98 sequence pieces from moss = 71 complete seqs, 24 finished pseudogenes,

plus 3 bacterial contamination P450s.

15 sequences not from Physcomitrella moss, used to assemble moss genes.

 

in progress D. Nelson

July 31, 2005, revised Jan. 31, 2006

 

517 moss ESTs

 

CYP51 clan sequences (1 complete sequence and 1 finished pseudogene)

 

>CYP51G1 complete

ESTs BJ585158.1 BJ591215.1 BJ592754.1 BJ963427.1 BJ165255.1 BJ157286.1

BJ188328.1 BJ185333.1

MGDAEMQGAPVGESAVFDRSKVMMLLGSLVVAAIVGHFVLAWNRKRRNLPPVVD

SAVPFVGGLLKFIKGPVPLLKEEYGRLGQVFTLQMLTRNVTFLIGPEVSAHFFKAQEADLSQRE (0)

VYQFNVPTFGPGVVFDVDYSIRMEQFRFFTEALTVKRLRSYVEMMVEEAH (0)

LFFSKWGEEGEVDLKVELEQLIVNTASRCLLGPEIRNSHLEKVTSLFHDLDNGMLPVSVLFPYLPIPAHKRRDR (2)

ARKELAEIFSKVIKARKASGKKEPDMLQAFMDSTYRSLKRGTTEEECTGLLIAALFAGQHTSSITSTWTGAYLMK (2)

YKQFMPAVIEEQKEIMRRHGDHLDYDVLNEMSCLHRAMKEALRLHPPLILLLRQNHTDFSVTTREGKSYTIPKG

HIVGTSPAFANRLPYVYKDPDTFNPDRFAPGNEEDVKAGQFSYIAFGGGRHGCLGETFAYMQ (0)

VKTVWSYLLQHFELELTGPKFPEVDWNAMVVGIKGEVMVRYKRRQLTCD*

 

>756723207 755804088 717597240 CYP51 pseudogene 54% to 51G1 rice with

multiple frameshifts finished

TSPAFANRLP

HLHKDPDFFNPDRLDPENEETK

IGGIISCMCFGGGHHSCLRETYLH

VQGKTVWSFLLQYFVMELVSPKFPAVDWNVMVVGNKGEVLGLLFSL*

 

CYP71 clan sequences (41 complete sequences 15 finished pseudogenes

0 partial sequences)

 

>710927435 CYP756A1 33% to 92A8 66% to 710912672 complete

870079473 1028549191 997124596 no ESTs

MAHLHTRLSEEAEAWIATGVDSFSRWQEYAAGFGRATYIVAALGFFAVVILELHNS

RKRRLSKLPPGPFQWPYLGSLPNLLLTVGVTSSFRLREKVSELGRNH

GPLMFLQIADTQILIVSSGTAAKE (0)

VLIARDEEFNFRPQCAVGKYLGFGSSDIAFAEGRHHWYLRKLCDTRLFSADSFVSYGHIPRAEAL

KMLHSVWEASKKGNGISVRETVTAFVRNSLCGMLLGSAHLDIENVSLQFTEKTLI

TLLDETICVVGEITLSDLAPGLKRVDFHGRTRKLKELHERWEKYLRVILEDRSHRLEKSA

KPEALVDVLLSLDDADMKLSNEAIMGVLL (0)

DTLVGGVYSTSATIEWALAELVRHPGVLEKVQLEMSEVVGPYHIVEDAEISQLPYFQ (0)

ATVKETLRLHPVVPMSLPHMNKVATSISRYQIPANTSVVIDYKAIA

RDPAAWHKPLRFDPSRFLHTSAASQIDNIFKFLPFGYGRRGCPGANFAAVLLQLALAHLI

QAFDWAPTKGQLPHDIDVKESPGLVCFRFSPLVLSSTPRLANSLYQVSP*

 

>710912672 CYP71B like4 CYP756A2 complete BJ165273.1 BJ581063 BJ157306 879465659

828157377 830613141 815612895 755803843

MAQAVGLGRLPPPLSEENKAWMTNQLESYSTWQMNAAGLGRALYILAAVVFSAVVCFEQYSKRKERLSKV

PPGPFQWPYLGSLPYLIRTVGLRSSTRLREKITELAMKHGPLMFLQIADTQIVVVSSGKIAKE (0)

VLVAHDAEFYFRPRCLVGKYLGFDS

TNMAFAEGRNHWRLRQLCDKHLFLPECFASYGHVQKQEAEKMLHSVWEATKRGENISV

RHTVITFARNSLCRMLLGTAHLDIENTSLEFNKETLITLLDEAFAVAGETTLIDLTPG

LNWLDFHGREQKMKYLRRRLEKYFQEILDDRSQRLDRSEPEAFVDVLLSLDEDKTLSDEAMMGVLL (0)

DTLVAGTYSISASVEWALTELVRNPTMLENVQNEITQVVGPHHIVEVTEFSQLSYFQ

AIVKETLRLHPAMPMSIPHMNKVATPLSSYEIPPNTSVVVDYAAIGRDSEIWPN 179

PLDFDPRRFTDTDAASQIDSFKFLPFGYGRRVCPGANLGLRLLQLGLAHLVQGFDW

IPIEGQLPHDIDIKESSGAICFKSTPLILRAIPRLASTLYEI*

 

>692433988 CYP73A49 complete 846079417 836296434

BJ177355.1 BJ182198.1 BJ176060.1 BJ186266.1 BJ197128.1

BJ963588.1 BJ192275.1 BJ179214.1 BJ191683.1

BJ975047 = mate pair of BJ966530.1 BJ600264 BJ611038

BJ975788 = mate pair of BJ967270.1 BJ587131 BJ593693 BQ039467

BJ582985 = mate pair of BJ177851.1 BJ581278 BJ582455 BJ584349

71% to 73A5

MGAGWKEAMALGLAGAGVARVLAISEDVVDNAAVSSFVKQF

MNLEGAVQALLVAVLLGLLIAKLRAPKLNLPPGPVALPIVGNWLQVGDDLNHRNLAEMSQ

KYGDVFLLKMGQRNLVVVSSPEVAKEVLHTQSVEFGSRTRNVVFDIFT

GNGQDMVFTVYGDHWRRMRRIMTVPFFTNKVVQQSRGAWEDEA

LRVIQDLKAKPEAS TTGVVIRKRLQLMMYNIMYRLMFDSRFESEEDPLFLKLKALNGERS

RLAQSFEYNYGDFIPVLRPLLRGYLKVCQEIKDRRLALFKEHFLDERKKLLSTLGPRPDG

EKAAIDLILEAQKRGEINEENVLYIVENINVAA IETTLWSIEWGVAELVNN

PEMQTRIREELDSTLGKGNLITEPDTYNNKLPYLSAFVKEVMRLH

MAIPLLVPHMNLHQAKLAGYDI

PAESKILVNAWWIANNPNHWDQPEKFIPERFLDGKIEAKGDDFRFLPFGSGRRSCPGIIIA

MPLLSIVLGRLVQSLELLPPPGTKKVDVSEKGGQFSLHIATHSTVVCKPIA*

 

>CYP73Ayy CYP73A48 705225761 complete 69% to 73A5 68% to upper seq

686707760 two frameshifts near end near exact overlap with 705225761 (join)

ESTs

BJ156825 BJ601621 AW598785 AW156067 BJ960273 BJ962155

BJ173522 BJ170223 BJ955206 BJ608342 BJ603676 BJ955206

BJ605702 BJ593402 BJ607994 BJ596392 BJ609670 BJ944446

BJ606143 BJ598803 BJ583187 BQ041736 BJ597214 BJ599148

BJ607151 BJ595328 BJ163543 BJ203089 BJ199707 BJ201130

BJ197619 BJ178048 BJ195721 BJ970670 BJ193565 BJ199312

BJ206667 BJ204697 BJ200793 BJ173402 BJ185972 BJ190015

MEAASLASMFTFNNIVQGLCVAVFLGIVIMKLRAPKLKLPPGPFALPIVGNWLQVGDDLNQR

NLAEMSQKYGDVFLLKMGQRNLVVVSSPDIAKDVLHTQGVEFGSRTRNVVFDIFTGNGQDMVF

TVYGEHWRRMRRIMTVPFFTNKVVQHSRYAWEEETDYVIKDLKARPEAATSGVIIRRRLQ

LMMYNIMYRMMFNSRFETEDDPLFVKLKALNGERSRLAQSFDYNYGDFIPI

LRPFLKGYLKTCQDVKDRRLALFKEHFVDERK (2)

