSYKHSPAYNMIVEPGHGVYL  129

 

>CG924844.1  MBEGK30TFB mth2 Medicago truncatula genomic clone 50F11,

CR302206, 48% to 714A2

941  STALSVVWAMYLLAVYPKWQQRIRTEISETFGNLPPSFTDITKLNQLKK (0) 810

228  MVILESMRIYGPAVTNSRETLAEMKIGNLVLPKGLYIWMFVPLLHRDTDNWGPDATEFKP  49

48   ERFANGLSGACKYPQA

 

>CYP714E1 Medicago truncatula

         GenEMBL AC151673.4

CR487934, CR480969, CR504550, CR483340, CR478119

92445 MSIVVEVMVALVAVLVALIHFLHVLVLRLRSLRAKLHRQGIHGPSPDFYFGNIKEMKTLLLQQQT 92251

92250 QVKQIKQEHEDEDVCASISHSWTSTVFPHIHKWRKQY 92140 (1)

100935 GPTFLYSTGSIQWLLVT DVEMVKEILLNTSFNLGKPSYLSRD MGPLLGQGIVSSSGLIWS 100756

100755 HQRKIIAPELYLDKVK 100708 (0)

100300 AMVDRVIYSTNILIRSWESRIERDGVVSEIKVDEDLRSLSADIIARVSFGSNYVEGKE 100127

100126 IFTKLRDLIKLLSKIYVGIPGFR 100058 (2)

99921 YLPNKSNRQIWRLEKEINSNISKLVKQRQEEGHEQDLLQMILEGAKNCEGSDGFFSNSI 99745

99744 SQDRFIIDNCKTIFFAGHDTTAITSSWCLMLLAKYQDWQDRARAEVLEVCGNGNPDASILRTMKT 99550 (0)

99246 LTMVIQETLRLYPPAVFITRTSFQDINLKGIKVPKGI 99136

99135 NMQIPIAILQQDIDIWGPDAHEFNPERFANGVLGACKIPQAYMPFGIGSRVCPGQHLSMI 98956

98955 ELKVFLSLILSKFRVSLSSSYCHSPAFRLLIEPGHGVVLNMTRI* 98821

 

>CG956831.1  MBEJS35TFB mth2 Medicago truncatula genomic clone 70F21,

CR309652, 76% to 714E1

231  FRYLPNKRNIQIWRLEKEINSKILKLVKQCQEKGSEQFLLQTILEGAKNCEGSDG  395

396  LFSNSISQERFIIDNCKSIFFAGHDTTAITSTWCLILLAKYQDWQDRARAEVLEVCRDGN  575

576  LDASNLRKMKT (0)

777  LTMVIQETLRLYSPVLFAARTTLKDYDLKGI

 

>CR307160.1  CR307160 MTE1 Medicago truncatula genomic

82% to 714E1

3    FKPERFSNGVLGSCKFPQAYMPFGIGSRVCPGQHLGMIELKVILSLILSKFRFSLSSTYC  182

183  HSPTLRILIEPGHDVVLKMTKI  248

 

>CR304256.1 Medicago truncatula genomic,

N-term for a CYP714 (partial)

442  MSIVIEVLVMALGAVLVSLIHFLNVMILR  528

 

>CG920054.1  MBEJL75TF mth2 Medicago truncatula genomic clone 68N6, genomic

82% to 714E1 N-term

265  MSISVEVVVALAAVLVALIHFLQVLVWRPKSLRAKLHRQGIHGPSPHFYLGNIQEMKTL  89

     LHQQQQLSLKHKEEKEDICDTISHSWTSS

 

>CYP714E7 CR485106.1  CR485106 MTH2 Medicago truncatula genomic

CR963790, CR297876, DY615858 AW775039.1 86% to 714E1

CR968004, CR966683, CR500604, CG973461, CR513492

     LGPLLGQGIISSSGPIWAHQRKIIAPELYLDK

     LKAMVDQIVDSTDIMLRSWESRIESDGVVSEIKIDEDLRS

4    LSADIIARVCFGSNYVKGKEIFTKLKDLLKLLSKIYVGIPGFR  (2?) 132

249  YLPNKSNRQIWRLEEEINSNISKLVKQRQEEGREQDLLQMILEGAKNCEGSD  404

405  GLLSNSVTRDRFIIDNCKTIFFAGHDTTSITASWCLMLLATYQDWQDRVRAEVLEVCGND  584

585  NLDANILRSMKT (0)

     LTMVIQETLRLYPPAVFLTRAAFQDINIKGIKVPKGMNIQIPIPILQHEIDIWGADAHEFNPERFAN  361

362  GVLRACKIPQAYMPFGIGSRVCPGQHLSMIE  454

     LKVFLSLILSKFHVSLSSSYCHSPAIRLLTEPGHGVVLKMTRV*

 

>CG928751.1 Medicago truncatula genomic clone

= CR510480, 68% to CYP714E1

     LRELQNIICKIFAGIPGFR (2?)

187  YLPNKSNRQMWRLEKEISSKISKLIKQRQIDAHDEQDLLQMILDSAKKCESDGDSFLPNAT  366

367  SRERFMIDNCKNIFFAGYETTAITTSWCLMLLATHPDWQDRVRAEVLKICGKDGIVD  537

538  ANQLKSMKT (0)  561

 

>CR510480.1 Medicago truncatula genomic,

= CG928751, 71% to 714E1

     IICKIFALIPGFR (2?)

193  YLPNKSNRQMWRLEKEISSKISKLIKQRQIDAHDEQDLLQMILDSAKKCESDGDSFLPNAT  372

373  SRERFMIDNCKNIFFAGYETTAITTSWCLMLLATHPDWQDRVRAEVLKICG  507

 

>CYP715A4 AC148154.15  Medicago truncatula clone mth217a6, complete sequence

join(28250..28526,28664..28893,29293..29901,30370..30798)

56% to 715A1

CG971912

MELIRLDYCIFVTMLATLCLLLLLILTFSWWVFPILKHKKLKSC

GLGGGPTPRFPLGNIDEMKIKDNVAYSYLSHDIHANVLPYFSSWQKLHGKVFIYWLGT

EPFLYIAGAEFLKKMSTDVMAKRWGKPNVFRNDRDPMFGNGLVMVEGNDWVRHRNIVA

PSFNPLNLKAMARTMIVSTNQMIDRWTSQIKLGKHEIDIEKEIIATAGEIIAKTSFGM

EGENAREVLHKLRALQMTLFKTNRHVGVPFGKYFNVKKNLVAKKLGKEIDKILLSIVE

ARKKSLKNNSKQDLLSFLVKENSDVSQSAKTLTTREVVDECKTFFFGGHETTALAITW

TLLLLATHEDWQNQLREEIKEVVGNNEFDITMLAGLKKMKWVMNEVLRLYPPSPNVQR

QTREDIKVDNVTVPNGTNMWIDVVAMHHDPELWGDDVNEFKPERFVDDVNGGCKHKMG

YLPFGFGGRMCVGRNLTFMEYKIVLTMLLSNFTFKVSPGYHHSPAIMLSLRPAHGLPL

IVQPLN

 

>CR330854.1  CR330854 MTE1 Medicago truncatula genomic

73% to 715A

470  FSYLTLNII*KIYGLICNFYMQMKWVRSEALRLYPPSPNVQRQAKEDIRVDNIKVPKGT  294

293  NIWIDVVAMHHDMTLWGNDANKFKPERFMNDANGECHHTMGYLPFGFGGRACIGRNLIF  117

116  MEYNIVLTLLLTKFKFKL  63

 

>CR346101.1  CR346101 MTE1 Medicago truncatula genomic

94% to 715A

443  EVLRLYPPAPNVQRQAREDIQVDDVTVPNGTNMWIDVVAMHHDPELWGDDVNDFKPERF  267

266  MDDVNGGCKHKMGYLPFGFGGRMCVGRNLTFMEYKIVLTILLSNFTFKVSPGYHHSPA  93

92   IMLSLRPAHGLPLIV  48

 

>CR295424.1  CR295424 MTE1 Medicago truncatula genomic

96% to 715A

442  IVTMLATLCLLLLLILTFSWWVFPILKHKKLKSCGLGGPTPRFPLGNIEEMKIKD  278

277  NVAYSHLSHDIHANVLPYFSSWQKLHGK  194

 

>CR346101.1 Medicago truncatula genomic,

93% to 715A

452  VMNEVLRLYPPAPNVQRQAREDIQVDDVTVPNGTNMWIDVVAMHHDPELWGDDVNDFKPE  273

272  RFMDDVNGGCKHKMGYLPFGFGGRMCVGRNLTFMEYKIVLTILLSNFTFK  123

 

>CG947844.1  MBEGB12TR mth2 Medicago truncatula genomic clone 48A24, genomic

70% to CR295424

92   VVLLATLCLLLLLILTFSWWIFPIQIHKKLKRNGFGGPTPSFPFGNIEEMKRK  250

251  NSIKSCVASSNLTNDIHSQVFPYFSSWQKSFGKS  352

 

>CYP721A11 AC148607.16  Medicago truncatula clone mth243g15, complete sequence

55% to 721A1

join(55386..55880,56014..56258,56718..57081,58012..58431)

CG960239, CR326214

MNHVPVLVTILVLVVLYYLLKTLHSIFYVPYKIQQHFRNQGISG

PTYRPIFGNSSEIKRLYAETKSESNPFDHDILKRVVPFYNRWSCMYGKTFLYWFGSTP

RLAISDPDLIKEVLVTNCVEYGKVPYNPQSKLLFGQGLVGLQGDQWNFHRRIFNLAFN

TEILKGWVPDIVLSVTTMLEKWENQRGGRDDFEIDVHRDLHELSADVISRTAFGSSFE

EGKHIFKLQEQQMHLFSQAVRSVYIPGFRYLPTKKNRDRWRLDKETRESICKLIETKS

SVKENTKNVLNSLMCSYKNEVGGENKLGLEEIIDECKTIYFAGKDTTANLLSWALLLL

AKHQEWQSMAREEVLRVIGHSQLPVADNLNDLKIVSMIINETLRLYPPALMLMRQTNK

NVMLGSIEVPAKTQLYLPLTDIHHNREIWGEDCHGFNPMRFSEPRKHLAAFFPFGLGP

RTCVGQNLALVEAKIALALIIQHYSFEVSPSYIHAPVLFITLQPQHGAQILFRRISC

 

>CG976056.1  MBEKB76TRB mth2 Medicago truncatula genomic clone 72M8,

75% to 721A

440  LDKQTRESI*KLIETKRSVKENTKNSLMSSYKNEVGGEDRLQLDEIID  583

584  ECKTIYFAGKDTTSNLFTWGVLLLAEYKEWQSKAHEEI  697

 

>CYP734A12 ortholog AC152406.8  Medicago truncatula clone mth271o20, complete sequence

join(47747..47965,48081..48322,48458..48842,49420..49878)

only 434 aa a little short

77% to 734A1, 45% to 72A59

CG968413, CG945599, CG943034, CR294120, CR502541, CR502370

46196  MELELLSWLKLVSFSFIFLLCVLKVTVL

46280  LWWRPRKIEGYFAKQGIRGPPYHFFIGNVKELVGMMLKASSQPMPNFSHNILPRVLSFY  46456

46457  HHWKKIYG  46480

47750  FLVWFGPTVRLTVSDPDLIREIFTSKSEFYEKNEAPPLVKQLEGDGLLSLKGEKWAHHRK  47929

IISPTFHMENLKLLIPVMATSVVEMLEKWSEMSDKGEVEIE

VSEWFQTLTEDVITKTAFGSSYQDGKAIFHLQAQQMILAADAFQKIFIPGYRFFPTRK

NIKSWKLDKEIKKSLVKLIKRREENLNNGNEERIEKGPKDLLGLMIEASSNNNNTNVT

VDDIVEECKSFFFAGKQTTSNLLTWTTILLAMHPQWQVQARDEVLKMCGSRDLPTKDH

VVKLKTLNMIVNESLRLYPPTIATIRRAKTDVDLGGYKIPRGTELLIPILAVHHDIAI

WGNDVNEFNPGRFSEGVARAAKHPVAFIPFGLGVRTCIGQNLAVLQTKLALAIILQRL

SFRLAPSYQHAPTVLMLLYPQYGAPIIFNQLSIVDNPNQGSS

 

>CYP735A10 Medicago truncatula genomic clone

CR323638, CR297536, CG930803, CR321042

75% to 735A1

LNLQLVMDECKTFFFAGHETTALLLTWTAMLLAINPSWQEKVRIEVKEIFNQGTPSIDQF  SKLNV  (0)

LHMVINESLRLYPPASVLPRMAFEDIILGDLYIPKGLSIWIPVLAIHHSEKLWGKDANEXXXX

RFASKSFMPGRFPLFASGPRNCVGQSFAMMEAKIILAMLISKFSFTISENYKHAP

ITVLTIKPKYGVQICLKPLDP*

 

CYP74 clan

 

>CYP74A1 Medicago truncatula mRNA for allene oxide synthase (aos gene).

ACCESSION   AJ316561

MASSTLSTPSPNLLKHQNRPSSTTSSRRSSTFLPPIRSSVSEKP

PFQVSISQPQTTKLPIRKIPGDYGIPFIQPYKDRLDYFYNQGRDEYFKSRIQKYQSTI

FRTNVPPGPFIAQNPNVVVLLDGKSFPVLFDASKIDKTDVFTGTYTPSTELTGGYRVL

SYLDPSEPKHEQLKKLMFFLLKSRSRHVIPEFQSCYREFFNALENQLAENGHASFADN

NDQAAFNFLNRALFGVNPVDTELGLDGPKMVQKWVLFQLGPVLKLGLPKFVEDSMIHN

FRLPFRLIKKDYQRLYDFFYASSGFALEEAERLDVSKEEACHNLLFATCFNSFGGMKL

FFPNLMKWIGRGGVRLHTKLATEIREAVRSAGGEITMAAMENMPLMKSVVYEAFRIDP

PVPLQFGRAKRDMVIENHENGFLVKKGELLLGYQPFATKDPKIFERAEEFVADRFVGD

EGEKLLKHVLWSNGPESQSPTVGNKQCAGKDFTTLISRLLVVELFLRYDSFEIQVGNS

PLGPSITLTSLKRSSF

 

>CR968904.1  CR968904 MTH4 Medicago truncatula genomic

83% to 74A1

3    LYDFFYESSTGPVLDEAVRLGVSKEEAVHNLLFATCFNSFGGMKIFFPNLLKWIGRGGV  179

 

>CYP74B4v1  Medicago sativa mRNA for hydroperoxide lyase (gene).