KLNSVNPPKSEAEKCAIDHILEAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAE

LVNNQEIQTRIRNELDSILGKGNLVSEPDTYNNKLPYLTAFVKEVMRLHMAIPLLVPHMN

INQAKLAGYDIPAESKILVNAWWIANNPKYWDQPEKFMPERFLDGKIEASGNDFRFLP

FGVGRRACPGIIIAMPLLAIVLGRLIQSFELLTPPGVKKIDLTETGGQFSLRIANHSTVV

ARPLAV*

 

>755680881 CYP73A50 76% to 710919188 1005948486 67% to 73Ayy 60% to 73A5

895358221 852123011 complete

CYP73Axx (no ESTs) lower part from AIE to end = 755680881

exon starting with KLGNA has no exact matches in trace archive

This is proably the same seq as 755680881

710919274 759458758 61% to 73A5

MEKPTVVRGLLAIFVIGLVTGVEFKAP

STLDFVFSLDPCRQSLLLIVFTAIVINLRMKDRKMNLPPGPTALPIVGNWLK (0)

VGNDLKHRTLAEMSERYGDVFMLKMGWRNYVVVSSPEAAKGVLHTQGEEFAC

RTRNAVFDIFAGKGQDIVFTNYGDHWRRMRRILTVPFVTAKVLQHAHFAWEEEVDEVMED

VQSRPESATAGVVLRHRFQLMMYNIVYRMMFNSRFASEYDPLYLKLKGLNGERCRLPAQN

YKYNYADFFPFLKLFIRGYLKICQEVRDKRLSLFKEHFVDERR (2)

KLVNAVGVSGAEEKCAIDHMLEAQKKGEISEDNILYLIENINVA (1)

AIESTLLSIEWGIAELVNHPNVQKRLQAELLEVIGEGNLVAEPDTHNNK

LPFLTAVVKETLRLHMPVPLLVPLMNMRQAKLAGYDIPPQSKVLVNAWWIGNNSKFWDQP

EKFMPERFLPAAAENQSLDFRFLPFGAGRRSCPGTAIAMPLLAIVLGRLLQKFDLLPPPG

MSKVDVAESGGQFSLHMATHSIVVLRPRN*

 

>710919188 CYP73A51 717596474 756814972 762526716 61% to 73A5 N-term

883857969 977890599 complete no ESTs

MGNPMGIGVLLVILVFGVVAKVDFKSRILLDFAFSSSLL

MQALLLGVFIVIVVSLRREGRNMNLPPCPAAFPIVGNWLQ (0)

VGNDLKHRKLAEMAQKYGDVFMLRMGRRRFVVVSSPEAAKEVLHTHGVEFASRTRNAVY

DVFAGKGQDIVFTNYGDHWRRMRRIMTVPFVTHKVVKHAHFAWEDEVDHCIRDVEARSE

SATTGVVLRHRFQLMMYNIMYRMMFNSRFADEHDPLYLKLKGLNSERCRLPAQNSKYNY

ADFIPILRPFLRGYLKVCQDVRDRRLTLFKERFVDDQ (2)

KLVNAVGAAGAGEKCAIDHILEAQKKGEISENNVLYLIENINIA (1)

AIESTLLSIEWGVAELVNHPEVQKRVQKEL

DEVLGDGHLVSEPDIHSGKLPFLTAVVKETLRLHMPIPLLVPHMNVKQAKIFGYDIPPES

KILVNAWWIGNNPKFWDQPERFMPERFLSATSEATTVDFRFLPFGAGRRSCPGSAIAVPL

LAIVLGRLVQKIDLLPPPGMTKVDVTESGGQFSLHMATHSTVVTRPRA*

 

>BJ163406 CYP73A52P aa 169-308 mate pair to BJ173377 finished

this seq seen in at least 6 trace archive seqs 1023200166

883856438 869788433 891417707 866058619 884943991

890407139 838586233 816063061

This seems to be an expressed pseudogene 76% to 692433988

LATS*EAGNSELGASFLKHF

MGLESAVQGLLVAVLVGLLIAKLRAPKLKLPPGTVALPIVGNWLQ (0)

VGDDLNIGNLAEMSKKYGDVFMLKMGQRNLVMVSSPEAAKEVLHTQGTEFGSRERNVVY

DILIGNGQDMVFAVYEEDWRKMRRIMTVPFFTSKVVQQSRGTWEDDALRVVEELRTRPEAS

TTGVVIRNRLNSMMYNSIYRLMFDRRFENEEDPLFLRLKALNGGRSRLAQSFEYN*GDFI

PILHPVLRGYQRVCQEDQDRRLGVFNEHFVDVRKKLLETTGP

KPDGEKAAIYLILEAQRKGEISEDNLLYIVENINVAAI ETMLWSIEGGVAELVNNPDI

QTRVSEELDHTLGKGNLITELDTYNPK (deletion)

HWDQPGRFMPERFSGNNIEVSGGDFRFLPFGSGRRSCRSIIIAMPLLTIVLSRLVQS

MGQLSPPGMKKVDVAEKGGQFSRHIATRSTMVCKPIA*

 

>755683069 CYP73A53P 710485186 72% to 73A5 with frameshift and stop codon

pseudogene, stop codon seen in 12 sequences, finished

815536458 41/47 (87%) to 73Ayy 824722097 pseudogene

816099016 87% to CYP73Ayy, suspect these join with 755683069

MATAGTIMMQAVGMASMFTFQNVVQGLIVAMVVWIFVIKLKSPKYKLPPGPVANWLE (0)

FGDDLNHRYLAELTKKYGDIFLLKMGQRNVVVISSPEIAKDALQTQGIAFGSRPRNVVF

DIFSGKGQDMVFTPYGEHWRLMRRITTAPLFT

NKVVQQSRYAWEEEID*VSKDLKTLPE

XXTSGVIIRTKLQLMMYNIIYRMMFTSRFKDEKDPLYLKLKVLN

EDPRYLNLKVLNGEQNRMGQSFDYNSGDFIPIVRPFLRGYLKVC

QDVKDRRIALFKEYFVDERR (2)

KLTSVNPPKSEEQKCAIDYIFEAEKLGEINEDNVLYIVENINVAAIDTTLWSIE*GIAE

LVNNPELDGIREELDAVLGKGNMVIEPDTYNNKLPLLTAFVKEVMRLHMSIPHVVHMN

LKHEKLAGYDIPAESKILVNVWWIGNNPKY*DQ

PEKFMPERFLDGNIEPSGNDFRYLPFGVGRRRCPGIFIAMPLLSIVLGRLIQSFELLPPP

GVKEVDVTEFCGQFSLRIANHSTVVVRPLL*

 

>710518592 CYP73A54P 755698511 44% to 73A5 C-term to PERF finished

pseudogene stop codon seen in 11 seqs

GNFVSEPDTHNSKLQFLRAVSRKS

KVTLPSPLFSLHMNVKQVQIGGYYMFAESKISVIAW*IGNSPKLWDQLEKFMPEK 123

 

>CYP75B like1 CYP767A1 change to 757A1 716895728 755798807 39% to 92A11 38% to 75B1 complete

852155406 977922988 859713404 42% to CYP76C like14 no ESTs

MMEIGGMRAEWHVVLSACVTIATMVL

TIMKLRKKIGKLPPGPRALPLIGNIHQIGDFSRRNLMQMAE

KYGPIMYMRIGSKPLLVVSTAEAAHEFLKTQDKEWADRPTTTADKIFTNDHRNIVCAPYA

AHWRHLRKICTMDLFTPKRLMSFRTPRTEEINQMMTSIHEDVAAGKEVKLHVKLGHLTTNNITRMLLGKR (2)

FFTVDEKGQMEAHRFKELVFELFRASSTPMIGDFIPWLKWVSIASGYVKYLKRVKADLDAFLQEFL

EIKKAASDQATAERAKDFVDLLLEQKTVSGDGPLEDATIRS (0)

DMLLAGTDTVSNAMEWTIAELMRHPECMRKLQQELDTVVGKSRIVSETDLPNLPYLQAVVK

EVMRFYPPAPLSLPHQSIVPTTVCGYDLPAGTQLCINLYAIQRDPKYWPNPVQFNP

DRFLNCDVDVGGTHFQLIPFGAGRRQCPGMPLGNLLLQISVARLVQAFEYSLPRGTK

RNYFMNYYSGANKLTSGIMYLI*

 