ACCESSION   AJ249245

MSLPPPIPPPSLATPPKARPTELPIRQIPGSHGWPLLGPLSDRL

DYFWFQKPENFFRTRMEKYKSTVFRTNVPPTFPFFTNVNPNIIAVLDCKSFSHLFDMD

LVDKRDVLVGDFVPSVEFTGNIRVGVYQDVSEPQHAKAKNFSMNILKQSSSIWVPELI

SNLDIFLDQIEATLSNSSSASYFSPLQKFLFTFLSKVLARADPSLDPKIAESGSSMLN

KWLAVQLLPTVSVGTIQPLEEIFLHSFSYPYALVSGDYKNLYNFIKQHGKEVIKNGTE

FGLSEDEAIHNLLFVLGFNSYGGFSIFLPKLIESITNGPTGLQEKLRKEAREKGGSTL

GFDSLKELELINSVVYETLRMNPPVPLQFGRARKDFQLSSYDSAFNVKKGELLCGFQK

LVMRDPVVFDEPEQFKPERFTKEKGAELLNYLYWSNGPQTGSPTVSNKQCAGKDIVTF

TAALIVAHLLRRYDLIKGDGSSITALQKAK

 

>CYP74B4 DQ011231.1 ortholog of M. sativa seq

Medicago truncatula 13hydroperoxide lyase (HPL3) mRNA, complete, 96% to cyp74B4

AC150799.4  Medicago truncatula chromosome 2

complement(join(58647..59290,59492..59873,62944..63360))

MSLPPPIPPPSLATPPKARPTELPIRQIPGSHGWPLLGPLSDRL

DYFWFQKPENFFRTRMDKYKSTVFRTNVPPTFPFFTNVNPNIIAVLDCKSFSHLFDMD

LVDKKDVLVGDFVPSVEFTGNIRVGVYQDVSEPQHAKAKSFSMNILKQSSSIWVPELI

SNLDIFLDQIEATLSNSSSVSYFSPLQQFLFTFLSKVLARADPSLDPKIAESGSSMLN

KWLAVQLLPTVSVGTIQPLEEIFLHSFSYPYALVSGDYNKLYNFIKQHGKEVIKSGTE

FGLSEDEAIHNLLFVLGFNSYGGFSIFLPKLIDSIANGPTGLQEKLRKEAREKGGSTL

GFDSLKELELINSVVYETLRMNPPVPLQFGRARKDFQLSSYDSAFNVKKGELLCGFQK

LIMRDPVVFDEPEQFKPERFTKEKGAELLNYLYWSNGPQTGSPSGSNKQCAGKDIVTF

TAALIVAHLLRRYDLIKGDGSSITALRKAK

 

>CYP74C12 Medicago truncatula mRNA for 9/13 hydroperoxide lyase (hpl2 gene).

ACCESSION   AJ316563

MASSKQEQSSTNKELPLKQIPGSYGLPFIGPIFDRHDYFYNQGR

DKFFSTRIQKYNSTIFRTNMPPGPFISSNPRVIALLDAASFPILFDNKKVEKLNVLDG

TFMPSTKFTGGYRVCAYLDTTEPNHALIKGFYLNTLLLRKDTFIPLFKTILSDGFNEI

EDGLSSKSGKADFNSMVSVASFNFMFKLFCDDKNPSETILGDQGPKMFDTWLLFQLAP

LATLGPPKIFNYLEDILLRTVPFPACLTRSSYKKLYEAFSTSATTMLNEAEKAGLKRS

EALHNIIFTAGFNAYGGLKNQFPILFKWLGSSGEELHKELANEIRTVVKQEGGVTIQS

LEKMPLVKSVVYEAMRIEPAVPYQYAKAREDLIVKSHDAAFEIKKGEMIFGYQPFATK

DPRVFDDPEVFVAKRFVGEGEKLLKYVLWSNGKETEEPSVGNKQCPGKNLVVLLCRLL

LVEFFLRYDTFENETKNNAFGAAVSITSLTKASSV

 

>CYP74C13 Medicago truncatula mRNA for 9/13 hydroperoxide lyase (hpl1 gene).

ACCESSION   AJ316562

CG935768 CR499006 CG967887 CR305353 CR344356 CR503697

MASSSETSSTNLPLKPIPGSYGLPIIGPLHDRHDYFYNQGRDKY

FQTRIEKYNSTVLKLNMPPGGFIAPDPKVIALLDGASFPILFDNAKVEKRDVLDGTFM

PSTDFFGGYRTCAFQDTAEPSHSLLKRFIFHILSSKHDTFIPLFQTNLTEHFTDLEKE

LAGKHQKASFNTSIGGITFNFLFKLITDKNPSETKIGDSGPTLVQTWLAAQLAPLATA

GLPKIFNYLEDVLIRTIPIPAWTVKSSYNKLYEGLMEAGTTVLDEAEKMGIKREEACH

NLVFTLGFNAFGGLTNQFPILIKWVGLAGADLHKKLADEIRAIVREEGGVNLYALDKM

TLTKSTVYEALRIEPAVPYQYAKAREDLVVQSHDASFEIKKGEMIFGYQPFATKDAKI

FDKPEDFIAERFIGDGEKLLKHVFWSNGRETDEATPDNKICPAKNLVVLLCRLYLVEF

FLNYDTFTFDFKPSVLGPTITIKSLVKASSTV

 

CYP85 clan

 

>CYP85A1 CG945080 Medicago truncatula genomic, partial, genomic is not in nr

ARKSIINILSKLLEERRASKEIYEDMLSCLMRGNDNKSKLNDEELIDLIITIMYSGYETI

STTSMMAVKYLHDHPKVLDEMRKEHFAIRERKKPEDPIDCNDLKSMRFTRAV

IFETSRLATIVNGVLRKTTHDMELNG

 

>CYP87A9    Medicago truncatula

GenEMBL AA660764 00656 MtRHE

59% identical to Nterminal of CYP87A1

AC146573.21 genomic

74% to 87A2

join(120579..120775,121025..121346,121454..121603,

121782..122033,122138..122227,122317..122395,

122541..122647,122838..122965,123081..123207)

MWVLCLGALVTICIITRWVYRWRNPSCNGKLPPGSM GLPLLGES

LQFFSPNTSCDIPPFIRKRMKRYGPIFKTNLVGRPVVVSTDPDLNYFIFQQEGKIFQS

WYPDTFTEIFGQQNVGSLHGFMYKYLKNMMLNLFGPESLKKMISEVEQAACRTL QQAS

CQDSVELKEATETMIFDLTAKKLISYDPTESSENLRENFVAFIQGLISFPLNIPGTAY

NKCLQGRKKAMKMLKNMLQERREMPRKQQMDFFDYVIEELRKEGTLLTEAIALDLMFV

LLFASFETTSQALTYAIKLLSDNPLVFKQLQEEHEAILERRENPNSGVTWQEYKSMTF

TFQLITETARLANIVPGIFRKALREINFKGYTIPAGWAIMVCPPAVHLNPAKYQDPLV

FNPSRWEGMEPSGATKHFLAFGGGMRFCVGTEFAKVQMAVFLHCLVTKYRWRPIKGGN

IVRTPGLQFPNGFHVQITEKDQKKHESECTTTY

 

>CYP87A9      Medicago truncatula

            GenEMBL AA660764 00656 MtRHE

            59% identical to N-terminal of CYP87A1

GLPLLGESLQFFSPNTSCDIPPFIRKRMKRYGPIFKTNLVGRPVVVSTDPDLNYFIFQQE

GKIFQSWYPDTFTEIFGQQNVXSLHGFMYKYLKNMMLNLFGPESLKKMISEVEQAACXTL

 

>CYP88A13 52% to 88A4 CR931738.1  Medicago truncatula chromosome 5

CYP88  TC97565 48% to 88A4, 47% to 88D1

CR931738.1 CL314721.1  Medicago truncatula chromosome 5

81776 MGLLDYSQWLILVAALLGGYAFVFGFLRRLNEWYYVGRLGKSQN

LPPGDMGWPFFGNMPTFAKYAKSDPDSLIYNLISR

YGRTGMYRTHLFGYPTVIVCSPETCRNVLKDEEHLKPGYPASAMALAGKKSFHGISSAE

HKRLRKVTTSPINGHELYNYIGLIEDIVVKNLEDSSKTNTPVEFLKEAKKFTFDVITSV

FFSSDREHADLALVEHLYIDLLRGMRSQSINLPGFPFYKALK

ARKKLVKLLKGLVDHKRRNNNNEKQQTKKDLMELLMEARDDEGEKLEDEDIIDLLLLFLL

AGHESSAYGVLWTVINLTNHPHVFERAK

KEQEEIMARRPSDQKGLTHTEIRQMKYLSQ

VIDEMLRKTSISFANFRQAKVDFNLNG

GYTIPKGWKVLVWNRGVHMDPENYPNPKEFDPSRWE

NFKARVGQFLPFGYGSRYCPGSDLAKLEITIYLHHFLLNYR

MERINPDCPITYLPIARPTDNCLARIIKVT* 77319

 

>CYP88A14 CR931738.1  Medicago truncatula chromosome 5 clone mth256k10,

56% to 88A4, 55% to 88A6, 56% to 88A11

CR299583.1

72170  MVLLDYSQWLILVAALLGGYAFVFGFLRRLNEWYYVGRLGKSQNLPPGDMGWPFFGNMP  71994

71993  TFLKAFKSADPDSFINNLVSR   71931

71703  YGKTGMYRTHLFGSPSIIVCTPETCRKVLTDEENLKVGYPHSTMVLTGKRSFHG  71542

71541  ISNSEHKRLRRLITSPINGDEALSTYISLIEDSAVKHLEELSKMNTPCEFLKEMRKFAFE  71362

71361  VITTIFISSDRDH  71323

VDLGLVENLYIDLLKGMKSLAINLTGFAFHKALK

ARKKLMKLLQALVDQKRRNNNKVKKMKKDMMDLLMEVKDEEGRMLEDEDIIDLLLVFLL

AGHESSAHGILWTIIYLIDHPHVFQRAK

KEQEEIMETRPSTQKGLNLKEIKQMQYLSK

VIDEMLRITTISFANFRRAKVDVNING  69806 

69552  GYTIPKGWKVLVWNRGVHMDPEIYTNPKEYDPSRWE  69445

NYKAKAGSFNPFGLGSRLCPGSDLAKLEITIYLHHFLLNYR

MERINPDCPVTYLPVPRPKDNCLARIIKVT* 68951

 

>CYP88D1 AC144538.23

complement(join(124806..124905,125048..125169,

125592..125698,125793..125868,127018..127107,

129807..130070,130160..130631,131357..131589))

43% to 88A4, 38% to tomato 88B1, 37% to 88C1, 36% to CYP88x Selaginella

MELQWFWMFAATLLACYIFVSKVMRNLNGWYYDLIFKNKQYPLP

PGDMGWPLIGNLWSFFKYFYSGRGEMFINNIIFKFGRTGIYKTHLYGSPSIIVIAPAI

CKKVLIDEVTFKIGYPKSALELGDSKILHKERGRFKQLVSSPINGHNVLEMYLERIED

IVINKLEELSSMKHPVEFLTEMKKASFEFVIHIFFDSCDQDTVNKIGDLFNVMSIALL

SFMPINVPGFAYNKALKARMEFVKIIENIICGRRMAIKNGQIGENNNLLDIILETKDE

RGEKLEDKDIIDLLIAFLFGAHDSIATASMWSVMYLAQNPLCLKKAKEEQEGILKARS

TSQKRLSIEEIKKMIYLSQVVDETIRHITIFSAFREAAIDVNINGYFIPKGWKVLVWL

SALHMDPEYYSNPKEFNPTRWDDYNPGSGTFIPFGVGRRLCPGRDLAKYEISIFLHYF

VLNYKLERINPECPITSFPYSKPIDNCLAKVIKISDS

 

>CR323935.1  CR323935 MTE1 Medicago truncatula genomic

74% to AC144538.23

165  YRLEIVNPECPMTCLPSSKPIDNCLARVIKI  257

 

>CR512856.1 Medicago truncatula genomic, /17 (76%), Gaps = 0/17 (0%)

72% to AC144538.23

401  GYIIPKGWKVLPWLRAI  351

349  IHMDPTYYPNSDEFNPSRW  293

 

>AC152157.10  Medicago truncatula

Cterm piece 69% to AC144538.23 runs off the end

86259  DYNPTAGTFLPFGIGSRLCPGGDLARLEMTIFLHYFILNYK  86137

86000  FERINPKCPLTYIPIPKPTDNCLGKVIQLS  85911

 

>CR345113.1 Medicago truncatula genomic,

64% to CR931738

BQ123950 BG450794.1 ESTs

FLQKHPEYLQKAKEEQEEIIKRRPPTQKGLTLKEIRGMDFLYKVIDETM

RVITFSLVVFREAKSDVMINGYTIPKGWKVLTWFRSVHLDPEIYPNPKEFNPNRWNKE

HKAGEFLPFGAGTRLCPGNDLAKMEIAVFLHHFILNYQ (2)

LEQLNPKCPVRYLPHTRPMDNCLGRVKKCSST*

 

>CG949073.1 Medicago truncatula genomic clone

= CG929798, 41% to 88A3

7    LAKLVKPIVEERRSMIKNGEKTKDKDLLDIFLEARDEDGWKPDDDDIIDMLIGIVLAGHEATA  186

187  NTMMWSMIYLTQNPHIMKKAKVINF  261

 

>CG938838.1 Medicago truncatula genomic clone

41% to 88A4, 52% to AC144538.23

507  RYGRTGIYKSHLFGSPSIIICDSDMCRQILTNDETFKIGYPKSTMEVTRCKFFWRSSQE  331

330  EHKRVKRLISVLTMGHNTLEMYLTCMEDIVINSLEEISSMNHQVEFLKEMKNI  172

171  SFQVIVDILIGSYNQHIITKIGDSFTEIYGALFSMPINLPGFAFHKGL  28

 

>CR302898.1 Medicago truncatula genomic,

72% to AC152157.10, 75% to 88A3

505  FLPFGAGSRHCPGSDLAKIEISIFLHYFLNNYK  407

 

>CYP90A14 TC109815   79% to 90A1

CR482185.1

KYISMAYFLFFIIFIFFLFLLLLRKLRYARLQLPPGSLGLPFIGETLQMISAYKSDNPEP

FIDQRVNRYGSIFTSHVFGEPTVFSADPETNRFIIMNEGKLFECSYPGSISNLLGKHSLL

LMKGSLHKKMHSLTMSFANSSIIKDHLLFDIDRLIRLNLDSWSDRVLLMEEAKKITFELT

VKQLMSFDPDE

 