>CYP76C like14 CYP761E2 complete 74% to CYP76C like13 43% to 736A1

44% to 92A13 42% to 92A14

692514018 no ESTs

816061186 859980678 755804916 759452715

755804916 759452715

MYFEKTTVARMLTAGFESENGLTGRRVEFYVFLAAIFIMPLVLL

KITRRPRLKLPPSPPAYPIIGHLHLLGKLPHQSMTNLAKKYGEIYSLRLGSVPAIVISTP

EMAKEFLLTNDKIWSSRSVHMTSGYYFSYDYA (1)

GIAFAPSTPVWRSLRKICMSELFTQRRLEASKGLREEEMQYMIR (2)

SILDDAHQGRLIDLKLKINALTANIVARMVLNK

RFTGCIDSTVETEAEAHQFKEMMEEHFLLLGVFMIGDYIPWLSPLDLGGT

EKRMKSLRKRLDAFLDDILEVHEVKRAKGPIPEEDQDVIDVLLNEMYQQDSN

ESKQLDTNNVKSTIL (0)

NLFAGGTDTSTVTIEWAMSEMLRNPTIMGKLKAELDARIGKDRRVRETDLSDLPYLQAVT 530

KETFRLHPVGPLLIPHVSTHDCEVGGYHIPTGTRLYVNVYAIGRNPKVWDRPLE 692

FDPERFMTGLNAGVDVKGKHFHLLPFGTGRRGCPALPLGLLIVQWTLATLVHALDLSL 866

PQSMEPEDVDMTEAYGLTVPXGASLYLNAKLRAADHLY*

 

>BJ166750 CYP754A1 BJ171256 BJ172713 BJ602502 mate = BJ205564 complete

1014495025 879457809 883995654 1014487906 862362793 BJ165056

51% to 75B like3 BJ157072 BJ157394 BJ190531 BJ170915 BJ595929

MVEESWLWVLFVGALSFSILLQWGLNRKRKLKLPPGP

TAWPIVGCVFGLPRLNPPEKLFNKLSEKYGELMLLQLGSWSIVVTSSARMAMEILKTHDN

EFANRPDVISSRLNFNNTGLIQMHSTNPLFKRTRRMFS

AEIVSPRTVLETGVIRRKQ (0)

LRTLRSIVQDFDAGRSVNFTHEMKTLAMNLSMSICFGTDYATKVNDEAEALIHTYK (0)

IMAIWTRRSLGAIFPALRWLDLDGIESGFADVELQLRTNITALIEKKKQEMSMWSAE

DIQAGANEGDVMTKFLSMEGEDRCSEDQLISVVF

TILLAGTDTVFNVVTEAMYALLMHPNFYHRAVEELDAVVGKSRLV

EEADIPKLPMIQNIIKETFRIKPAGPSLVPRKNFEACEVAGYHIPANTTVFVNCIPLMRD

PSFWDSPDEFNPDRFIDSKVTVLGSDFNYLPFGYGKRTCPGLNLGMI

TVQYILAACLQCISWKLSRPRRLDIETDDDPRKVDDVMVDGKQRVDPALLEFAPQPVK*

 

>CYP75B like3 CYP754B1 complete BI437153 AW509529 BJ595585.1 BJ977649.1 BJ969326

713843806 713853618 CYP71 N-term 869925250 881364275

34% to 92A sequences, no high similarity to a known family

36% to Panax ginseng seq. AB122079

yellow exon questionable

MVGDVWIWVLITMVVAVIVGVGIDKKTKRGLKLPPGPPAWPVVGCLASLPAGHPPEVMFAKLAEKHGE

LMLLWLGSKPYVVASSARMAMEFLKRHDQEFANRPMSVVREYVSFKGNSIISMSASDPKY

QRLRRTFVMELLSPKKIAATRDLRKDQ (0)

VLKMLRAIREDLDAKHEANFTEAVLTLGMSLSIGLLFGRDYGGKVFSEEIQTLVLTFKT (0)

MVKYLSMINISDLIPSLRWLDLQGIERGLGLGEVQLRKSIMALIEQKRLDKIRLSSDE

IESGACQRDILSKLLSLEGEDRLDDDQLMGVVF

ALMLAGSDSISRGVGRAMQELLKQPLLHQRALDELDEVVGRRRLVEESDISSLPLINNIIKETLRLHP

PAQLLIPHGNVEQCEVAGYHIPARSTVLVNLYALSRDPSFWNSPLEFAPDRFVDSNLTVQGS

DFHYIPFGYGRRGCPGLNLGMITVQYALALCLQCILWRLPAGATISETYIDWKNSPDLIV

DGDLRVDLHLLEGL*

 

>AB122079 CYP768A1 change to 764A1 Panax ginseng (Apiales) 41% to 92A9 40% to 75B

MFPLAYPLLFVLLGALSWWILPIISPLKRHHKLPPGPRGLPIIG

SLHTLGALPHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPK

LQAAEYMSYGTKGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREELGMVVKSI

KEASAANEVVDLSAKVANIIENMTYRLLLGRTKDDRYDLKGIMNEALTLAGRFNIADF

VPFLGPLDIQGLTRQFKDTGKRLDKILEFIIDEHEQNSSNGNASGDFIDDMLSLKNKP

SNTHDELSKVIDRSVIKAIMIDIISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDA

VVGVDRMVEETDLPNLEYVYMVVKEGLRLHPVAPLLGPHESMEDITINGYFIPKQSRV

IVNSWALGRDPNVWSEDADEFLPERFEGSNIDVRGRDFQLLPFGSGRRGCPGMQLGLI

TVQLVVARLVHCFDWNLPNGITPDNLDMTEKFGLTTPRVKHLLAVPKYRL

 

>CYP76C like1 CYP758A1 complete 715966631 AXOS23673.g1 BQ040580 AW599561 48% to 76C2

BJ609203.1 opp end = BJ201966 BQ040759.1 711801903 BJ168318 BJ166758 BJ158754

BJ160069

CYP76C like4 713876163 46% to 76C2 no ESTs one frameshift and stop codon

no exact matches in trace archive, best match = 715966631

probably a poor version of the 715966631 sequence

MATPDSSGGAFDLAKWINGLVAHWGSVAVAVVAAAVIAKFIFNSTVGRRKL

PPGPAPWPILGNIASLAGLPHRSLEKLARKYGSLMYLRLGEVPCIVISSADVAKQLFKTH

DILFSNRPGGCFFEQLTEYRNITASRYGPHWRHLRKTCVHELFTQKRLEAYQATRLE

EISISIKELFEESDKKGPVDLHAWLHRLLFNNLTRVIMNNR

YFGTDEKGMKDAMDFNNVTALMFSQAGDVVISDFLPYLGFLTRLQGKPLLYR

KTREIVLEMMRRMTNFDERKKLHAEGRSTGEPEDFVDVLLSSTLSDGTTPLPDDICLMLL

MDVLVAGTDTSATTVEWTITELLRHPEAYKRVREELNSVVGSDQLVKEEHLEHLPYLNAVLQ 356

ESFRLHPATPLGLPRESSEAFEFLGYSLPAGTRLFVNQWAIHRDPAVYEQPEEFN 521

PERFLGREALKFIGDTQFQLVPFGSGRRNCAGLPMAVIVIPLVLAHLLHSVEFSLP

DGQQPKDLDMTETFGVAAPKASPLMIYATPRESAALY*

 

>CYP76C like2 This is a hybrid seq of two different genes

713877140 762522648 711800153

692509705 710494763 715965478 755800431 692507811 713794646 43% to 76C2

692476632 879809357 859709904 716891783 717625521 869788525 870057181

AW599509 BJ583667 BJ579892 BJ597932 BJ166653 BJ194761 BJ946070 BJ174288

BJ190667 BJ158648 BJ174717 BJ177099 BJ178535 BJ588129 BJ586603 BJ585830

BJ179043 BJ179518 BJ171222 BJ579424 BJ582321 BJ582678 BJ584175

715978988 756810370 CYP76C like11 51% to 76C4 95% to 76C like2

no other exact matches in trace files

1025182054 = best match same as 76C like2 assume this is the same seq

MAEGGLLFGFELADVLVAAVLISVVVLYFHAEALQRRRCPPGPWPWPVVGN

FSALGDLPYRNLHKLAGKYGGLMYLRL (1)