>CR315678.1 Medicago truncatula genomic,

91% to 90A14

622  RRYKLPPGSLGLPFVGETMQLISAYKTDNPEPFIDQRVNRYGSIFTTHVFGEPTVFSADP  443

442  ETNRFILMNEGKLFECSYPGSISNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLL  263

262  LDIDRLIRLNLDSWSDRVLLMEEAKKVSYFI  170

 

>CYP90B10 AC147964.10  Medicago truncatula clone mth25i18, complete sequence

join(64431..64633,64920..65244,65341..65493,65743..65994,

66136..66228,66341..66419,66997..67103,67189..67200)

70985..71194

69% to 90B1

MSNSYLTCSFLSSIFVLSLIFIFIKRKKTRYNLPPGKMGWPFIG

ETIGYLKPYTATTMGEFMENHIARYGTIYKSNLFGGPAIVSADAELNRFILQNDGKLF

ECSYPKSIGGILGKWSMLVLVGDMHREMRNISLNFMSYARLKTHFLKDMEKHTLFVLS

SWKENCTFSAQDEAKKFTFNLMAKQIMSLDPGNLETEQLKKEYVCFMKGVVSAPLNLP

GTAYRKALKSRNNILKFIEGKMEERVKRNQEGKKGMEENDLLNWVLKHSNLSTEQILD

LILSLLFAGHETSSVAIALAIYFLPSCPQAIQQLREEHREIARSKKKAGEVELTWDDY

KRMEFTHCVVNETLRLGNVVRFLHRKAIKDVHYKGYDIPCGWKVLPVISAVHLDPSNF

DQPQHFNPWRWQAGV 67112

70985 MSNNNFMPFGGGPRLCAGLELAKLEMAVFIHHIILKYNWDMVDVDQPIVY  71134

PFVDFPKGLPIRVQSQATL

 

>CYP90B11 CT033768.1  Medicago truncatula chromosome 5

70% to CYP90B1

34766  MSDSDITFYFLSSILSLLIFIFFLIKTKQAKPNLNLPPGRMGWPFIGETIGYLKPYSAT  34942

34943  TIGKFMEQHIAR  34978

35064  YGKIYKSNLFGGPTIVSADAGLNRFILQNEGKLFECSYPSSIGGILGKWSMLVLVGD  35234

35235  MHRDMRNISLNFLCHARLRTHLLKEVEKHTRLVLSSWKEKTTFAAQDEAKK  35387

35474  FTFNLMAEHIMSLQPGKIETENLKKEYVTFMKGVVSAPLNFPGTAYWRALK  35626

35852  SRCTILKFIEGKMEERMKRMQEGNENSEENDLLNWVLKHSNLSTEQILDLILSLLFAGH  36028

36029  ETSSVSIALAIYFLPGCPQAILQLR  36103

36376  EEHKEIARAKKQAGETELTWEDYKKMEFTHC 

36693  VVNETLRLGNVVRFLHRKALKDVRYK  36770

36890  GYDIPCGWKVLPVIAAVHLDPLLFDQPHHFNPWRWQX  36997

39192  GASGNSNIFLPFGGGPRLCAGSELAKLEMAVFIHHLILNYNWELTDNNDQAFAYPFVDFP  39371

39372  KGLQIRVQAHSLI  39410

 

>CYP90C4 ABE89648. 63% to 90C1 Medicago truncatula

AC146720.23

MAWGWGQGRSPSTTRVSPSVKFLLTSSPLGGIRHGKNSIKKKKN

KVKMNKKKGKVPRGNKGWPLLGETLDFIACGYTSNPVSFMEKRKSL

YGDVFKTSILGTGVIVSTDPDVNKVILQNQGSIFIPA

YPKSIRELMGEHSILQMNGNMHRKLHALLGGFLRSPQFKARITRDIEHSVKQCLASWT

HQPIYVQDQVKK (0)

ITFTILVKVLMSIDPGEDLYNLKREFEEFIKGLICLPIKLPGTRLYKSLK (0)

AKERMMKIVQRIIEERNDNKDCVANDVVDVLLQDKDESNTIPNIWLKNMSENII

EMMIPGEETLPTAMTMAVKFLSDSPLALSKL ()

EENIELKKSKNCSDDYAWSDYLSLQFTQN ()

VINETLRMANIVNAIWRKAIKDVDIKG ()

YLIPKDWCVVASL TSVHLDGTNYEKPLEFDPWRWEKIEAGTRNNCFTPFGGGQRLCPGIELSRLELSIFLHHLVTTYRWVAEK DEIIYFPTVKMKKKLPIIVTTINT

 

>CG936144.1 Medicago truncatula genomic clone

42% to 90C1 Nterm

719  LMGTFLLCWWFLFMKKKKNKVKMNKKKGKVPRGNKGWPLLGETLDFIACG  570

 

>CYP707A16 Glycine max

AI735873.1 AW472495.1  BE555159.1 AW423990.1

BM187643.1 BM178973.1  BI471774.1  BG507701.1 BQ473983.1

73% to 707A1, 72% to 707A3, but end after TTKYR does not match

55% to 707A4 and the end does match

MELSTMFFLCASLLFIVLFFRTLIKPYYVSKRRDLPLPPGSMGWPYIGETFQMYSQDPNV

FFASKIKRFGSMFKSHILGCPCVMISSPEAAKFVLNKAQLFKPTFPASKERMLGKQAIFF

HQGEYHANLRRLVLRTFMPEAIKNIVPDIESIAQ

DCLKSWEGRLITTFLEMKTFTFNVALLSIFG

KEEILYRDALKRCYYTLEQGYNSMPINVPGTLFHKAMKARKELAQIVAQIIWSRRQ

RKMIDYKDLLGSFMDEKSGLTDDQIADNVIGVIFAARDTTASVLTWIVKYLGENPSVLEAV NEEQE

CILKSKEERGEDKGLNWEDAKKMPITSRVIQETLRVASILSFTFREAVEDVEYQGYLIPK

GWKVLPLFRNIHHSPDNFKEPEKFDPSRFEAAPKPNTFMPFGSGIHMCP GNELAKLEILVLL

HHLTTKYR

WSVVGAKNGIQYGPFALPQNGLPITLFPKSK*

 

>CYP707A17 DQ335814                1230 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP707A16

(CYP707A17 revised from 707A16) mRNA, partial cds.

Note 707A16 = Glycine max DQ340252

ESTs BG646607.1 AW687753.2

MELSIMLCFFTSILFIVLFRIFIKSFVSKRHDLPLPPGSMGWPY

IGETFQLYSQDPNVFFASKIKRYGSMFKSHILGCPCVMISSPEAAKFVLNKAQLFKPT

FPASKERMLGKQAIFFHQGEYHANLRRLVLRTFMPVAIRNIVPDIESIAEDSLKSMEG

RLITTFLEMKTFTFNVALLSIFGKDEIHYREQLKQCYYTLEKGYNSMPINLPGTLFHK

AMKARKELAQILAQIISSRREKKEEYKDLLGSFMDEKSGLSDEQIANNVIGVIFATRD

TTASVLTWIVKYLGENISALESVIEEQESILKSKEENGEEKGLNWEDTKKMVITSRVI

QETLRVASILSFTFREAVEDVEYQGYLIPKGWKVLPLFRNIHHSPNNFKDPEK

FDPSRFEAATKPNTFMPFGSG IHACPGNELAKMEILVLLHHLTTKYRWSVEGTK

NGIQYGPFALPQNGLPITLYPKK*

 

>CYP707A18 AC151424.15  Medicago truncatula clone mth2101c17, complete sequence

complement(join(71072..71201,71640..71758,71850..71956,

72138..72216,72394..72480,72931..73185,73267..73416,

73769..74093,74427..74623))

64% to 707A4, 56% to 707A19

CR294148.1 CR319279 CG951226

MDSTLAYIIVLFLLTLFSFKFFPKRPKTKQTSAKLPPGSMGWPY

IGQTLQLYSQDPNVFFFSKQKRYGEIFKTNILGCKCVMLASPEAARFVLVTQSHLFKP

TYPKSKERLIGPCALFFHQGEYHLRLRKLIQRSLSLDSLRNLVPEIEALAVSTIKSWG

DDGCMINTFKEMKKFSFEVGILKVFGNLEPRLREELKKNYWIVDNGYNSFPTQIPGTQ

YKKALLAREKLGSILKEIISERKEKKLLESERDLLSCLLNWKGEGGEILSDDEIGDNI

IGVLFAAQDTTATVMTWVIKYLHDQPKLLECVKAEQKAIHMENDGKLQLNWNQTRNMP

ITYKVVLESMRMASVISFPFREAVADVEYKGFLIPKGWKAMPLFRNIHHNPEFFPEPH

KFNPSRFEVSPKPNTFLPFGSGVHACPGNELAKLETLIMIHHLVTKFRLEVVGSQCGI

QYGPFPLPLNGLPARCWRESTSIARKRFIGQK

 

>CYP707A19 new

AW776461.1 EST

AC174363.7 genomic 83% to 707A17, 74% to 707A1

CR330355.1 CR312173.1

MEITTLFFYFASFLFIVLFKSLIKNFLFPSNGKQLPLPPGSMGYPYIGETFQMYSQDPSLFFANKIK

YGAMFKSHILGCPCVMISSPEAAKFVLNKSQLFKPTFPASKERMLGKQAIFFHQGNYH

ANLRRLVLRSFMPEAIKSIVPNIESIAQTCLKSWDGNLITTYLEMKT

FTFNVALLSIFGKDEILYREDLKRCYYTLEKGYNSMPINLPGTLFHKAMKARKELAQILE

QIISTRRCKKQVYNDLLASFMDEKAGLSDEQISDNIIGVIFAARDTTASVLTWIVKYLGE

NPSVLESVT (0)

85269 EEQMSIIKGKQENGEEIGLNWEDTKNMPITSRVIQETLRVASILSFTFREATEDVEYQG

YLIPKGWKVLPLFRNIHHSPENFKEPEKFDPSRFE 85550

85670 VAPKPNTFMPFGNGVHACPGNELAKLEILVLVHHLTTKYR 85789

86141 WSVVGEKNGIQYGPFALPQNGLPINLYSKK* 86233

 

>CG931620.1 Medicago truncatula genomic clone

96% to AC151424.15

712  VKAREKLGSILKEIISERKEKKLLESERDLLSCLFDWKGEGGEILSDDEIGDNIIGVLFA  891

 

>CR335896.1 Medicago truncatula genomic,

72% to AC151424.15, 64% to 707A18

725  LSDEEVADNVIGVLFAAQDTTASVLTWILKYLHDHQKLLEAIKVSVF  585

 

>CR305206.1 Medicago truncatula genomic,

71% to 707A4, 69% to AC151424.15

117  RYGEIFKTRILGCQCVMLASPEAARFVLVTHSHLFKPTYPKSKEKLIGSSALFFHQGDYH  296

297  TRIRKLVQTSLSPESIKKLIPYIETQVISSLDSWVSTGQVINAFHELKKVILL  455

 

>CR309422.1 Medicago truncatula genomic,

= CR315139, 75% to 707A6 rice

383  LFYTFLFLLITLLLYPFIMKHNKHRATSKPKVPPGSMGWPYIGETLQLYSQHPNTFFAS  207

206  KQKRFLTLF  180

 

>CYP716A12 DQ335781                1940 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP716A12

(CYP716A12) mRNA, complete cds.

MEPNFYLSLLLLFVTFISLSLFFIFYKQKSPLNLPPGKMGYPII

GESLEFLSTGWKGHPEKFIFDRMRKYSSELFKTSIVGESTVVCCGAASNKFLFSNENK

LVTAWWPDSVNKIFPTTSLDSNLKEESIKMRKLLPQFFKPEALQRYVGVMDVIAQRHF

VTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVAKFSDPFQLIAAGIISLPIDL

PGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQDILSHMLLTSDENGKSMNE

LNIADKILGLLIGGHDTASVACTFLVKYLGELPHIYDKVYQEQMEIAKSKPAGELLNW

DDLKKMKYSWNVACEVMRLSPPLQGGFREAITDFMFNGFSIPKGWKLYWSANSTHKNA

ECFPMPEKFDPTRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRFKWE

KVIPDEKIIVDPFPIPAKDLPIRLYPHKA

 

>CYP716D4 Stevia rebaudiana

GenEMBL DQ398871

ent-kaurenoic acid 13-hydroxylase

56% to 716D3, 55% to 716D5

MIQVLTPILLFLIFFVFWKVYKHQKTKINLPPGSFGWPFLGETL

ALLRAGWDSEPERFVRERIKKHGSPLVFKTSLFGDRFAVLCGPAGNKFLFCNENKLVA

SWWPVPVRKLFGKSLLTIRGDEAKWMRKMLLSYLGPDAFATHYAVTMDVVTRRHIDVH

WRGKEEVNVFQTVKLYAFELACRLFMNLDDPNHIAKLGSLFNIFLKGIIELPIDVPGT

RFYSSKKAAAAIRIELKKLIKARKLELKEGKASSSQDLLSHLLTSPDENGMFLTEEEI

VDNILLLLFAGHDTSALSITLLMKTLGEHSDVYDKVLKEQLEISKTKEAWESLKWEDI

QKMKYSWSVICEVMRLNPPVIGTYREALVDIDYAGYTIPKGWKLHWSAVSTQRDEANF

EDVTRFDPSRFEGAGPTPFTFVPFGGGPRMCLGKEFARLEVLAFLHNIVTNFKWDLLI

PDEKIEYDPMATPAKGLPIRLHPHQV

 

>CYP716D5 AC152752.18  Medicago truncatula

complement(join(105607..105912,106035..106222,

106442..106897,107501..107993))

61% to 716D3, 57% to 716D1, 56% to 716D2, 52% to 716A12

MEVTKLIVLPAVLALFVLFLHFIKRIIKLRKLNLPKGTLGFPFV

GESFEFLKANLEGKQIRFIQERMKKYDSKVFKTSLFGENIAVFCGPAGNKFLFSNENK

NVQVWWPSSVKKLLRLSLVNKVGDEAKVTRRLLMSFLNPETLRNYLPNMDRIAQHHIN

THWKGKEQVVVYPIIQLYTFELACCLFLSMEDPIDVSNLSSYFEEFLKGIIGFSINFP

GTRFHKAMKAADEIRKEIKMIMKKRKVDLDEKKASPTQDLLSHLLATPDTSGRFLNEV

EIIDNILLLLFAGHDTSRSVLSLVMKYLGNLPQVYEQVLKEQLEISQGKEAGELLQWE

DIQKMKYSWNVASEVLRLSPPVGGAFRDAIKDFTYADYNIPSGWKLHWNTHTTHMDPT

LFSNPEKFDASRFEGEGPTPYSYVPFGGGPRMCLGQEFARLEILVFMHNIVKRFKWDL

VNPDEKFKYDPMLEPENGLPIQLQPSQYTW

 

>CYP716G1 AC161863.21  Medicago truncatula, complete sequence

42% to CYP716A12, 45% to 716C2,

CR294101.1

14065  FLQSLLLILIPLIAFFCFFLKTKQIGTKNMPPGAFGWPLVGETYQLLFKNIENFIQ  14232

14233  ERAEKHSSEIFKTNLFGEPTVVMFGPAANKFLSINESKLVKVWYMKSQCKLFNLPDQNQN  14412

14413  QTQVGVASPPVKVLGLLKHEGIIRYMGNNNNIESIIQKHFITHWEGKTELKVYPLVKSFS  14592

14593  ISLAFQFFLGTDETHYVDKFATKFENLFSGIYSVPMDFPGSTYHRAIKGASEIRKEIQYM  14772

14773  IKDKIEGLSKGKVMDGLLAHIVDAEKSGKYVPKIEISNTIMGLMNASYISIATTLAF  14943

14944  MIKHIGLSPHIYQRIIS

       EHADIK  15123

15124  RSSKESGTSQLDWDSIQKLKYTWAVALESMRLYSPAPGAFREAKTDFTYEGFTIPKGWK  15300

15416  IFWAFIGTNKNPKYFDKPESFDPSRFEGNNVLAPYTYIPFGSGPRSCPGKDYTRLAILT  15592

15593  FIHNLVTKFKWEVMLPDEEVSGAMIPIPTEGIPIRLH  15703

 

>CYP720A1 ortholog AC138580.19  Medicago truncatula clone mth214e15, complete sequence

complement(join(85291..85399,85550..85677,85773..85894,

86443..86521,86724..86807,87151..87393,87822..87971,

88050..88374,88534..88757))

68% to CYP720

CG921452.1 CG975856.1

MRENISETWLVMIIVIMFTAIFAKVIQIKKRKEEKSIGRLPPGR

RGWPLIGDSINWYNAVASSHPPQFVEEMVQRYGKIFSCSLFGKWAVVSSDPSFNRFVM

QNEGKLFMSSYPKSFRDLVGKNGVITVQGEQQRKLHGIASNMMRLDKLKFHFMNDIQN

VMIQTLSNFKNQQVILLQDVCRKVAINLMVNQLLGVSSESQVNEMAQLFSDFVDGCLS

VPINIPGSSYHTAMK

XXXXXXXXXXXX

AREKIISKINKIIEVQRQNGPPKEGNNGVLGRLIEEDSLPDDA

VADFIINLLFAGNETTTKTMLFAVYFLTQCPNAMEQLLDEQDSLRTKSAEESLTWQDY

KAMPFTQCVIDETLRLGGIAIWLLREAKEDIQYQDFVIPKGCFVVPFLSAVHLDEKVY

NEAKNFNPWRWMEPENEEKRNWRSSPFYAPFGGGARFCPGAELARLQIALFLHYFVTN

YRWKQMKEDRMSFFPSARLVNGFEICLTKRHDNNQRN

 

>CYP722A1 ortholog AC151458.27  Medicago truncatula, complete sequence

39% to 722B1, 45% to 722A1 Populus

BH759623.1 Medicago truncatula BAC

BH739312.1, CR343594

       MWNLSREELVFVVQNYYD

82201  IILVLFLSIGLTYLASRAWKRATNNREDIPGRLGLPFIGETFSLLSATNSTRGCYDFVRL  82022

82021  RRLC (2)  82010

80845  RHGRWFKTRLFGKVHIYIPTPEGARTIFANDFDLFNKGYVKSMADAVGKKSLLCVPVESH  80666

80665  KRIRRLLSEPFSMTSL  80618

       YAFITKFDKLLCGRLQKLEESGKSFKTLDFCME (0)

       MTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAMLSFPVMIPGTRYYKGIT

79758  ARNRLMETFREIIARRRRGEESPGDFLQSMLQRDSFPASE  79639

79638  KLDDSEIMDNLLTLIIAGQTTTAAAMMWSVKFLNDNRDAQDILR  79507

       EEQLSLTKMKPEGASLNHEDINNMRYGLK

79156  ESVFFLQVVKETLRMSNVLLWFPRVALKDCTIEG 79058

78917  GYEIKKGWHVNIDATCIHYDSDLFMDPLKFNPQRFD  78810

78699  EMQKPYSFLPFGSGPRTCLGMNMAKVTMLVFLHRLTSGYT  (2) 78580

       WTLDDLDACLEKKAHIPRLRSGCPITLKSISKSMPET*

 

>CR320218.1 Medicago truncatula genomic,

= CR295889, CR485303 56% to 724A1

158  RYGRVFKSHLFGYPTIVSCDFELNMFILQNEGKLFPVDYPKVMHKILGKYALLLVTGELH  337

338  KKLRSTVISFVSASKSESNFLHFVEMLALSRINSWGSNCKQVAFYKEAKR  (0)

FSINVMLKHLLNINPDDPLAVKILENFENYIKGFITLPINIPGTTYSKAVK (0)

 

>CR299111.1 Medicago truncatula genomic,

87% to 724B1, 67% to CYP709B

150  DENSTSKKVAPFGGGPRLCPGADLAKVEIAFFLHHLVLNYR (2)  272

 

>CYP724 DT014285.1 Vitis vinifera cDNA

TSSLATQVLGNLVCCCNSQTRGFNRCMISQLESNLGPAWSPSTEDPSNSRFGTPAHTNLP

HGKMGWPLLGETLAYLKPHKSDSIGIFLQEHCS

RYGKVFKSHLFGHRTIVSCDHELNMFI

LQNEEKLFQSSYPQALHGILGRNSLILVSGDVHKKLRSLALGMIGGTKSTVNFLPSIERL

SISMMELWKGCKEVVFCKEAKR

FTFNLMMKQSLSIGPDEAV

 

>CR295197.1 Medicago truncatula genomic,

56% to 728B2 rice

     PIIGQSLGLLRAMRANTAEK

81   WIEDRINKYGPISKLSLFGTPTVLIHGQAANKFIFANGGDALVNQQTQSIKMILGDRNLL  260

261  ELSGKDHSRVRGALVPFLKPESLKQYVGKIDEEVRRHIQIHWEGKQQLK

 

>AL388713.1 Medicago truncatula cDNA

AL382824, AL388714.1

83% to soybean CYP728

3    GKEICVFDFMVAEQEEIAKGKLL 32

35   GETLTWEDLSKMKFTWRVAMETLRRFSPIFGGFRKTATDIEYGGYIIPKGWQIFWVTSMT  214

215  HMDNNIFPEPSKFDPSRFENLASTPPYCFVPFGGGARICPGYEFARVETLVAIHYLVTKY  394

395  SWKLLSENSFSRDPMP TPSQGLLIELCPRKLS*

 

>CX704924.1 Glycine max cDNA

54% to rice CYP728B2

851  ASARIQNILKEIVQKKKIELKQNAASARQDLISFLLGMVDEDGKQVMSEKEIFHNIK  681

680  LVMVAGHDTSAVLITFIIRLLANEPAIYAA VLQEQEEIAKGKLSGEALTWEDLSKMKYTW  501

500  RVAMETIRMFPPIFGGFRKAATDIEYDGYFIPKGWQIFWVTAMTHMDENIFPEPSKIDP  324

323  SRFENQASVPPYCFIPFGGGARICPGYEFSRLETLVAIHYLVTRFSWKLCSDNF  162

161  FSRDPMPVPTQGLLVQIWPRKLS*

 

>CYP729A5 DQ455129.1 Medicago truncatula

AW171727.2 Medicago truncatula cDNA

57% to CYP729A2

CA922948.1, BG588956.1, BG589086.1 BE239378 (ESTs)

CG942140.1 CR495708

FTKEPGPFLNSLDKLYQDLLLGVRAYPINIPGFAYHHALQCRRKLDDFFGMEL

DNRKNKDKVETIDLMDGLMQIEDDDGDKLSDKEVVDNIVSLVAAGYLSTSLASTWAIYL

LAKYPIVLKKLREENMAFRKGSPEDFITPKDVSNLKYTNKVVEEVIRMANIAACAFRKV

DTEVDYKGYKIPKGWNVILLLRYLHTDSKNFKDPMNFNPDRWNEPAKPGTYQPFGGGQRL

CPGNTLARIQLALLLHHLSIGYKWELINPNADIIYLSHPAPVDGVEVKFSKL*

 

>CG924975.1  MBEJF78TR mth2 Medicago truncatula genomic clone 67M12, genomic

62% to 733A1 rice C-term 85 clan

499 RWRALEKDDSVQPTLVRMPKNKYPVIVESL* 407

 

>Zinnia elegans CYP733

AU290839 EST

HGPPVNNMPYTAKVVSETLRRATILPWYSRKAAQDFEINGYSIKKGWSVNLDVVSIHHDP

QVFADPNKFDPSRFD

DPLRSYSFLGFGNGPRMCPGMNLAKLEISIFIHHLVCRY

KWKPLEKDDSVQPTLVRMPKNKYPIIVVPL*

 

>CG816619.1 Glycine max genomic clone

76% to rice 733A1

     SDKQLKDNILTLLVAGHDTTTAALTWLIKFLGENPIVLEQLR ()

     EEHRQIVINRKSGTDLTWAEVNNMPYTAK  () 352

432  VISETLRRATILPWFSRKASQDFEID   () 509

619  GYKIKKGWSVNLNVVSIHHDPEVFPDPEKFDPSRFD

790  ETLRPFSFLGFGSGPRMCPGMNLAKLEICVFIHHLVNRY  924

 

CYP86clan

 

>CYP86A23 TC103601, genomic is not in nr

AL381933.1

METFTLLLTLTAALSAYFLWFHLLARTLTGPKAWPFIGSLPGLFKNRNRVHDW

IAENLRATGVSATYQTSIMPFPFLAHKQGFYTVTCHPKNLEHILRTRFDNYPKGPKWQTA

FHDLLGQGIFNSDGETWIMQRKTAALEFTARTLKLAMARWVNRSIKNRLWCILDKSVKDN

VYVDLQDLLLRLTFDNICGLTLGKDPETLSPALPENPFSVAFDTATEATMYRFLYPGLIW

RFQKLFGIGSEKMLKQSLQIVETYMNNAISDRKETPSDDLMSRFMKKRDIDGKPINATIL

QHIILNFILAGRDTSSVALSWFFWLVMNHPKVEEKII

 

>CG922116.1 CG968429.1  Medicago truncatula genomic clone

BF519917.1

75% to CYP86A

KRDGNGKPFDAGKLRHIALNFVLAGRDTSSVALSWFFWLVMNHPSVEEKILAELTAVLAE

TRGGDSRRWTEEAVDFEEAEK

LVYLKAALAETLRLYPSVPEDFKYAVDDDVLPDGTVVPAGSTVTYSIYSVGRMKSVWGEDCM

EFKPDRWLSVHEGQTRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVAAAVLIRYRL

LPVPGHKVQQKMSLTLFMKYGLRVFLCPR

 

>CR964129.1  CR964129 MTH4 Medicago truncatula genomic

81% to 86A23

601  GSLPVLFMNRNRVHDWMTSNLNRTGGSNTYQTCILPFPFLARKQGFYTVTSHPKNIEH  428

427  ILRTRFDNYPKGPTWQTAFHDLLGHGIFNSDGDTWLVQRKTAALEFTTRTLRQAMARWVN  248

247  RTIKNRLWCILDKAVKEKVTVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSLSF  68

67   DYATEATLQRLLYPGFFGGSRS

 

>CYP86A24 AC146341.10  Medicago truncatula

76% to 86A8

complement(135922..137544)

METCTALLLLTAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIE

NCERMHDWICDNLRACGGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYP

KGPTWQAVFHDLLGDGIFNSDGNTWVFQRKTAALEFTTRTLRQAMARWVSRAIKDRLC

TILKKAEVQGEPVDLQDVMLRLTFDNICGLAFGRDPQTCATGLPENGFAAAFDRATEA

TLQRFILPEVFWKVKKWLGLGMEVGLSRSLAFVDQHLSSVIEKRKVELLSQQKDGSLL

HDDLLTRFMRKKESYSDKFLQHVALNFILAGRDTSSVALSWFFWLVIQNPKVEEKILR

EICTVLMETRGADMEKWTDEPLGFEEVDRLVYLKAALSETLRLYPSVPEDSKHVVKDD

VLPDGTFVPAGSSVTYSIYSAGRLKSTWGEDCMEFRPERWLSLDGTTFIMHDSFKFVA

FNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVVPGHRVEQKMSLTLFMKNGLRVNVY

NRDLKGVFATIQNEKEGEIQGKVLNDLKCNGT

 

>CYP86B6 AC146777.27 Medicago truncatula, complete sequence

join(76685..78001,78615..79010)

70% to 86B1

MHFHIPYLSNTMTKSSNINFTSSNSSSSSSSSSPLAAANFNFNM

IYSISLSLLQDIQILEILIAITLFIIIHSLRQKNHHGLPIWPFLGMLPSLINGLRTNL

YEWITDILNKQNGTFRFKGPSFSSLNCIVTSDPRNLEHLLKTKFINFPKGTYFRNMVR

DLLGDGIFSADDEIWQKQRKTASIEFHSTKFRNLTTDSLFELVHSRLLPVLDESVDKR

AVTDLQDILLRLTFDNVCMIAFGVDPGCLSQKLPEIPFAKAFEDATEATVLRFVMPTC

AWKFMRLLNLGVERKLKKSIKGVDEFAMNVIRTRKKELSLEVDEKKQRSDLLTVFMKM

KDENGSAYSDKFLRDICVNFILAGRDTSSVALSWFFWLLDQNHEVEEKILEEICKVVS

QRNDIKKEEFENSLIFRPEEIKKMDYLHACLSETLRLYPSVPVDHKEVVEDDTFPDGT

ILKKGTKVIYAIYAMGRMESIWGKDCREFKPERWLKDGRFMSESAYKFTAFNGGPRLC

LGKDFAYYQMKYVAASIIYRYHVKVVENHPVEPKIALTMYMKHGIKVNLYRRDAAEIQ

KHLI

 

>CR488956.1  CR488956 MTH2 Medicago truncatula genomic

87% to AC146777.27

77   DKEKSDLLTVFMRLKDENGKSYSDKFLRDICVNFILAGRDTSSVALSWFFWLV  235

236  DQN  244

 

>CR333119.1  CR333119 MTE1 Medicago truncatula genomic

70% to AC146777.27

207  IQITEIIIAAIVFIFIRSLRSKKHRGLPNWPIFGMLPYLIKGLKTNLYEWITDILK  374

375  HHNGTCRFRGPWFTSLNYVVTSEPQNLEHLLKTKFSNFPKGNYFRDIVSELLGDGTFAAD  554

555  NETWQKQRKIASIEFHSTNFRKLTIKSIFELVNNRLIPV  671

 