GAKPCLVISTAAVAKEFYTTVDASFASRPKRFSWTVWNN

NDENYRNIGLAEYGPYYRKLRRLLNTELFSPRRHASYEVTRAQEI

QCMMKVLLEESEKGNPVNLQTWLHGTTSNNMTRMVVGKR (2)

FYGVSGDDGEKQ GQDLQK MTSSVFELLGSVV

ISDFVPYLS FITKLQGHASKFSKIRDVSDKLTADFFDLD

SHRNNYKKMKNDPSYVPDFEDVLMETPFENGTNLPDQDLLKLLQ (0)

ELLNAGTETSSNTSEWAMAE

LIRRPELIERAQTEMDSVIGSKRLVEESDIQQLPFLQAV MKENFRLHPPAPLLLPHESREPTELLGYHFPAGTELLVNAFAIHRDPSVYDNPDSF

DPDRFLARPHVDHMSTSDPYELMPFGKGLRMCPGYRLANTMVALMLANLLYVFDWSLPEG

QTEVDMTETIGISVRKKQPLFLVPKPRFELSLESVAEN*

 

>713877140 CYP758F2 (no AP insert, LHK insert) complete

also 824697165 893557678

993602306 869943560 997070612 993467812

1020671150 755800431 892704920 883863821

1006335547 857898605 BJ583667 mate = BJ178535

BJ579892 mate = BJ174717

BJ597932 mate = BJ194761

BJ179518 BJ158648 BJ190667 BJ177099 BJ179043

BJ946070 mate = BJ956863

957569174 883845570 713794646

MAEGGLLFGFELADVLVAAVLISVVVLYFH

AEALQRRRCPPGPWPWPVVGNFSALGDLPHRNLHKLAGKYGGLMYLRL (1)

GAKPCLVISTAAVAKEFYTTVDASFASRPKRFSWTVWNNNDENYRNIGLAEYGPYYRKLRRLLNTELFSPRR

HASYEVTRAQEIQCMMKVLLEESEKGNPVNLQTWLHGTTSNNMTRMVVGKR (2)

FYGVSGDDGEKQGQDLQKMTSSVFELLGSVVISDFVPYLS

FITKLQGHASKFSKIRDVSDKLTADFFDLDSHRNNY

KKMKNDPSYVPDFEDVLMETPFENGTNLPDQDLLKLLQ (0)

EMLNAGTETSSNTSEWAMAELIRRPELIERAQTEMDSVIGSKRLVEESDIQQLPFLQAV

MKENFRLHPPLLLPHESREPTELLGYHFPAGTEVLVNSFAIHRDPSVYDNPDSFDPDR

FLARPHVDHMSTSDPYELMPFGKGLRMCPGYRLANTMVALMLANLLYVFDWSLPEG

QTEVDMTETIGLSVSKKQPLFLVPKPRFELSLESVAEN*

 

>830443705 CYP758F1 (AP insertion) 96% identical to 713877140 (no AP insert)

879461440 1020623392 complete

may be alternative splicing in this gene. Two exon 2s exist

863042033 870057181 881406076 833254849

1003202172

BJ579424 mate = BJ174288

BJ588129 mate = BJ182840

BJ585830 mate = BJ180571

BJ586603 mate = BJ181679

828265864 833246011 977999457

(exon2a, short)

GAKPCLVISTAAVAKEFYTTVDASFASRPKRFSWTVWNNND

AFPSQSNNSVAVALSVDVSHLILPILSLEMHCATR

 

MAEGGLLFGFALADVLVAAVLISVVVLYFHAETLQRRRCPPGPWPWPVVGNFSALGDLPHRNLAGKYGGLMYLRL (1)

GAKPCLVISTAAVAKEFYTTVDASFASRPKRFSWTVWNNND

ENYRNIGLAEYGPYYRKLRRLLNTELFSPRRHASHEVTRAQEIQCMMK

VLLEESEKGNPVNLQTWLHGTTSNNMTRMVVGKR (2)

FYGVRVDDSEKERQDLQKMTSSVFELLGSVDLSDFVPYLS

FITKLQGHASKFSKIRDVSDKLTADFFDLDSHRNNY

KKMKNDPSYVPDFEDVLMETPFENGTNLPDQDLLKLLQ (0)

ELLNAGTETSSNTSEWAMAE

LIRRPELIERAQTEMDSVIGSKRLVEESDIQQLPFLQAV MKENFRLHPPAPLLLPHESREPTELLGYHFPAGTELLVNAFAIHRDPSVYDNPDSF

DPDRFLARPHVDHMSTSDPYELMPFGKGLRMCPGYRLANTMVALMLANLLYVFDWSLPEG

QTEVDMTETIGISVRKKQPLFLVPKPRFELSLESVAEN*

 

>815741313 CYP758B1 870248614 1029254207 43% to CYP76C like2 complete

816093549 978054225

MLATAFLVGFLAWAAMILGKFILEGIQRRNLPPGPWAWPIVGSLFSLGPLPYKTLRVLAKKHGELMYLR

LGSIQSVVVSSASMAKEVVTNHDLQFAYRPTKLFGKLLFNSKDIVHASNGPAWRHLRMIC

TSQFFTKKRLASYEATRTFEIHTLMKDILRKSSSEDCVVNLPFQLRNTSTNFISQMVFNKRY

FVEGEESNVEDAKRYQKILKIHFSSYAIFVVSDYIPCLRFITKLQG

IRGKFQQIADKIHKKMDEIIDINGHERRRIDANHKQDADRKKDFVDLLLETTSHDGKGTLDHETVRG (0)

DMLFAGAETQSSTLEWAMAFLIRNPGVMKQVQAELDGVVGTERVVQESDLEKL

PYLEAVVKEVMRVKPGAPIGINHESREPRQVAGHYLPAKTRLIFNIHAIHRDPS

VYDRPDEFDPTRFLSPGKGNVPTGQELFQLMPYGAGRRICPGMPLAIVNIPHVLAHLVHS

FDWSLPAGQDHRELDMTEKFDGVTSPRLHPLHLIPHPRKPAFLYK*

 

>710914928 CYP758F3P 44% to 76C1 80% to 76C like 2 finished

859944242  1000198948 756701133

pseudogene stop codon seen in 9 seqs, cannot extend upstream

AMAKLITRPELIERAQTEMDSVIGFKRLVEESDI*QLX

LQAVMKENFRLHPPDPFLLPHESREHTELLEYQNLVGTKVLVNAFAIHVDPSVYNNPDSF

DLDRFLARPHIDHMSKSDPYELIPFEKGLRMYPEYKLANTMVALMLAKLLYVFDGSLLES

QTEVDMGETISLSVSKKQPLLLVPKPRFEISLESVTXN

 

>CYP76C like3 CYP758C2 715973711 692501289 755703204 complete

710499319 722465916 49% to 76C4 BJ184478.1 755703204

884001657 891382019 859936235

686708074 34% to 71B2 N-term

MAQALVSPTCPRVVDKVATVTARL

GAILKELGYFAPPVALVVILATKLVWDARIQSQRRKTLPPGPRPWPIIGNLSALVGDKPHRALQELAFEFGGLMYLQL (1)

GMSSSIVVLSTAEAVREVFRSNDERILSRPKMLSFGIISDNYRSISFGPPGKLWQSMRRFCSTEL

FTNTRVASYQGRREEEVKHMLMVLVEESEKGKAVDLRSWLHDLSSNMTTRMLVNKR (2)

FFANRGENDGKQEILKSELEHVLEGFNVNIMRNVLSDYLPSLRYFAEELHGARAALEAFRDEAATVGRKIV

ELEKHRQRAQNPSKDENYVPDFVDVLIGAPLDDGKSLSDTLLTVQVL (0)

EFFFAGTHTSSATVEWAMAELITHPDLMKRAQAEVDGAVPADRLVRDS 549

DIPNLPYLQAVVKETFRMHPVLSLGGPRETTRPIEVNGYKIPAQTRLFVNIFAV 711

HRDPAVYTDPETFDPDRFLTQHLHTNHCSGFDSHELIPFGVGRRMCPGFHLGNTLVHLML 891

ANLLHRFHWSLPEGETIATVQASVMSEKLYGLLFHPNENLHLVPELKNGLPAS*

 

>755697346 CYP758C1 N-term complete 36% to 92A9 34% to 76C2 no ESTs

836315685 977938989 711868310 713876758

710485469 755791105

MMDSASYSAPFAALWDTFGRGTVVAVLVVVVVGELLLYARFQAQRRSTLPPGPRPWPILGN

FFVFSDVNHAHHDLRRLAAKFGPLMYLQL (1)

GSVPCVVVSTAEAAKELFRGHNDECLISRPKMLGLEILSDNYQLMAYAPAPGKLWHSLRKFGSMEL

FSFKRVAFYRSLREEELRHWIKFVLESREGEAMNLKSCVFELAANMMTRMLVNKR (2)

MFDITGADTQQQLLRSEFESFMEEHYKCLMPNVISDFLPFLRFFCEKLQGWRAYIQD

HQEKSVEFWTRIIEVEKHRQRAAERQNDGSYVPDLVDFMSTAPLDDGKVLSDRNITLQIL (0)

DFFLGGTDTTPLTLEWAMAELVTHPNFMKRAQEELDRVVGLERLVEETDFPNLP

FLQAIVKETYRLHPVGPLGGPRESTEPVEALGYKIPAKTRVILNIFAIHRDPAVYER

PDEFDPTRFLDRPLAAFDSYELMPFGVGRRMCPAFNLGNTTVHLILANLIHNFDWALADG

QNIDTFDMTERLHGVTFSLKYALSLIPTARSGILARAL*

 

>756700900 CYP759A1 75B like complete 83% to 76C like6, 38% to 92A14

755797279 883855058 850658210

BJ603828 BJ609557 BJ610988 BJ952601 BJ180041 BJ186479 BJ187843

BJ200343 BJ970091 BJ585378 BJ598216 BJ601033 BJ601619 BJ194512

BJ182396 BJ206478 BJ194704 BJ941950 BJ177426 BJ189078

BJ597358 BJ584496 BJ598216 BJ196301 BJ587678 BJ609929

BJ598163 BJ167822 BJ582057 BJ581628 BJ171635 BJ609821

BJ597734 BJ592849 BJ195065 BJ193723 BJ204894 BJ206483

BJ176403 BJ179692 BJ166342 BJ601824 BJ204693 BJ195012

BJ193292 BJ185416 BJ179347 BJ174872 BJ587298 BJ159549

MEFNQLVSVAAVVVVLGASLVFLRLFTK

KKLNLPPSPKGRMPIIGHLHLMDDNEAAHRTFARISEQNGPLTMIYMGNKPTLLVSTAAM

AEQVLKHNDQAFASRPFITAGKTLGFDFKSIVFAPFGNYYRRLRRIYTVELLSPKRVALSQ (0?)

VLRQHEIKHVINSVLAENQAEGRVNMTSILQEMGIDNLVRMIFAKPHMGATECLTKE

EMATLKSVVKEAVNLAGVIYVGDFIPLLDIYDFTGYKKKTNKLAAKMLDIATQLIEKHKS

DAGTGVDNDKLNLVDILLSQKGEDQLPPHAMAGILF (0)

DFIIAGSDTTSVSIEWAIAELLHYPHYLKRAQEEIDQVVGKERLVTEQDIKHMPFLQAVV

KELFRLHPAAPLGIPHCNMEETKLAGYDIPAKNTVMMNLWAIGRDPAHWDDALEFKPERF

LNKDITLLGRDFHLIPFSVGRRQCPGAGLGLAVVQLAVASLLHGFEWSTYNQKPEEIDMR

EKPGLVTPRKSDLIVTAVPRLPLHVYQGDKNGVQNGH*

 

>862766641 CYP759A2P 815526881 1009468231 1006200210 finished

pseudogene 61% to 756700900 stop codon lost at the end

759458516 (joins with 862766641) heme signature not typical

1028764555 stop codon seen in 10 seqs. finished

MEIHALVSVTSVVVVLGVS*LFLRSSMSRKLNFRPIPK

GRMPIIWHLPLIEDKEATFARICQ*NDPPTMM*VGNKPKLLISAAGMTEQVLK

HNYQAFASRPFMTAEKTLEIDFKSIVLAPFGNYYKRLRRIYTAELLSLKRVALSH (0)

VPRQHKVKHMVNKVLSEMQATGCENMISILQELGIDKLERMIFV*SHMVASEPLTREEM

VTLKTLVKEVVNLASVVCVGD

FLPLLNIYDFMGYKKK

MHYLSAKMNLVAQVL

I*KNQIQQRTWRRRG*LNMMDILLSQ*GENELPPNAMAVVIF (0)

DFIIIGSDTTSVSIKMAIGELLHHSHFTRRAQEEIHILGNDSLIEEQDNNMLFV

QDVAKERFRLHPASPLCISKFNLE*NEFVGYDIPANSTVMLNSWTIGRD

PLAATPDSQEFNPVRFLNKDIKMMGPDFQLILVSVERRQCSGTGMIMEVVEVVDASLL

RGFEWRCYNHKPKEFDMSEKPGPVRPRSTDVAITQVPRIHVHVYYRYKNSVQCGH

 

>CYP76C like6 CYP759A3P 755805060 692477956 710486323 973548001 finished

45% to 98A3 82% to 756700900

stop codon seen in 9 sequences , pseudogene

IPLDIYDFT (0)

GHKAKTMKLQAKMFASAMALIEKNKSNEKPVVDKDKQNLVDILLSQEGDDRLPDHALAAVLF (0)

DFIIAGSDTTSVSIEWAIAELLHYPHFMKRAQGEIDSVVGKDRLVDEQDIKNMPFLQAIIK 490

*LFRLHPAAPLGIPHFNLEQATLAGYDIPAQTTVMLNLWAIGRDPAFWTNPKEFNP 658

ERFLNKDITMFRRDFQLIPFSVGRRQCPGAGLGLAVVQLAVASLLHGFEWSTHNQKPE 832

EMDMREKPGLVTPRMTDLVVRVVPRLPLHVYHGRENGQQ*

 

>713808566 CYP76C like9 CYP761F1P 50% to 76C7 large deletion seen in 5 seqs.

Pseudogene finished

1003459573 816293569 no ESTs

METSQLSDYWAGSQLLGNSSFGPGVRVDSVSGSQY

FVVEFFLSAIVFTVFNLVFQRLHEPSLIPPRLSAWNFLCQT

HVLRRNPTVVLHNLVKRYGPVTHVKLWSQDLLVLSSVXAVEEFYKLHDMEFGDRPSSMN

RVTLSNSINSSCFPPLATYWKHLRFVLVSASTIPSFSSSFAFFRM

 

EWALEALHHHPSIVAQVSE

EVERSLGSRSHIEDSDLAKLPYLQAVVKELFRLYPPCAFSFPHESFDEYCHIFGYEVSPRTQVLINIY

TIQRDPAVWTNPNEFNPTRFITHPGIDMHGQHYQLLPFGGGR

QCPATKLAIRYVQSGLARYFHDARSSHMIPHSTCLEDDL*

 

>755830564 CYP76C like13 CYP761E1 complete 716051221 53% to 76C4 BJ975320.1 opp end = BJ966803 890572743

710522592 55% to 76C2 N-term 78% to 75B like 2

830395654 85% to 755830564 no other trace files match this

The best match is 755830564, probably the same sequence

MDFAKSTVARISFEGLKPEDGLSNQRVEIIVFLAAMFILPFVLLKLMRRP

KLKLPPSPPAYPIIGHLHLLGKLPHHSIANIAKTYGEIYSLRLGSVPAIVVTTPEMAKEFLLTHDKIWASRTVRD

VSGYYLSYNHTGIAFAPFTPVWRNLRKICTSELFTQKRMEASQGV

RDVEMQCMIRSILNDAN QRRLIDLKLEVNALTANVVTRMVLNKR

FMRCVDSTAEEESRAQQFKEIMKDHFTLQGIFMIGDYIPWLRPLDLGGK

EKRMKALRKRLDAFLNEILDDHEVKRAKGPIAEEDQDMIDVLLNEMHQQDPNEPHKMDLNNIKSTIL (0)

NMFAGGTDTATITIEWAMSELLRNPPIMAKLKAELDALIGQDRRVRETDVPNLPYLQAITKETF 372

RLHPAGPLLVPHESTHDCEVAGYRIPAGTRLFVNIYAIGRSSKAWDRPLEFDPE 210

RFMTGPDASVDTKGKHYRLLPFGTGRRGCPGMSLGLLLVQFTLAALVHALDWSLPPGMDPED

VDMTEACGLKVPREHALSLNAKPRAAAQFY*

 

 

>CYP81D like1 CYP761D1 762530079 756730662 36% to 75B1 complete

866056372 863085271 879876478 BJ164021 BJ199501 BJ605910

MASSSLDFPTFF (0)