>CR495566.1  CR495566 MTH2 Medicago truncatula genomic

83% to AC146777.27

33   DKFLRDICVSFILAGRDTSSVALSWFFWLLNQNHEVEEKILEEICRVVSQREDININKEV  212

213  FNDSLRFKPEEIKKMGYLHAALSETLRLYPSVPMDHKEVIK  335

 

>CR349900.1  CR349900 MTE1 Medicago truncatula genomic

CR324391 (3 aa diffs), 85% to AC146777.27

61   EDDTFPNGIKLKKGTKVIYAIYSMGRMENIWGKDCLEFKPERWLTEDGHFMSESAYKFTA  240

241  FNGGPRLCLGKDFAYYQMKYVAANIIFRYHIKVVENHLVVPKLALTLYMKHGLKVNLHRR  420

 

>CR487784.1  CR487784 MTH2 Medicago truncatula genomic

2 aa diffs to CR481555

10   EMKMVAIAILLTYHIQVVEDHPIIPSLSVVLHMKHGLKVNVKKRS  144

 

>CR481555.1  CR481555 MTH2 Medicago truncatula genomic

2 aa diffs to CR487784, 1 aa diff to CR340188, 56% to CR349900

10   EMKMVAIAILFNYHIQVVEDHPIIPSLSVVLHMKHGLKVNVKKRS  144

 

>CR340188.1  CR340188 MTE1 Medicago truncatula genomic

1 aa diff to CR481555

194  ILLNYHIQVVEDHPIIPSLSVVLHMKHGLKVNVKKRS  84

 

>CG945631.1  MBEHF78TR mth2 Medicago truncatula genomic clone 55M12,

CG948618, 77% to CR349900

duplication

duplication

621  TKVIHAIYLMGRMESIWGK

     GWLAFQAEMGVNK  716

 

664  VYGEKDGWRFRQKWGLTKNCHFTSKSSYKFAAFNRGSRLCLAKDFAYIQMK

     YVATSIIFRYRVKIVENHPVGSKLSLTLYMKHRLK  921

 

534  EDDTFPNGIKLIKETKVIYAIFSMGRMESIRRKDCSEFKPERRLTKDIYFMSEAYYKFTI  355

354  FNGGSRLCLGKDFAYYQTKYVAASIILFCYDVKVV  250

 

>CYP94A14 DQ335797                1815 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP94A14

(CYP94A14) mRNA, complete cds.

CG951473

MELETLLSLLLFSAPLVWFLFLATKKQSKFQKTPSSTAIPKTYP

IIGSVFSIYANFHRRVHWISDILQTIPSSTFILHRSFGSRQVFTANPAVVQHILKTNF

PCYRKGLTLKRSVGDFLGDGIFSADGETWKFQRQISSHEFNTKSLRKFVETVVEVELN

DRLLPILSEASKNQTVLLDFQDILQRFTFDSICRIAFGFDPEYLHSSLPKTMFVKAFD

DSSLISSVRFNAAIPLIWKVKKILNIGIERRLKEAVAEVRGLATRIVREKKKELKEKA

TLESVDLLSRFLSSGHSDESFVVDIVISFILAGKDTTSAALTWFFWLLSKHSHVENEI

LKEITGKSEIVSYDEVKDMVYTHASLCESMRLYPPVPVDTKEAAYNDVLPDGTFVKKG

WRVAYHIYAMGRSEKIWGLDWAEFRPERWLSQDEDGKWSFIGMDPYSYAVFQAGPRVC

LGKEMAFLQMKRVVAGIMRQFRVVPAMDKGVEPEYIAHLTSLMKGGFSVRIEKRSHKDQ

 

>CG963147.1  MBEAF93TR mth2 Medicago truncatula genomic clone 12O18,

78% to 94A14 no ESTs

387  EVKNMVYTHASLCESMRMDPPVSVDAKEAAYDDVLPDGTLVKKGWIVAYHVYVMGRSEKI  208

207  WGSDWAEF*PERWLSRADDGKWSFVGMDPYTFPIFPAGPRVCLGKAVAFLEMK  49

 

>CG930785.1  MBEFA35TF mth2 Medicago truncatula genomic clone 42E21, genomic

CG957197, CR970073, CR506064

63% to 94A14 no ESTs

     LIQTEFVKAFGNSL*ISSERLNDAIPFLWKVKKILNVGSKKRLKE  196

197  AVVEVRGLATRIVREKKKEFVEKSVLESLVILPRRLSYAHSEESFAVDIVI  349

 

>CR317651.1  CR317651 MTE1 Medicago truncatula genomic

75% to 94A14 no ESTs

270  KTIPKHYPIFGSIFAFSANFHRRIQWIADILQTIPSSTFIFHRAFGSRQVFTANPAVVQHIL  85

84   KTNFPCYNKGLSRDQTLLEFLGDGIKS  4

 

>CYP94D24 AC141107.5  Medicago truncatula

59% to 94D2, 47% to 94A14

CR484885.1, CR337631 

MQLFCFSPESYLILIISFLFLYLYFHFYTTSKNHIKYGFKIYPL

LGALPEFILNRHRFLEWTTQVLRNCPTNTAVFVRPGKIHGIITANPENIQHILKTKFE

NYPKGERFINLLQDFLGRGIFNSDGDLWKLQRKTASYEFNTKSLRNFIVQNVTVETET

RLIPILSKATEKNEIIDLQDVLERFAFDNVCKLAFNVDPGCLGGNGTTGAAAFMAAFE

DAALLSSGRFMTLFPFLWKMKKIFNVGSEWRLKESITTVHEFADEIIRSRMEAKESPT

KGEDLLSRFIGTEEASPEFLRDIVISFILAGRDTTSSALSWFFWILSSRNDVKEKIIE

EIETIRLKSGCATTMFGYEELKEMHYLHAAITEAMRLYPPVPVDTKACLNDDVLPDGT

RIMKGWFISYHTYAMGRMESVWGKDCNEFKPERWLENDKDGASVCRSESPFRFPVFHA

GPRMCLGKEMAYIQMKSIAASVMERFEIVALEKDTCPEHVLSLTLRMKNGLPVNVSLR

 

>CYP94C9 DQ335798                1676 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP94C9 (CYP94C9)

mRNA, complete cds.

CYP94C9 AC127021.25  Medicago truncatula clone mth25e5, complete sequence

124715..126097 = DQ335798

MSFYFHQDSLSLQSTMSTTFTFLFFSFTLLFSFFSFLLFISRIKPWCNCNTCKTFLT

MSWSNKFVNLVDYYTHLLQESPTGTIHVHVLGNTITSNPENVEYI

LKTNFNNYPKGKQFSTILGDLLGRGIFNVDGHSWKFQRKMASLELGSVVIRSYAMELV

IEEIKTRLLPLIASVAEKKTASKADNTSEDVLLDMQDILRRFSFDNICKFSFGLDPCC

LVPSLPVSNLANAFDLSSTLSAQRALTASPLIWKMKRFFNIGSEKKLKEAIKIVNDLA

NEMIKQRREIENGVESRKDLLSRFMGALNSHDDEYLRDIVVSFLLAGRDTVASALTGF

FILLSKNPKVEEKIRVELDRVMNPNQECATFEQTREMHYLNGAIHESMRLFPPVQFDS

KFALEDDVLPDGTFIKKGSRVTYHPYAMGRMENIWGPDCLEFKPERWLKDGVFVPKCP

FKYPVFQAGSRVCLGKELAIVEMKSVVASLVKRFDVRVVGPNQEPQFAPGLTASFRGG

LPVKIYERT

 

>CYP94C10 CR498341.1  CR498341 MTH2 Medicago truncatula genomic

62% to 94C9, 65% to 94C6 

CA918199.1 BI308802 ESTs

MITLILLIFFTTIFSYLISCFHKFFSSSVFCSCEIC

QAYLSSSWSKDFNNLCDWYAHLLKKSPTKTIHIHVLRN

IITANCENVEYILKTKFENYPKGKPFSSILGDFLGRGIFNVDGDLWKFQKKMASLELNKQ

SIRSFAFEVVNNEIENRLIPLLQNQNLNQVVFDLQDVFKRFSFDSICRFSFGLDPMCLET

SLPMSDFALSFDLASKLSAERAMVVSPLIWKIKRFFNMGSEKELQKSINIINMLA

KVVINQKRKLGFSHHKDLLSRFMSTTIHDDMFLRDIVISFLLAGRDTVASSLTSFFWLLSK

 

>CR493140.1  CR493140 MTH2 Medicago truncatula genomic

49% to 94C9 no ESTs

2    ERWFEEPIEEGGNNNEGVLKYVSPYKFSVFQAGPRVCLGKDMAFIQMEYVVASILNQFEI  181

182  RPVSIDQPVFVPFLTAYMDGGFNVRVHKR  VQNGTYGRKMGA*

 

>CR347573.1  CR347573 MTE1 Medicago truncatula genomic

note two frags on opp strands

54% to 94C2, 51% to CR498341

494  TITCNPQNIEHMLKTCLDNNPKG  562

487  DLLDDGIFNVDGVSWNFQRKMASLELTSVTVRSYALEIINEEIHTRLIPFMFSFARDEKI  308

307  FDLRDIM  287

 

>CYP94C like pseudogene AC155884.2  Medicago truncatula chromosome 2

pseudogene piece like 94C9

11589  SKQMLIDMQDIFRRYSFDIICQFSFGLDPHCLLPSLPTSILPDEFDLCSKITAERAMVVS  11768

11769  PLYWKLKRFLNVGSERKLKEAISVVNSSAEAMIKERHRLRVGSLKDLLSRFMDSEDV  11939

11940  DDKYLRDIVINFLLAGRDTIASALTDFFLLLSNNPRVEEKIRVELDSIMKPTQESPTFKQ  12119

12120  TREFHYVNSAI  12152

 

>CYP94C like pseudogene AC155884.2  Medicago truncatula chromosome 2

pseudogene piece like 94C9

12586  SKQMLIDMQDICRRYSFDIICQFSFGLDPRCLLPSP

       SRKDLLSRFMD

12937  DDKYLRDIVINFLLAGRDTIASTLTDFFLLLSYNPRVEEKIRVELDSIMKPTQESPTFEQ  13116

13117  TREFHYVNSAI  13149

 

>CYP94C like pseudogene AC155884.2  Medicago truncatula chromosome 2

pseudogene piece like 94C9

13176  VKRYFNIMLEKKLKEAIKV

13703  DLLSHLIVRDDVRGKDYLRDIVLSLLVVGRDTVVAGLTELFWLLSRNLQVQERIMKEIDR  13882

13883  ILGPSLELQFNSKYAKKDGILPDGYPVTKGCRVT  13984

13985  YHPYAMAREERIWGADCKVFNPEWWLNQDISRKRSYFKYPVF

 

>CG945401.1  MBEAA08TR mth2 Medicago truncatula genomic clone 11A15,

86% to CG968039

7    KIFDFFGDGILNSSSHIWKQQRTMFHSFLKRKTFKNFFQQTMKKKVENCLLPFLNDVSEI  186

187  GAQVDLEDALSRFTFDSICTIAFGFDPNCLPNKFNELI*IAYQKSLPVIDEVIIYRHFKP  366

367  RCLWKLQKWLDVGQERKLKEA  429

 

>CYP96J1 CG920236.1 Medicago truncatula genomic clone

CG928867, CG964753, 92% to CG921937, 36% to 96A1, 47% to 96F4 Populus

AW693084.2 EST, missing heme to end

     MQFANIHFSKTTMSIIQCIGGFVTILIFLYIYYSRRNRDELLLINWPIIGILPSFLCHL

     SDYHDYSTIVLKRYGGTCRFQGPWFTNTSF

  2  IALADQMNVNYITKKNCGNYRKGSKYHDIFEVLGGSIFNSDSDDVWKQEKTMFHLVLGRKSFKN  193

194  MFEQSIQKKVENYLIPFLNDVSEAGAHVDLQDAFNRFTFDSSCMILFGFDPNCLPNKFNQ  373

374  LRKIPYKESLPVMEEVILYRHFIPSSLWKLQKWLNVGQEKKFKVAQEYLDRFLYESIT  547

548  FSHGEEQSKCSDEEMDQCFLGMVKALKKEGHGKGEISEKYLRDTAFTMIFAGNGTI  715

716  SSALSWFFWLLSTYPIVEEKIIQEIKDNWLTQEGNRITLRHVDLDKLVYLHGAICETLRL  895

896  YPPIPFEHICSIKSDILPSGYHVSPNTTLIYSLYS MGRMEQIWGEDCMEFKPERWIS  885

886  ERGDII  903

 

>CYP96J2 CG921937.1  MBEDG89TRC mth2 Medicago truncatula genomic clone 31P9,

CR486265, CR490379, CR498121,

91% to 96J1 93% to CG928867, 36% to 96A12 no ESTs

2    DPMNVTYITKKNFGNYAKGSKFHDIFEVLGGSIFNSDSNDVWKQEKTMFHLVLGRKSFKNMFQH  181

182  SIQKKVDDYLIPFLNDVSEAGAQVDLQDAFNRFTFDSSCLILFGFDPNCLPNKFNQLREI  361

362  PYKKSLPVMEEVIFYRHFIPSSLWKLQKWLNVGQEKKFKVAQEYLDRFLYESITF  526

527  SLGEEQSKCSNEEMDQCFLGMVKALKKEGYGKGEISEKYLRDTALTMVFAGNGSISSAL  703

704  SWFFWLLSTYPIVEEKIIQEI  766

 

>CYP96J3P CG927167.1 Medicago truncatula genomic clone

65% to CYP96J1 41% to 96A2

CG932401, CR486627, CR486643

All four have stop codon, possible pseudogene

8    TSDPMNVEHIASKNFGNYGRGSNFKEIFDFFGDGILNSNSHVWKQQRTMFHSFLKRKTFK  187

188  NFFQQTMKKKLENYLLPFLNDVSEIGAQVDLEDALSRFTFDSICTIAFGFDPNCLLNKFN  367

368  ELTEIDYQKSLAVIDEVILYRHFIPSYLWKLQKWLHVRQEKKLREAEENLDRFLYEGITF  547

548  SKQEQSKCSSSE*IDDFVKALMKEEYGTRGMDEKYLRDNALSLFLAG  688

689  NGTVTSGLSWFFWLVSTHPIVEAKIIQEIKDNWPTQEENQTPWRDVDLDNLVYLHGAICE  868

869  TLRLYPPVPF  898

 

>CYP96J4 CG968039.1  MBENK40TR mth2 Medicago truncatula genomic clone 8H7, genomic