IIGATVFAIFIFKKFLTKHSN

LPPGPIALPVIGSMHLLGTSPHHNLQKLSTKYGPLMSIRLGQAQCVVASS

TETAMEFLKNQDSNFTSRPALRVGEAVFYGQ (1)

DLVFQNSTPLWRHLKKIFQVEFTSTKRLDTTRHVREEEIAHLTSTLPHNCEV

NLRIHLKSMIGNIISRMAVGQRLCAKPEECESEEQLREVASLREVMDNVAFCIGAVNLAD

YIPALKWLDLQGLERRFKKTFQIMNSVSG

EIIAKHQERRKLSNPTDKQKDLIDVLLDDMEKPQDGSPRVTMDSIKAVTWNAFAGATDAI 525

AMSLEWAMSEILLHPHVQAKAHAELDVVVGKNRRVEESDIQNLSYIGAIIKETLRLHPV 348

APMLAPHAALNPCKAFGFDIPGGTWVIINAWAIARDPAVWKDPTEFNPDRFMQDDP 180

NALNPRVFEMLPFGAGKRMCPGVAMANVTMQRAIAKLLHEF

WGLTSELDMSEGTMSIVVPRAVPLHAVAKPRLSSEFYT*

 

>755808481 CYP761B1 39% to 93F1 complete 42% to 98A like1 no ESTs

1006224824 835905148 832116318 1006223877

MPFSGGQGTFMFQ (0)

GSAIAVVAIFLLARFITTPKNIPPGPFAWPIIGSLHLIGPYPHRSLAKLA

EKYGSLMSVWFGQRLIIFATSPETALEFVKTQDANFCSRPKQQAPSVLLPH (1)

DLTFSDVTSHSKLLRKIFQQQFTTSKKMEATQQLRANEFAHMLRTIPH

DTTVNVKFHLEVLAGNIFSQLVMSRRLLQPSSIEDTT

TDSTEKLKDLMKITADLDRIIGTFNPGDFIPAVKRFDLAGIGCKFKQFRNRMDSFVEKI

IQERLEERKSSRAPKELREKDYLDALLDEADQQKEIDLNVVKTMIW (0)

EIFAAGMETNIASSEWAMAELVNAPHTMKKAQAELDAVVGRDRMVKESDLPNLPYIKAIA

KESLRLHPPVPFLAHQCIKSCKAFGYDIKSGTSVFVNVYGLGRLESIYPDPNTFNPDRF

LPGGSNVGLDYQGQNFELLPFGSGRRICAGMPVASLMVQTAVATXLHAFTWIAP

KDHELMEGLGAASLSKAVPLKAHATPRLPSHVYSL*

 

>CYP98A like1 CYP761A1 692435809 36% to 98A3 815740002 815612579 complete

717626666 836312331 710501813 34% to 76C2  no ESTs

N-term exon is a best guess

MVPAGYGGVSEFPFL (0)

KFAVAVLGVYFVAVLIRGASRKLPPGPVGFPIIGSVHLLGPRSHVSLAQLARKYGAPLMSLYLGQ

KLFVVASSAEAAMEVLKKQDAVFCSRPPLRGFKVIFPH

DVTFADLTPESNYLRKF 964

IRLHLTTARSIEAFQHIRVDEMLQMVRSIVASPRDVVVNLRTSLEVMTANVLTRSIIGKR 784

FMGRTGLSESEKKEIMEFIHIAAEIGECLGAKNPGDLIPALKLVDWNGLDQRMKNLRR 610

KMATFLANIVRERREKSSLGTSNPPGKEMLGVLLDEMENAAAGEKITEDILNTIIW

ESFTAGMETTVLATDWTLAEVLRNPEVLQKCQAELDAVVGRNRRAQESDIPDLHYIKAVVKES 483

FRLHPVIPLLIPHYSHDPIKVLGYDIPAHTQLLINVWAIGRDPKVWADPLKFHPE 318

RFLEGPHRETEMFGKSFNLLPFGSGRRACMGITLGTLLVEASVVVLLHSFDWILP

AEGIDMTEGQGLSVRKNVPACAFATPRLPPHVYAE*

 

>BJ976918 mate = BJ968430 CYP78A27 BJ583325 686708553

47% to BJ601765 55% to 78A11

1023015550 828195390 complete

MDSTTCEVGGLWLFALPMLAKQGRSSLEEALGCTNFSSILCIVGVISACALLVCWASPGG

SSWGRLRCVKTIPGPRGFPVIGSLLEMGGLAHRRLAQLAVTYKATALMALSLGETRVVIASQPDTAREIL

HSTAFADRPLKQSAQQLLFGRAIGFAPYGGYWRNLRRIAANHLFAPKRIAAHGKTRLDEL

ALMLNAIQREVETTGHVLIRPHLQRASLNNIMGS

VFGRRYDFVLGSEEANELGALVKEGFELLGAFNLADHLPVLKCLDAQNILQRCAALVPRV

TAFVKKIIDEHRQRRDVRATTGESYEEDFVDVLLGLTGEEKLSEEDMIAVLW (0)

     EMIFRGTDTTAILTEWIMAEMVLNPEIQCNVQRELDSAFRKKNITDFTSLESELS

773  RLPYLQAVIKETLRLHPPGPLLSWARLSTQDVCIAGHLIPKHTTAMVNMWAITHDPKLWA  594

593  NPNEFIPERFLPSHGGQDVDVRGNDLRLAPFGAGRRVCPGRALGLATVQLWVAQLLYNFK  414

413  WTAVPGCDVDLTEILKLSSEMVKPLQSVATRRLVDPSS*

 

>BJ608079 CYP78A28 75% to BJ976918 993690276 1006187613 976463611

complete BJ591726 BJ594024 BJ594365 BJ609075 BJ169137 BJ591774

BJ602430 BJ589265 BJ590426

MDSAPTQVGGWWWFAVPLLAKQGRSSLEEAAGYTNLNGLVIMLVLGVISACAIFV

CWISPGGSSWGRLRGKRTIPGPRGFPIIGSLLDMGGLAHRRLAQLAVAYKAMPLMALSLG

ETRVVIASQPDTAREILHSAGFADRPLKQSADQLMFSRAIGFASHGKYWRSLRRIAANHL

FSPKRIAEHEDSRVAESEFMLQSIENDLLVLGSVQIRGHLQRASLNNIMRSVF

GRRYDFVTGSEEATQLRAMVDEGFDLLGAFNWADHLPALKFLD

AQKIHQRCADLVPRVRTFVQKIIDEHRNENNSRVGADERRETDFVDVLLSLKGDEQLAD

EDMIAVLW (0)

EMIFRGTDTTAILTEWIMAEMVLHPEIQRKVQFELDSVFPTGICNCASFENMLSRLPYLK

AVVKETLRLHPPGPLLSWARLSVQDVCVAGHTIPAGTTAMVNMWAITHDPEVWANPSVFS

PERFLPSHGGQDVDVRGNDLRLAPFGAGRRVCPGRALGLATVHLWVAQLLHNFEWTPAPVCEVDLTEVLK

LSSEMVNPLQSVATSRRVSTSG*

 

>BJ601765 mate = BJ204837 CYP78E1 47% to 78A9 48% to 78A4 pinus complete

BJ157387 mate = BJ165354

BJ163959 mate = BJ172406

BJ596508 mate = BJ192420

BJ164880 BJ605699 BJ604521 BJ595714 BJ601611 BJ602476 BJ582121

BJ604032 BJ603006

710548465 54% to 78A9

997125033 839338142 785867756 N-term is a little long

MAERPARLWPLTDFPIFISKGDIVCKDSCIGRFQKYQNVGRAVAKKFREFLSA

LTKSKACKPVNSVIKALAAPLILIAIAQEFSRDAVKQFLLDGFLTQPLRWLFQYISPFIQ

QVGTVDTATWTDVHASSILVFFIAAISLIISIVGWCGPGGPAWSFSRIFSPSNKLPTPNG

PRGCPVIGSWTLMQGSEMH

RELARQAWAGGPSTRNLMALSVGTTLIVLTSDANVAKEILRSAVFGERPLKQAALDLGFE

RAIGFALQGPYWRHLRKVAVTHMFSHRQIVTHSELLQRETLRMISAMVHSIRTDCVKDYR

VGLCARPFLQRAAVNNIMTIVFGRHFDFGNSCDEAEALEAMIREGFELLGGFNWADHL

PLVRHIPFLSFSRRCRNLTMKVRAFVQSILDERRRCHHQSHSATSSVLNTSFVDALLS

LEGDQKLQDEDIISILW (0)