CG938882, CG941434, 84% to CG927167, 39% to 96A2

2    IVTSDPLNVDHIAGKNFGNYGRGSNFKEIFDFFGDGILNSNSNVWKQQRTMFHSFLKRKT  181

182  FKNFFQQTMKKKLENYLLPFLDDVSEIGAQLDLEDALSRFTFDSICTIAFGFDPNCLPNK  361

362  FNELTEIAYQKALTVIDEVIMYRHFIPSFLWKLQKWLHVGQEKKLREAEENLDRFLYESI  541

542  TFSKQEQRKYNGSEEMDECYFVREKARTKEGYGKEEMSGKFLRDDTLSLFLAGS  703

704  GPASSGLSWFFWLVSTHPIVEAKIIQEIKDNCPTQEENQIPSRDEYLDKLVYLHGAICEA  883

884  LRLY  895

 

>CYP96J5 CG951353.1 Medicago truncatula genomic clone

= CR486377, CG926555.1, CR505485

58% to 96J4, 36% to 96A11 86 clan, no ESTs

900  TFHFKGPWFTNMPNFTLTSDPMNVHHITSKNFSNYGRGSDFPEIFEVLGISLINLDSNDW  721

720  KQERTILHSLLKRKSFKTSLQQIIQKKLESCLLPFLDHATKGLQVLDLQDILERFTFDII  541

540  GTSLFEFDPNCLPYKFNEFSDIAYVKAISVIEDTILFRHYIPKCFWKLQKWLQIGQEKKN  361

360  NIAQENIHKFLYNCISYYKDGEEKRTFKSNEDVDESHSCLLKDLMKEGLGKGEMAE  193

192  KYIINTTLNLLAAGSGTVSSGLSWFFWLVSTHPIVETKIIQEIKDNFLK  46

45   GLDKLVYLHGAICEA  1

 

>CYP96J6 CG949304.1 Medicago truncatula genomic clone

CR490357.1

70% to 96J5 42% to 96A10

4    FEILLHQCIRNKLEIFLLPFLDHASKGVQILDLQDILERFTFDIICTSVFGFDPNCLPNN  183

184  FSEISDISYVKAISVTEDVILSRHYIPKCIWKLQKWLQIGQEKKYKVAKENLHQFIYKCL  363

364  NYYRSGEEKRSDDSHLCLLKDLMEEGLEKGEMVERYIRDTTINLLVAGN  510

511  GTISTGLTWFFWLVSTHPRVDGKIIQEIKDNCLKHDENFIANLGVEELDKLVYLHGAICE  690

691  ALRLYPSVAFQHKCAIKSDKLPSGDHVSPNTKLIYSLYAMGRMEQIWGEDCLEFKPERWI  870

871  SDRGQIIQVPSYKFI  915

 

>CR485438.1  Medicago truncatula genomic,

65% to CR508430, 57% to 96A15

     LYPPLAFQHKCAILSDILPSGEHVGPNTKLIYSLYAMGRMQQIWGD

181  DCLEFKPERWISARGGIINVPSYKFIAFNAGPRSCIGKDLSFVQMKMVAASLLWKFRIQV  360

361  VEGHPVTLRTSIVVRMKHGLKVEVS KRCI*

 

>CR508430.1  CR508430 MTH4 Medicago truncatula genomic

CR508998 (2 aa diffs), 60% to CYP96J6 CG949304

511  NLIDDKFLRDTAINLLAAGRDTISSALTWFFWLVATHPFVEAKILEEVRENLSSREDNNW  332

331  KDLGMEGLSKLIYLHGALCEALRLYPPIPFEHKSNLKSDVLPSGHVIKSNTMILYSLYSI  152

151  GRVEEIWGEDCLEFKPERWVSKKGGTIHVPSYKFIAFNAGPRSRLGKDIS  2

 

>CG962886.1  MBEHQ92TR mth2 Medicago truncatula genomic clone 58O15,

71% to CG927167

15   DPINVNHIASKNFGNYGRGSINFQEIFEFFGGGIVNSDSHVWKEKRTMFHSILKRKSFKN  194

195  LFQQTSQKKLEKFLLPFIQF  254

253  SEAGSEVDLQDILNRFTFDSICIIVFGFDPNWLPNKISDLREISYQKSLIVIEEVLFYIN  432

433  FIPSFL  450

 

>CG973769.1  MBEJI58TF mth2 Medicago truncatula genomic clone 68I19,

93% to CG921937 no ESTs

415  MSIIQCIGGFLTILIFLYIYYWRRNRDEFVPINWPIIGMLPAFLHHLSDFHDYATI  248

247  VLKRHGGTFLIKGPWFTDISFIGLADPMNVDYITKKNVGNYAKGSKFHDIFEVLGGSIFN  68

67   SDSDDVWK  44

 

>CR964383.1rev  CR964383 MTH4 Medicago truncatula genomic

CR510125, CX541751.1 EST

73% to CG964459.1, 46% to 96J5, 45% to 96A10, 46% to 96F2

MTMFVYTTIACAIFSFLCIIFQIHRRRCCKYPILIDYTFLGMLPSLLWNLWNIHDFLA

ALLKQHRGSGEFMGPWFTKMNYFITSDPMNVHHIMSKRFDNYVKGHEFHEIFEAFGDGIF

NADSKTWKYNRSLLHSIFKQTSFELFQEKIIQNKLERSLIPLLDHVQQ

QGSVVDLQDVFNRFTFDNICSVVLGCDPNCLSID  183

184  FPDVACEKAFDQIEECIFYRHVVPRSVWRLQQLLQVGQEKKMTKACKEFDQFIYSNIESK  363

364  RVELRKGTKNIDEMGDLLTTLMNEEKGSQVVQHDDKFLRDAAFNLFVAGRDTI  522

523  TSALTWLFYLVATHPLVETKILEEI  597

 

>CG964459.1

72% to CR964383

350 SFEAFQEKIIHNKVEKSLIPILNHVLQQKGSVVDLQDVFNRFTFDNICLIILGHDPNCLS 171

170 TDFPEVPSEKAFNQAEESIFYRHTVPICVWKLQSWLQIGEEKKMTEACKVFDQFL 6

 

>CYP704B11 CR931811.1a  Medicago truncatula chromosome 5

CG937505

CR299270 2 aa diffs to CR931811.1a

75% to 704B1

49973  MGGLVILICMIFSWIFLHRWSQRNKKGPKTW

50066  PFLGAAIEQLMNYDRMHDWLVQYFSMSKTVVVPMPFTTYTYIADPVNVEHVLKTNFSNYP  50245

50246  K

       GEVFHSYMEVL  50425

50426  LGHGIFNVDGELWKRQRKTASLEFASRNLRDFSTKVFKEYALKLSTILSQSSFLNQQIDM  50605

50606  Q  50608

50691  ELLMRMTLDSICKVGFGVEIGTLNPNSPNNSFAQAFDTANIIVTLRFIDPLWKIKKILN  50867

50868  LGSEAQLGKSIKIIDDFTYSVIRRRKAEIEDAKKNGQQ  50981

51396  MKNDILSRFIELGENHATDKSLRDVVLNFVVAGRDTTATTLSWAIYMVMTHSHVAQKLY  51572

51573  LELKTFEENQAKEENVTLPQYDDKDDPKLFNQRVVQFSKLLNKDSLEKLHYLHAVITETL  51752

51753  RLYPAVPQ  51776

52134  DPKGVIEDDVLPDGTKIKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWFKDGVLKNES  52310

52311  PFKFTAFQ  52334

52561  AGPRICLGKDSAYLQMRMVLAILCRFYKFNLVPDHQVKYRMMTILSMAHGLRVTVEKRS*  52740

 

>CYP704B11-de6b  CR931811.1b  Medicago truncatula chromosome 5

pseudogene 83% to 704B1 

57013  AGPRICLGKDSAYHQMRMVLAILCRFYKFNLVPDHQVKYRMMTILSMAHGLRVTVEKRS  57189

 

>CYP704G1 AC146342.5g  Medicago truncatula

58% to 704G2

runs off the end

112154 KHNVKLIDDFVNGVINTKKSQLELQQDS   (0) 112071

111878 NVKEDILSRFLMESKNGQTTITDKYLRDIILNFMIAGKDTTANTLSWFFYMLCKNPLVEDK  111696

111695 IVQEIRDVTCSHESELNSIDEFVANLTDLILDKMHYLHATLTETLRLYPVLPV   (0) 111537

111238 DGRTADAPDVLPDGHKLEKGDGVYYLAYAMGRMSSIWGEDADEFRPERWITDGIFQPESPFKF VAFH (0) 111038

110942 AGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLTAIPRS*  110760

 

>CYP704G1 AC174350.4a  Medicago truncatula

This clone overlaps the AC146342.5e, f and g sequences and continues the g seq.

= AC146342.5e

10349  MDVLYTILTLIAFSLLAIFLAICFILMTIFKGKSIGDPKYAPVKGTVFNHLFYFNKLYDY  10170

10169  QAQMAKIHPTYRLLAPNQSDQLYTIDVRNIEHVLKTNFDKYSRGKYSQDVMTDLFGEGIF  9990

9989   AVDGDKWRQQRKVASYEFSTRVLRDFSCSVFRKNAAKLVRVISVFYHEGLVFDMQ  (0) 9825

8611   DLQMRCALDSIFKVGFGTELNCLEGSSKEGTEFMKAFDESNALIYWRYVDPIWNLKRFLN  8432

8431   IGGEAKLKHNVKLIDDFVNGVINTKKEQLALQQDS  (0) 8327

8211   NVKEDILSRFLMESKKGQTTITDKYLRDIILNFMIAGKDTTA  8086

8085   NTLSWFFYMLCKNPIVEDKIVQEIRDVTCFHESELSNIDEFATNLTDSILDKMHYLHAAL  7906

7905   TETLRLYPVVPV  (0) 7870

5527   DGRTADAPDILPDGHKLQKGDAVNYMAYAMGRMSSIWGEDAEEFRPERWITDGIFQPESP  5348

5347   FKFVAFH (0) 5327

5220   AGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLHAIPRS * 5038

 

>CYP704G2 AC174350.4b  Medicago truncatula

This clone overlaps the AC146342.5e, f and g sequences and continues the g seq.

= AC146342.5f, CR326348, CG933983

16141  MDVLYTMLTLIAFSSLAIFLAICFIMMTIFKGKSIGDSKYTPVKGTVFNQLFYFKKLYDY  15962

15961  HAQLAKIHPTYRLLAPNHSELYTIDVRNIEHVLKTNFDKYSRGKYSQDIMTDLFGEGIFV  15782

15781  VDGNKWKQQRKVASYEFSTRVLRDFSCSVFRKNAAKLVRVISEFYHEGLVFDMQ  15620

14783  DLQMRCALDSIFKVGFGTELNCLEGSSKEGTEFMKAFDESNALIYLRYVDPIWSL  14619

14618  KRFLNIGGEAKLKHNVKLIDDFVNGVINTKKSQLELQQDS   (0) 14499

13365  NVKEDILSRFLMESKNGQTTITDKYLRDIILNFMIAGKDTTANTLSWFFYMLCKNPLVED  13186

13185  KIVQEIKDVTCSHESELNNIDEFAGNLTDVILDKMHYLHAALTETLRLYPVVPI  (0) 13024

12857  DGRTADAPDILPDGHKLEKGDGVNYLAYAMGRMSSIWGEDANEFRPERWINNGIFQPESP  12678

12677  FKFVAFH (0) 12657

12574  VSMQAGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLHAIPRS*  12380

 

>CYP704G2 AC146342.5f  Medicago truncatula

50% to 704G2

103680 MDVLYTMLTLIAFSSLAIFLAICFIMMTIFKGKSIGDSKYTPVKGTVFNQLFYFKK  103513

103512 LYDYHAQLAKIHPTYRLLAPNHSELYTIDVRNIEHVLKTNFDKYSRGKYSQDIMTDLFGE  103333

103332 GIFVVDGNKWKQQRKVASYEFSTRVLRDFSCSVFRKNAAKLVRVISEFYHEGLVFDMQ   (0) 103159

102322 DLQMRCALDSIFKVGFGTELNCLEGSSKEGTEFMKAFDESNALIYLRYVDPIWSLKRFLN  102143

102142 IGGEAKL KHNVKLIDDFVNGVINTKKSQLELQQDS   (0) 102038

100904 NVKEDILSRFLMESKNGQTTITDKYLRDIILNFMIAGKDTTANTLSWFFYMLCKNPLVEDK  100722

100721 IVQEIKDVTCSHESELNNIDEFAGNLTDVILDKMHYLHAALTETLRLYPVVPI  100563

100396 DGRTADAPDILPDGHKLEKGDGVNYLAYAMGRMSSIWGEDANEFRPERWINNGIFQPESPFKFVAFH  (0) 100196

100101 AGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLHAIPRS*  99919

 

 >CR326348.1  CR326348 MTE1 Medicago truncatula genomic

54% to 704A5, 96% to AC146342.5f

153  TIDVRNIEHVLKTNFDKYSRGKYSQDIMTDLFGEGI*GVDGNKWKQQRKVA  1

 

>CYP704G3 AC146342.5e  Medicago truncatula

49% to 704G2

97888  MDVLYTILTLIAFSLLAIFLAICFILMTIFKGKSIGDPKYAPVKGTVFNHLFYFNK  97721

97720  LYDYQAQMAKIHPTYRLLAPNQSDQLYTIDVRNIEHVLKTNFDKYSRGKYSQDVMTDLFG  97541

97540  EGIFAVDGDKWRQQRKVASYEFSTRVLRDFSCSVFRKNAAKLVRVISVFYHEGLVFDMQ  (0) 97364

96150  DLQMRCALDSIFKVGFGTELNCLEGSSKEGTEFMKAFDESNALIYWRYVDPIWNLKRFLN  95971

95970  IGGEAKLKHNVKLIDDFVNGVINTKKEQLALQQDS  (0) 95866

95750  NVKEDILSRFLMESKKGQTTITDKYLRDIILNFMIAGKDTTANTLSWFFYMLCKNPIVED  95571

95570  KIVQEIRDVTCFHESELSNIDEFATNLTDSILDKMHYLHAALTETLRLYPVVPV  (0) 95409

93066  DGRTADAPDILPDGHKLQKGDAVNYMAYAMGRMSSIWGEDAEEFRPERWITDGIFQPESPFKFVAFH  (0) 92866

92759  AGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLHAIPRS*  92577

 

>CYP704G3 AC174350.4c  Medicago truncatula

This clone overlaps the AC146342.5e, f and g sequences and continues the g seq.