EMVFRGTDTIAVLTEWALAEVILNQGIQARIHEELDAVVGSNRLVQQKDIENL

PYLQAVLKETLRSHPPGPLLSWARLANEDTQIAGCHIPRGTTTMVNMWAITHDSSVWPNP

EVFDPSRFLKSEGGSDLDVLGTDLRLAPFGSGRRVCPGRALGIATAQLWLASLLHHFS

WSQDLSHPIDLTDNLTLSCEMASPLHGCPTVRFPL*

 

>756810029 CYP758E3 complete very similar to 716896136 

785857816 891367041 713807864

BJ161247 BJ196384 BJ597499 BJ605004 BJ608968 BJ606559 BJ596753 BJ164688

BJ600017 BJ603952 BJ611104 BJ610779 BJ608982 BJ604440 BJ602128 BJ169200

BJ169747 BJ172828 BJ597344 BJ601461 BJ601840 BJ603729 BJ170550 BJ606471

BJ598898 BJ596900 BJ171346 BJ167714 BJ171954 BJ595739 BJ609360 BJ164548

BJ598653 BJ604317 BJ604410 BJ166119 BJ168281 BJ198054 BJ202791 BJ606440

BQ040942 BQ040447 AW496963 BJ156788

CYP98A like2 42% to 98A3

MNLDESLDGKLYGNGMVAAAGLLVVLTVVFFSSTVVGKKKTPPGPLPWPVVGNFLDLSVLPHRALRNLATKYGGFMYLRL ()

GSVPCVVISTAAVAREFVLKNDADTAGRPMVVALAILEEDKTVASANPGPYWSQLRKLCHDQLFSPKRVASYE

SVRTEEIHLMMKLLLKDSNKGDAVNVRRWLQGVTCNYVTRMLLGKR ()

YFGNDEGNLEQEQERKEFEKFYEHIFWALGTFIIDDYIPYLSFITTL

QGWIPRLKEIRQFSDDIGAKLADLDKHRQRAQDRKIGEDYVPDFVDVLLTAKMEDGKPLPDMNIKMILM (0)

DMLIAGIDTIANTVEWAMXELMKNPTLMKRAKDELDEVVGLN

RIVQEADIPNLPFLQAITKEALRMHPPAPLSLPHESTRPAEMFGYKLPAHTRVFYNLFAIHRDPAM

YEKPDEFNPQRFIDHPEISHLTGMDYYELIPFGAGRRMCPAFRLGNLMVSLILAHVLHSF

DWSFTEGESAETFDMSEEFKLTVSLKKPPSWIFKPRNPAFLY*

 

>716896136 CYP758E2 BJ191252.1  opp end = BJ610609 692435929 BJ196454

CYP98A like3 756802151 49% to 98A8 692435929

891396529 869807241 complete 39% to 92A9

MLAAGLLVAALTWIFYSNAGKRETKKPPGPRPWPVVGNLLNLSSLPHRSLRDLATKYGGFMYLRL ()

GSVPCVVISTAAAAREFVLKNDADTAGRPQVVALAILEEDKTVASANPGPYWNQLRKL

CHDQLFSPKRLASYENARTEEIHHMARLLREDAKRGEVIDVRRWLQGVTCNYVTRML LGKR  ()

YFGNGEESPEEKEEKQGFEKFYKRIFEAVGTFIIDDYVPYLSFITKL

QGWIPRLWDIRHFSDSISVKIADLDKHRQRALDRNRGEEYVPDFVDVLLTTKMENGEPLPDKNIKMVLM (0)

NMLIAGTDTMANTVEWAMAELMVNPLHMKRAKDELDNVVGTNRLVQESDIPNLPFLQAITK 581

EALRMHPPAPLSLPHESIRPAEIMGYKFPAHTRVFYNLFAIHRDPAMYEKPDEFNP 749

QRFIDHPEVNHLTGMDYYELIPFGAGRRMCPAYQLGNLMVSLMLAHVLHSFDWLFPEGESVQTFDMSE

EFKLTVALKNPPRWIFQPRNPAFLY*

 

>BJ977736.1 mate = BJ969431 CYP98A34 65% to 98A3 complete

BJ592471 mate = BJ185073 846061460 692508229 BJ579946 BJ580001 BJ586442

BJ587890 BJ589491

BJ594223.1 BJ583015 BJ174825 BJ579629 BJ587496

    MAVMWENTYTVAAIVAALLFMMYKSLRSSHKLPPGPRPLPVVGNLTHITPVRFK

1   CFMEWAQTYGSVLSVWMGPTLNVVVSSADAAKEMLKERDHALSSRPLTRAAARFSRNGQD 180

181 LIWADYGPHYVKVRKVCTLELFTFKRLESLKPVREDEVGAMVAALFKDCADSRPLN 348

349 LKKYVSAMAFNNITRIVFGKRFVDDKGNIDNQGVEFKEIVSQGMKLGASLKMSEHIPYLR 528

529 WMFPLQEEEFAKHGARRDNLTKAIMQEHRLQSQKNGPGHHFVDALLSMQKQYDLSETTI 705

706 IGLLWDMITAGMDTTAISVEWAIAELVRNPDVQVKAQQELDQVVGQDRVVTEADFSQLPYLQAVAK  674

673 EALRPHPPTPLMLPHKATETVKIGGYDVPKGTVVHCNVYAISRDPTVWEEPLRFRPERFL  494

493 EEDIDIKGHDYRLLPFGAGRRVCPGAQLGLNMVQLMLARLLHHFSWAPPPGVT

    PAAIDMTERPGVVTFMAAPLQVLATPRLRAALYKNGSSPS*

 

>715983616 CYP98A like6 CYP760A2 715970277 755678777 63% to 98A like5 complete

1020670982 715970660 762555758 33% to 75B1 34% TO 92A15 BJ604138

BJ175204 BJ595911

MESKIVPVTGSTLVCLAAALLFLVGMMRRCCFGEKSLPPGPTG

WPVVGSLYSLGPRNIPACRRFAALAAKYGALMFLRMGSRPTVVISDSTTAKEFFKSQDNN

FSSRPRLATGKHFGYDYSSVVFSSGEKFTEMRLIYSAELLSSTNVKKLAPVRMEEIRFLM

ADVLRRSESERLGDRPHATEGLINITSMVFKANLNLMGRIIFSQSLFGDSGTVNATPKEV

ENFKFFVKSATRLVGLFNVGDYIPALRWLDLQ (1)

GVEGDLQRLKPHQEGLLLPIIHQYRKMHHSAEGFSKQEDRRVDFIAALVAKYSTLSDENIMAVAI (0)

DLIVGGSDSASTAVEWGMTELLRHPHYLQEVQAELDAVVGRDRLVELSDCDKLPFLDCV 570

VRETLRLHPPSPLAIPHYSSQECTLGGCRIPAKTTAYVNIHAIHRDPKVYT 723

NPNEFQPKRFKTLPSMQVMAQNCESIPFSAGRRACPGQKFAFPTVMLMLGNLLQCF 891

SWSPPPGIRGEDIDVDEAPGVVCSRLKPLVASATPRVEKSVILDHK*

 

>CYP98A like5 CYP760A1 complete 755781297 755685424

815607281 836327020 BJ194280 870229681 37% to 756700900 39% to 92A9

very similar to BJ175204.1 but not identical

MEDNRMGDGQVEEYSSRVMHLSALTLCAAMAVILLRRVMXSWNADKT

LPPGPKGWPIVGSLYSLGPRTIPACRR

FTTLADKYGPVMFFRLGSRPTVIVSNDKMARELLRVHDQTFASRPKLATGKHFGYNYSSV 560

VFSPSGAHFVRMKKIYTHELLSPKKVELLSALRMEEAHILLVDVLRNSGTEA 404

NGVVNITSLVFKANLNLMGRIVFSKRLFGESATISAPPREVENFKFFVKSATKLVGL 224

FNIGDYIPALRWLDLQ (1)

GVEGALLQLKPHQEGLLRPIIQEYRKMSLNLEGGMKQKEDGRVDFIAALVSNDSGLSDENIMAVAI (0)