= AC146342.5g, CG940828

25615  MDILYTLLTSIAFFFLAIFLAICFIMMTIFKGKSIGDPKYAPVKGTVFNQLFNFKKLHDY  25436

25435  HAQLAKTHPTMRLLAPNQSELYTIDVRNIEHILKTNFDKYSKGKYNKDIITDLLGEGIFA  25256

25255  VDGDKWKQQRKIASYEFSTRVLRDFSCSVFRKNASKLVRVISEFSHEGLVFDMQ  (0)  25094

24816  DLQMRCALDSIFKVGFGTELNCLEGSSKEGTEFMKAFDESNALIYWRYVDPIWSLKRFLN  24637

24636  IGGEAKLKHNVKLIDDFVNGVINTKKSQLELQQDS  (0) 24532

24339  NVKEDILSRFLMESKNGQTTITDKYLRDIILNFMIAGKDTTANTLSWFFYMLCKNPLVED  24160

24159  KIVQEIRDVTCSHESELNSIDEFVANLTDLILDKMHYLHATLTETLRLYPVLPV  (0) 23998

23699  DGRTADAPDVLPDGHKLEKGDGVYYLAYAMGRMSSIWGEDADEFRPERWITDGIFQPESP  23520

23519  FKFVAFH (0) 23499

23415  VSMQAGPRMCLGKDFAYRQMKIVAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLTAIPRS*  23221

 

>CR309988.1  CR309988 MTE1 Medicago truncatula genomic

97% to AC174350.4c

658  DVRNIEHILKTNFDKYSKGKYNQDIITDLFGEGIFAVDGDKWKQQRKIASYEFSTRVLRD  479

478  FSCSVFRKNASKLVRVISEFSHEGLVFDMQ  389

 

>CR296675.1  CR296675 MTE1 Medicago truncatula genomic

93% to AC174350.4c

221  DVLPDGHKVEKGDGVYYLAYAMGRMSSIWGEDVDEFCPERWINNGIFQPESPFKFVAFH  397

483  VSMQAGPRMCLGKDFAYRQMKIVAMCVLNFYNQEMIE  593

 

>CYP704G4P AC146342.5d  Medicago truncatula

pseudogene 65% to 704G2

82240  SGRTAEEHDILPDGYKVNKGETVYYLSYAMGRMPYIWGDDAQEFLPERWLKDGIFQPESSFKFTAFH  (0) 82040

81648  AGPRICLGKDFAYRQMKIVSMALVRFFRFKLENETNDVTYRTMFTLHIDHGLPLYATPRCDVVE*  81454

 

>CYP704G5 AC146342.5c  Medicago truncatula

54% to 704G2

 

78358  MNMLFLIMFYFILILFLCLFLLISIITLSTFIGQSIGNPKYPPVKGTVFHQLINFKTLFHYF  78173

78172  TKIAQTSPTFRLLAPKKSKIYTCDTKNVEHILKTQFHKYSKGKFNHDTIFDLLGDGIFAV  77993

77992  DGAKWRHQRKLSSLEFSTRVLRDFSCNVFRRNAVKLVRVVLGFSNAGLAFDIQ  (0) 77834

76473  DIVMKCTLDSIFKVGFGVELNCLEKSSKEANIFMKAFNDSNAFVFKRYLDPLWKLKRVLN  76294

76293  FGSEAALKKNIKIIDDFVHSLIKTRRELLSMQKDF (0)  76189

75779  SDKEDILSRFLLESKKDSSNMTDKYLRDIILNFMIAGKDTSANTLSWFFYMLCKNPLIQEKV  75594

75593  AQEVINVTSTSQESNLNLDEFVSNISDATLDKMHYLHAALTETLRLYPAVPM   (0) 75438

75318  SGRTAEEHDILPDGYIVNKGETVYYLSYAMGRMPYIWGDDAQEFLPERWLKDGIFQPESSFKFISFH  (0) 75118

74644  AGPRICLGKDFAYRQMKIVSMALVRFFRFKLENETNDVTYRTMFTLHIDHGLPLY  74480

74479  ATPRCDVAE*  74450

 

>CYP704G6 AC146342.5b  Medicago truncatula

91% to 704G2

CR300229, CR300093, CR299504

70560  MLFQSIMDFLSNP

70521  FLFAALSASLTLLLVQLLLRKLNNKSNNMKKKKYHPVAGTVFNQMMNFNRLHHYMTDL  70348

70347  ARKYRTYRLLNPFRSEVYTSEPSNVEYILKTNFENYGK  70234

69311  GLYNYQNLKDLLGDGIFAVDGEKWREQRKISSHEFSTKMLRDFSTSIFRKNAAKVANIV  69135

69134  SEAATSNFKLEIQ  (0) 69096

68760  DLLMKSTLDSIFQVAFGTELNSMCGSSEEGKNFANAFDTASALTLYRYVD  68611

68610  VFWKIKKFLNIGSEAALRKNTEVLNEFVIKLINTRIQQMNSKGDSI (0) 

68367  RKSGGDILSRFLQVKEYDTTYLRDIILNFVIAGKDTTAAT  68251

68250  LSWFMYMLCKYPAVQEKAAEEVREATNTKTVSSCTEFVSCVTDEALEKMNYLHATLTETL  68071

68070  RLYPAVPV  (0) 68047

67943  DAKICFADDTLPDGYSVKKGDMVSYQPYAMGRMKFIWGDDAEEFRPARWLDENGNFQAEN  67764

67763  PFKFTAFQ (0) 67740

66259  AGPRICLGKEFAYRQMKIFSAVLLGCFRFKLNDEKRNVTYKTMINLHIDGGLEIKALHRD*  66077

 

>CYP704G7 DQ335800                1719 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP704G2

(CYP704G2) mRNA, complete cds.

MLFQSIMDFLSNPLLFAALSASLTLLLVQLLLRKLNNKSNSMKK

KKYHPVAGTVFNQMMNFNRLHHYMTDLARKYKTYRLLNPFRSEVYTSEPSNVEYILKT

NFENYGKGLYNYQNLKDLLGDGIFTVDGEKWREQRKISSHEFSTRMLKDFSTSIFRKN

AAKVANIVSEAANSNTKLEIQDIFMKSTLDSIFNVVFGTEIDSMCGTSEEGKNFANSF

DNASALTLYRYVDVFWKIKKFLNIGSEAALRNNTEILNEFVIKLINTRIQQMKNSKGD

SVRKGGDILSRFLQVKEYDTKYLRDIILNFVIAGKDTTGGTLSWFMYMLCKYPAVQEK

AAQEVREATNTKTVSSCTEFVSSVTDEAIEKMNYVHAVLTETLRLYPALPFDAKICFA

DDTLPDGYSVKKRDMVSYQPYAMGRMKFIWGDDAEEFRPERWLDENGIFQPECPFKFT

AFQAGPRICLGKEFAYRQMKIFSAVLLGCFRFKLNDEKKNVTYKTMITLHIDGGLEIK

ALYRN

 

>CYP704G7v1 AC174347.10  Medicago truncatula

704G7 (2 aa diffs)

CG959668

98386   KKKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYKTYRLLNPFRSEVYTSEPSNVEYILKT  98565

98566   NFENYGK  98586

99666   GLYNYQNLKDLLGDGIFTVDGEKWREQRKISSHEFSTRMLRDFSTSIFRKNAAKVANIV  99842

99843   SEAANSNTKLEIQ

        DIFMKSTLDSIFNVVFGTEIDSMCGTSEEGKNFANSFDNASALT  100202

100203  LYRYVDVFWKIKKFLNIGSEAALRNNTEILNEFVIKLINTRIQQMKNSKGDS  100358

        VRKG

100540  GDILSRFLQVKEYDTKYLRDIILNFVIAGKDTTGGTLSWFMYMLCKYPAVQEKAAQEVRE  100719

100720  ATNTKTVSSCTEFVSSVTDEAIEKMNYVHAVLTETLRLYPALPX  100848

100956  DAKICFADDTLPDGYSVKKGDMVSYQPYAMGRMKFIWGDDAEEFRPERWLDENGIFQPEC  101135

101136  PFKFTAFQ

101616  AGPRICLGKEFAYRQMKIFSAVLLGCFRFKLNDEKKNVTYKTMITLHIDGGLEIKALYRN  101795

 

>CYP704G7v2 AC146342.5a  Medicago truncatula

2aa diffs to 704G7

CG959668, DQ335800, AC174347.10

18317  MLFQSIMDFLSNPLLFAALSASLTLLLVQLLLRKLNNKSNSM

18443  KKKKYHPVAGTVFNQMMNFNRLHHYMTDLARKYKTYRLLNPFRSEVYTSEPSNVEYILKT  18622

18623  NFENYGK (0) 18643

19723  GLYNYQNLKDLLGDGIFTVDGEKWREQRKISSHEFSTRMLRDFSTSIFRKNAAKVANIV  19899

19900  SEAANSNTKLEIQ DIFMKSTLDSIFNVVFGTEIDSMCGTSEEGKNFANSFDNASALT  20259

20260  LYRYVDVFWKIKKFLNIGSEAALRNNTEILNEFVIKLINTRIQQMKNSKGDSV  (0) 20418

20588  RKGGDILSRFLQVKEYDTKYLRDIILNFVIAGKDTTGGTLSWFMYMLCKYPAVQEKAAQEVRE  20776

20777  ATNTKTVSSCTEFVSSVTDEAIEKMNYVHAVLTETLRLYPALPF (0) 20908

21013  DAKICFADDTLPDGYSVKKGDMVSYQPYAMGRMKFIWGDDAEEFRPERWLDENGIFQPEC  21192

21193  PFKFTAFQ (0) 21216

21673  AGPRICLGKEFAYRQMKIFSAVLLGCFRFKLNDEKKNVTYKTMITLHIDGGLEIKALYR  21849

21850  N*  21853

 

>CYP704G8P AC149581.27a  Medicago truncatula

pseudogene 90% to 704G1 

56146  LARIVFEAATSNNIIELQ

56326  DLFMKSTLDSVFKVILGVELDTMCGTSKEGTQFSNAFNEASATIMFWYVNFLWKVQRFLN  56505

56506  IGSEAVLKKNLRVINEYVYTIIKSKIEQSQKPQKNSPELKGDILSRFLELNETDSKYLKD  56685

56686  VILSFIIAGKDTTSITLS*FIYQLCKHPHVQEKIAQEIREATKVEDGSTTDELATRITEE  56865

56866  SMKKMQYLDAALTETLRLHPPIPM  56937

57734  ESKYCFSDDTLPDGYSVRKGDYISFHPYVMGRMEFLWGEDAEQFRPERWLDENGNFQRES  57913

57914  PFKFTAFQ  57937

58479  AGPRICLGKEFVYRQMKIFSAVLLGSHNFKLADQNRLVKYRTTLTLQIDGGLHVNAFHRNK  58661

 

>CYP704G9 DQ335799                1610 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP704G1

(CYP704G1) mRNA, complete cds.

MKFIDFLFALKPLFPILIAIALAGFIIKIHGSRFFDKKRRYHPV

AGTVLHQLFNFHRLLEYMTDLTSKRKTYRLLSFNRSEVYTSDPANIEHMMATNFSNYG

KGWYHHSVLEDLLGDGIFTVDGEKWRHQRKSASYQFSTKLLRDFSSSVFKSNAVKLAG

IVSEAATSNNIIELQDLFMKSTLDSVFKGILGVELDTMCGTYREGTQFSNAFDEASAA

IMFRYVNFLWKVQRFLNMGSEAVLKKNLRVIDEYVYTVIRSKIEQSQKPQNNSSELKG

DILSRFLELNETDSKYLKDVILSFIIAGKDTTAITLSWFLYQLCKHPHVQEKIAQEIM

EATKVEDGSTIDELAARLTEESMEKMQYLHAALTETLRLHPPVPVESKYCFSDDTLPD

GYSVTKGDLVSFQPYVMGRMKFLWGEDAEQFRPERWLDENGNFQRESPFKFTAFQAGP

RICLGKEFAYRQMKIFSAVLLGSHSFKLADQNKLVKYRTSLTLQIDDGLHVNAFHRNK

 

>CYP704G9 AC149581.27b  Medicago truncatula

62266  MKFIDFLFALKPLFPILIAIALAGFIIKIHGSRFFDKKRRYHPVAGTVLHQLFNFHRLLE  62445

62446  YMTDLTSKRKTYRLLSFNRSEVYTSDPANIEHMMATNFSNYGK  62574

62996  GWYHHSVLEDLLGDGIFTVDGEKWRHQRKSASYQFSTKLLRDFSSSVFKS  63145

63146  NAVKLAGIVSEAATSNNIIELQ  63211

63403  DLFMKSTLDSVFKVILGVELDTMCGTYREGTQFSNAFDEASAAIMFRYVNFLWKVQRFL  63579

63580  NMGSEAVLKKNLRVIDEYVYTVIRSKIEQSQKPQNNSSELKGDILSRFLELNETDSKYLK  63759

63760  DVILSFIIAGKDTTAITLSWFLYQLCKHPHVQEKIAQEIMEATKVEDGSTIDELAARLTE  63939

63940  ESMEKMQYLHAALTETLRLHPPVPV  64014

64596  ESKYCFSDDTLPDGYSVTKGDLVSFQPYVMGRMKFLWGEDAEQFRPERWLDENGNFQRES  64775

64776  PFKFTAFQ  64799

64995  AGPRICLGKEFAYRQMKIFSAVLLGSHSFKLADQNKLVKYRTSLTLQIDDGLHVNAFHR  65171

65172  NK  65177

 

>CYP704G9-de5b  AC149581.27c  Medicago truncatula

pseudogene like 704G1

80246  GPRVCLGKKFAYRHIKIFSAVLLGSHNYKLADQNKLVKYRTMLTLQIDDGLHVNTFHRNK  80425

 

>ABE79358

89% to 704G9 [Medicago truncatula] MEFIDFLFAMKPLFPILIAIGLAGFIIKIHGIRNFDKKRKYHPVAGTVLHELFNFHRLLEYSTDITSKRK IYRLLSFNRSEVYTSDPANIEHILATNFSNYGKGWYHHSVLEDLLGDGIFTIDGEKWRHQQAINSQLSY

 

 

CYP97 clan

 

>CYP97A10 DQ335815                1599 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP97C9 (CYP97C9)

mRNA, partial cds.

82% to 97A3

AC148994.3 genomic

MGKGLIPADGEIWRVRRRTIVPALHLKFVAAMIGLFGQATDRLC

QKLDTAASDGEDVEMESLFSRLTLDVIGKAVFNYDFDSLSNDTGIIEAVYTVLREAED

RSISPIPVWDLPIWKDISPRQRKVTAALKLVNDTLNNLIAICKRMVDEEELQFHEEYM

NEQDPSISSLSCWRQEMMTSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVMSK

LQEEVDSVLGDRFPTIEDMKKLKYTTRVINESLRLYPQPPVLIRRSIEDDVLGEYPIK

RGEDIFISVWNLHRSPTLWNDADKFEPERWPLDGPNPNETNQGFKYLPFGGGPRKCIG

DMFASYEVVVALAMLVRRFNFQMAVGAPPVVMTTGATIHTTQGLNMTVTRRIKPPIVP

SLQMSTLEVDPSVSISDKTEEIGQKDQVYQAQKS

 

>CYP97A10 AC148994.3 genomic complete gene

join(22663..22991,23160..23358,24127..24198,24296..24406,

24802..24993,25433..25594,26226..26321,26406..26507,

26770..26802,26895..26975,27067..27149,27521..27652,

27728..27788,27973..28038,28804..28995)

79% to 97A3

EST BF635777.1 AW691435.2

MASHLTLLHAPPPLSLQTKTFHSKYITIKPLKPTTTFSSSCSLF

PCSLKTSHRGSCSSFIACSSSNGRSPNDSVDDGVVKSADQLLEEKRRAELSAKIASGE

FTVKQESGLPSILKKSLSNLGVSNEILEFLFGLYPKIPEAKGSISAIRSEAFFIPLYE

LYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNSKAYSKGILAEILDFV MGKGLIPA

DGEIWRVRRRTIVPALHLKFVAAMIGLFGQATDRLCQKLDTAASDGEDVEMESLFSRL

TLDVIGKAVFNYDFDSLSNDTGIIEAVYTVLREAEDRSISPIPVWDLPIWKDISPRQR

KVTAALKLVNDTLNNLIAICKRMVDEEELQFHEEYMNEQDPSILHFLLASGDDVTSKQ

LRDDLMTMLIAGHETSAAVLTWTFYLLSKEPSVMSKLQEEVDSVLGDRFPTIEDMKKL

KYTTRVINESLRLYPQPPVLIRRSIEDDVLGEYPIKRGEDIFISVWNLHRSPTLWNDA

DKFEPERWPLDGPNPNETNQGFKYLPFGGGPRKCIGDMFASYEVVVALAMLVRRFNFQ

MAVGAPPVVMTTGATIHTTQGLNMTVTRRIKPPIVPSLQMSTLEVDPSVSISDKTEEI

GQKDQVYQAQKS

 

>CYP97A10 AC124218.18  Medicago truncatula clone mth230b20, complete sequence

2962  MASHLTLLHAPPPLSLQTKTFHSKYITIKPLKPTTTFSSSCSLFPCSLKTSHRGSCSSFI  2783

2782  ACSSSNGRSPNDSVDDGVVKSADQLLEEKRRAELSAKIASGEFTVKQESG  2633

2464  LPSILKKSLSNLGVSNEILEFLFGLYPKIPEAKGSISAIRSEAFFIPLYELYITYGGIFR  2285

2284  LNFGPK  2267

1498  SFLIVSDPAIAKHILKDNSKAYSK  1427

1329  GILAEILDFVMGKGLIPADGEIWRVRRRTIVPALHLK  1219

 823  FVAAMIGLFGQATDRLCQKLDTAASDGEDVEMESLFSRLTLDVIGKAVFNYDFDSLSNDTGIIE  632

 192  AVYTVLREAEDRSISPIPVWDLPIWKDISPRQRKVTAALKLVNDTLNNLIAICK  31

 

>CYP97B13 AC142526.5  Medicago truncatula

77% to 97B3

complement(join(4001..4225,4510..4659,5086..5147,

6443..6534,7072..7160,7292..7378,7545..7604,7727..7774,

7897..8070,8614..8852,10036..10120,10980..11087,

11694..11889,12031..12140))

CR955008.2, CG947069.1 CR309774 CR340372

MVAVAISTVTLTGVNLHTRFHSSRFSSHSKRSSSTIRCQAVNGD

KKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFSLYDWFLE

HGSVYKLAFGPKAFVVVSDPIVARHILRENAFSYDKGVLADILEPIMGKGLIPADLET

WKQRRRVIAPGFHTSYLEAMVKLFTSCSERTVLKIDKLLEGEGYSGQKSIELDLEAEF

SNLALDIIGLGVFNYDFGSVTNESPVIKAVYGTLFEAEHRSTFYIPYWKFPLARWIVP

RQRKFQDDLKVINTCLDGLIRNAKESREETDVEKLQQRDYSNLKDASLLRFLVDMRGV

DVDDRQLRDDLMTMLIAGHETTAAVLTWAVFLLAQNPDKMKKAQAEVDSVLGTGKPTF

ELLKKLQYIRLIVVEALRLYPQPPLLIRRSLKSDVLPGGHKGDKDGYTIPAGTDVFIS

VYNLHRSPYFWDRPDDFEPERFLVENKNEEIEGWAGFDPSRSPGALYPNEIISDFAFL

PFGGGPRKCVGDQFALMESTVALTMLLQNFDVELKGTPESVELVTGATIHTKNGLWCN

LRKRSFAH

 

>CYP97C10 DQ335801                1814 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP97A10

(CYP97A10) mRNA, complete cds.

75% to 97C1

MPSCSCSCSCSLPLSHLSLSSFSKTPLPQKRYPLHPRILTKSST

NKNPETTKSTSWVSPDWLTSLSKSLTTSKNDDSNIPIASAKLDDVSDLLGGALFLPLF

KWMNEYGPIYRLAAGPRNFVVVSDPAIAKHVLKNYGKYGKGLVAEVSEFLFGDGFAIA

EGPLWTARRRAVVPSLHKRYLSIMVDRVFCKCAERLVEKLQADAVNGTAVNMEDKFSQ

LTLDVIGLSVFNYNFDALNSDSPVIEAVYTALKEAEARSTDLLPYWKIDFLCKIIPRQ

IKAENAVTVIRKTVEDLIEQCKEIVESEGERIDADEYVNDADPSILRFLLASREEVSS

VQLRDDLLSMLVAGHETTGSVLTWTLYLLSKDSSSLAKAQEEVDRVLQGRRPTYEDMK

DLKFLNRCIIESLRLYPHPPVLIRRSQIPDELPGDYKIDAGQDIMISVYNIHHSSKVW

DRAEEFFARKICLDGPVPNETNTDFRFIPFRGGPRKGVGDQFALLEATVAFAVFLQHM

NFELVPDQNIGMTTGATIHTTNGLYMKMSQRLKKLTSTFFSHRWQNLLANNYQQD

 

CYP710 clan

 

>CYP710A15 DQ335802                2056 bp    mRNA    linear   PLN 04AUG2006

DEFINITION  Medicago truncatula cytochrome P450 monooxygenase CYP710A15

(CYP710A15) mRNA, complete cds.

MNAPLLLSSFSFNQLIPYLICFILFLLLIEQISYLNKKRSIPGP

SLVLPFIGNAISLVRDPTKFWEVQSTLSKSAGFSANYIIGLFIVFIRDTELSHKVFSN

VKPNAFHLVGHPFGKKLFGEHNLIYMMGQEHKNLRRRIAPNFTPKALSTYTELQQIII

LKHLKSWLHKSHAQAHESFPIRVLTRDMNLETSQTVFVGPYLGLKARERFEHDYFLFN

VGLMKLPFDFPGTAFRNARLAVDRLAGTLGGCTAASKEKMEKGEEPSCLIDFWMQDTL

REIEESKLNGVTVPPFSTNAEIGGYLFDFLFAAQDASTSSLLWAVTLLDSHPEVLARV

REEVAGIWSPESNTLITSEQLREMKYTQAVAREVIRYRPPATLVPHVAAEPFPLTESY

TIPKGAIVFPSAFESSFQGFTEPDRFDPDRFSEERQEDQIFKRNFLAFGAGPHQCVGQ

RYALNHLVLFIAMFTSLIDFKRDRTDGCDEIVYVPTICPKDDCRVFLSKRCTRYPSLP

GVEELVK

 

CYP711 clan

 

>CYP711A10 Medicago truncatula

AC152551.33

71% to 711A1

CG937618.1

64274  MLFISVILNVPLASTIFILVTLMGG

64199  LVGYLYWPFWKLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYR (2) 64050

63581  FHMGRQPLIIIADAELCKEVGIKKFKEIPNRSIPSPISASPLHQKGLFFTR (2) 63429

62783  NSQWSTMRNTILSVYQPSHLANLVPKMQSFIESATQNLDDTSKEDIIFSNLSLRLATDV  62607

62606  IGDAAFGVNFGLSKPHSICESMNNVEQSSANSDEVSIFINQHIYSTTQLKMDLSGSFSII  62427

62426  IGLIAPILQEPIRQILKRIPGTMDWKMECTNKNLTGRLDDIVKKRMEDKSRTSKNFLSLI  62247

62246  LNTRESKSVSENVFSFDYISAVTYEHLLAGSATTSFTLSSIVYLVAGHPNVEEKLLQEID  62067

62066  GFGPHDKIPNAKDLNESFPYLDQ (0)

61892  VIKEAMRIYTVSPLVARETSNEVEIGGYLLPK (0) 61797

61455  GTWVWLALGVLAKDSRNYAEPEKFKPERFDPKCGEMKRRHPYAFIPFGIGPRACIGQKF  61279

61278  SLQEIKLTLIHLYRKYIFRHSLNMEKPVELEYGLVLNFKHGIKLRVIKRT*  61126

 

>CYP711A10-de5b  pseudogene  Medicago truncatula

AC152551.33

56170 HPYAFIPFGIGPRVCIGYKFFFQ*INLTLIHLYRKYVFX 56057

56052 YSLDMEKHVELEYGLVFNFKHGVNL*VIKRN* 55957

 

>CYP711A12 DQ335803                2017 bp    mRNA    linear   PLN 04AUG2006

Medicago truncatula cytochrome P450 monooxygenase CYP711A12

(CYP711A12) mRNA, complete cds.

MVFMDLEWLFPIPISVSFASTILALAGGWLIYLYEPYWRVRKVP

GPPSLPLVGHLHLLAKHGPDVFSVLAKQYGPIYRFHMGRQPLIIVADAELCKEVGIKK

FKDIPNRSTPSPIKASPLHQKGLFFSRDSQWSTMRNTILSVYQPSHLSRLVPTMQSFI

ESATQNLDSQKEDIFFSNLSLKLATDVIGQAAFGVNFGLSQSHSVHNESKNVATDNKD

LMNASGSNEVTDFINQHIYSTTQLKMDLSGSFSIILGLLVPILQEPFRQILKRIPGTM

DWKIERTNEKLGGRLDEIVEKRTKDRTRSSKDFLSLILNARESKAVSENVFTPEYISA

VTYEHLLAGSATTSFTLSSVVYLVAAHPEVEKKMLEEIDGYGSLDQIPTSQDLHDKFP

YLDQVIKEAMRFYIVSPLVARETSNEVEIGGYLLPKGTWVWLALGVLAKDHKNFPEPE

KFKPERFDPNCEEMKQRHPYAFIPFGIGPRACIGQKFSMQEIKLSLIHLYKKYLFRHS

ADMESPLELEYGIVLNFKHGVKFSVIKRTEMSC

 

>CYP711A12 CR956434.13  M.truncatula on chromosome 3

67499  MVFMDLEWLFPIPISVSFASTILALAGGWLIYLYEPYWRVRKVPGPPSLPLVGHLHLLAK  67320

67319  HGPDVFSVLAKQYGPIYR  67266

60597  FHMGRQPLIIVADAELCKEVGIKKFKDIPNRSTPSPIKASPLHQKGLFFSR 60445

60164  DSQWSTMRNTILSVYQPSHLSRLVPTMQSFIESATQNLDSQKEDIFFSNLSLKLATDVI  59988

59987  GQAAFGVNFGLSQSHSVHNESKNVATDNKDLMNASGSNEVTDFINQHIYSTTQLKMDLSG  59808

59807  SFSIILGLLVPILQEPFRQILKRIPGTMDWKIERTNEKLGGRLDEIVEKRTKDRTRSSKD  59628

59627  FLSLILNARESKAVSENVFTPEYISAVTYEHLLAGSATTSFTLSSVVYLVAAHPEVEKKM  59448

59447  LEEIDGYGSLDQIPTSQDLHDKFPYLDQ  59364

59067  VIKEAMRFYIVSPLVARETSNEVEIGGYLLPK  58972

58855  GTWVWLALGVLAKDHKNFPEPEKFKPERFDPNCEEMKQRHPYAFIPFGIGPRACIGQKF  58679

58678  SMQEIKLSLIHLYKKYLFRHSADMESPLELEYGIVLNFKHGVKFSVIKRTEMSC  58517

 

CYP727 clan

 

No members found yet

 

 

>Soybean CYP727

54% to 727B1 poplar

CG813047.1 CZ506069.1 genomic, CA801410.1 EST

MNDIIACAAAAANSSLPTSVLGVLHFLHSRGRSSSCVHTPSELLRDFATREFNAFLWLCLVAVTTLLL

RRLFNLFRLWHRAKTIPGPPSPSFFGHCKLFSRQNFTFTDVLSESHQKYGPIVKLWLGPT

QLLVSVTDPALIQEMLIKAKDKLPFTGKVFHLAFGESSLFAPSFEK (0)

VQKRRELLANELHERLLKSDDVIPMKVADFITDKIENIRTKRGINSRLVSQHMAFTIMGAT

FFGDGFLASPKAAIYEELFMMIAKDACFWASYNVTPFWRHEFWRYQCLCTKLKCLTQDIL

QHFRKGCKLFGQTDQDVRNESSNKETKSADGAQCCSGDDFQDYFFFRDLKDH

 

>Lotus japonicus CYP727

AV418489.1

70% to soybean 727, 56% to poplar CYP727B1

FGDGFLAWPKAAMYEELLTMIGKDACFWASYNVTPFWKQGFWRYQRLCNKLRCLTQDMLQ  181

HCRKSCKIFGHTDENVHSESSNLDMKSADGAQCCSDNEFHNYYFSHDLNGH  334

QNADDETCGNIMRVMFHGCQTTAALIAN

 

GSS section

 

False positives

 

>CR331796.1 Medicago truncatula genomic

ubiquitin ligase not a P450

46   EYISLFVDDKLRKGLKGVSEDVVEIILDKVMVLFRYLQEKDVFEKYYKQHLAKRLLSGK  222

223  TVSD  234

 

>CG954156.1  MBEKR39TR mth2 Medicago truncatula genomic clone 76G6, genomic

CG960944

425  VVDVFENGFIVKKTTVYLVYDEPIGEKMEQYCQEQEEIVCSGDEDECFVREV  270

 

>CG969307.1  MBEKX21TR mth2 Medicago truncatula genomic clone 77D18, genomic

400  VYYLFIRLHYLSHHIYDNIKITNVCL*GEIFIRKGHALFSLFFAIYILTN*HNNLK  567