DVMVGGSDSTSTAVEWSITELLRHPDCLQAAQEELDSVVGRDRLVEEADCANLPFLNCIVK 544

ETLRLHPPSPLAIPHFSAEECTLGGYRIPANTTAYVNIYAIGRDAATWEN 394

PNRFNPTRFKDSKVNVYGHDFNLLPFSSGRRGCPGVHFALPTYKLELANLLHCFKWS 223

PPPGVDFKDIDTKEAVGVVCSRLNPLMASVTPRIPRHVILAK*

 

>713858245 CYP703B2 715976935 46% to 703A2 complete 83% to BJ976025

711802793 978013669 CYP703 like1

993680425

    MDFRISELLIPAISEPVESGHLAFATCTVLVTLLSCVFLFIRSGTSVNLPPGPKGLPIL

283 GNLLQMGSHPHRTMTALHKVYGHILNIRLGCIPTVVVDSPQLIAEITKEQDNVFSSRPHM 462

463 TFTEILAYDAHDFAMAPYGPHWRHVRRICVHELLTPKRLENTRKERIEESRCMIMEVAE 639

640 RANKGEVVDLRDVLAGVSMTVMCRMLLGRREFAATGKQPKDFKHIIHELFRLMGALNPRD 819

820 FVPALGWLDLQGFERDMYK (0) 876

LRGEFDEVLDAIIQEHRDLESGKLPGGKKNDFISVLLDLPGEDGAPHLDDKTIKAVTI

DMMAGATDTSAVTNEWAMAEIIRNPQIQRKLQEEIDSVVGLERNVEESDVSNFPYLMCVVKETFRLH 494

PAGPFAIPRESMADTTLNGYL

IPKGTRVLINIYSLGRSSETWVDPLIFQPERWANENLTAIHDSGFRILPFGNGRRQCPGY

NLGTTMVLFTLARLLHGFNWSFPPGVTSDSIDMEELYGCTTPLRTRLRAIATPRLAPHLY

SQ*

 

>BJ976025 mate = BJ967509 CYP703B1 complete 43% to 703A3 45% to 703A2

820975853 884956080 833255812 BJ591871

MNILSPELLVPLITEWIQGGRLIFATCSVLVALLSSVF

LVAHFRTPMNLPPGPKAMPLLGNLLQMGSHPHRTMTAMHKKYGHILYIRLGCIPTVVVDS

PQLIAEITKEQDNVFSSRPHMTFTDIVAYDAHDFAMAPYGPHWRYVRRICVHELLTPKRL

EITMKERIEESRCMIMAVAEAAQKGEIVDMRDVFAGVSMTVMCRMLLGRREFAATGKKAK

DFKHLIHELFRLMGALNLRDFVPALGWLDLQGFERDMYK (0)

LRDEFDEVFDAVIQEHRDLASGKLPGGKPNDFISVLLDLPGENGAPHLDDKTIKAITP (0)

DMMAGATDTSAVTNEWAMAEIIRNTEIQRKLQEEIDSVVGLERNVQESDIN

KLPYLMCVVKETFRLHPAGPFAIPR

ETMADTKLSGYRIPKGTRVLINIFSLGRSSETWKDPLKFQPERWANENLSAIHDMGFRIL

PFGYGRRQCPGYNLGTTMVLLTLARLLHGFKWSFPPGVTAENIDMEELYGCTTPLRTRLR

TIATPRLAPHLYSQ*

 

>815536265 CYP703B3 869926625 831646057 833253850 73% to BJ976025 45% to 703A2

complete

MDTLVSLELFGGVVWNWVQESRLLMTTCSVLVALVSSVFLFSRFRKPLQLPPGPKGLP

FVGNLLQLGSLPHKTVTELHKKYGHLVYLRLGSVQTIVMDSPELFREITREQDNVFSSRP

HLTFTELVAYDAHDFAMAPYGPHWRHVRKICVHELLTNKRLESTAGERKEEWRCM

VKAILEAANSGDVVDMRDVFAGVSMTVMCRMLLGTRDFSAREDNP

RDFKHLIHELFRLMGVLNLRDFVPALGWLDLQGFERDMRK (0)

LRREFDEVFDAVIQEHRDLASGKLPGGKPNDFISVLLDLPGENGEPHLDEKTIKALLQ (0)

DMLAGATDTSAVTNEWAMAEIIRNQEIQRKLQNELDSVVGRDRNVQESDLPNMPYLM 450

CITKETFRLHPAGPFGIPRETMADTKLNGYHVPKGTRVLMNFYSLGRNPEIWADPLEFK 273

PERWERENLAQVQDPEFRIFHFGNGRRQCPGYILGSSMVLSTLATLYHGFNWSLPPDV

ARIDMDEAFGCTLPMRTRLRAVATPRLPPYLYA*

 

>756814065 CYP761F2P 755834403 835931597 46% to 75B1 47% to BJ977736

stop codon seen in 12 sequences pseudogene finished

464 DIITAGTNSTIEVVEWAITECIHNPAVMSKA*AELHRVVGKSLRVHEAEIPNLLYLQAIC 643

644 KEVFCLHPTTPLLYPHVNQHACTVFGYDILAGTSMLVNVGAIVQDPSIWEDPLVFKPERF

LERHSHLDAQGHHIELLQFGTGWPQCPGIGLSLTMVYILTATLLHCFEWSLPQDCTETEAPLSG*

 

>710491797 CYP755A1 692498994 835920053 32% to 75B1, 33% to 92A11 complete

1009323251 711801827 BU052572 AW699134 BI741530 BI488241

MVFTVRREVADWSHSFPPMSY

GTAVVVGFVLLLLLLVFGYSRRVGKKKTLPPGPFAFPVIGNLFLVGKHPHVTFAKLAKQY

GNIMRLHFGAVPVVIVSDANMARELFSVQDMKFASRPIYDLMSTAYKYMNYG

TDEEVSLAISEYGPKVRDLRQLCTTELFTQRKIDMKKSVRAEEIQRMFGKIKTMIRDEEP

VEIRPIVSEFSLRISCRTTFNKAFLNFENLPWRPGALHPQAFRNMETENTKLLGEHQILD 594

MIPMLKFVLERFDVFGINARWKEVSALKEECTRPVIEWYRKHSSDDESTLDFVEVLL 423

RLSEEGKLSKTCVKSLIL (0)

ELLTAGSDTIASVLEWTLLELVRHPHGMERLSAEIDGFFGINRPVDEDEFTKLPYLQ (0)

AVAKEVLRLHNPTTLGIPHSNMEEATLAGYHLPARTTV

LANFWAISRDPTTWGQDALTFNPDRFLACDLNVNGTNYEYLPFGAGR (2?)

RICPGRAVAMRVLAAAIGSFVHAFEWSALPGVELNANEGKDGLNIR

PETPLVLKLSPRPSAMLY*

 

>BJ969539 CYP761C1 884947623 890251096 863048229 839338572 692475254 complete

N-term exon is a best guess 41% to 75B6, 43% to 75B9

MAAFAVPTLKN (0)

VYYVATVLVVILLVRRLLTWPHQ

PPGPPGLPLVGHMHFLGANPHISLWKLADKYGPLMSLRLGNKPYVVATSPETAKEFLKT

LDANFGSRHYSSQSQYLLYGGQ  (1)

DVAFQESSPSWRNLKKIFTMELASPARLEASRHIREEE

MIVLLRTIHSKGELELKSQLIDMISHVISRMVINKRFDDSVESDFPTLVQT

HFRLAGAFVPGDYIPAVKWLDLGGFEAQMKKQKERMDAFIDDILVQHRERRAKGPVPMKEY

DMVHVLLDRIETKDDQIQLTDTHVKALVL (0)

DAFLGASETIILTSEWAMAELLRHPSLMAKAQAELDAVVGRDRMVTE

SDLRHLTYLNTIIKETFRLHPAAALLLPRESAQPSQAFGYNFPAKTRV

LINCYAIHRDPAIWHDPLVFNPDRFLQADLKDVDV

KGRHFQLLPFGAGRRVCPGLSMGILTVQFILASLLHSFDWSLPGDMKPEDVDMTEIYGLT

LPRAAPLPCAAKLRLPSHLLTTAQKP*

 

>DR061629.1  iq01h03.g1 Cycas sporophyll (w/o ovule) (NYBG) Cycas rumphii

66% to 75A1, 53% to 75A11

N-term only

METREWIVWGITWAVLYVGVGYIINNSRKSRR

LPPGPKGWPLLGSLPLLGAMP

HVSLYNLSKKYGPILYLKLGTSGMVVASSPETAKAFLKTLDTNFSNRPGNAGATYLAYEA

NDMVFAPYGPRWKMLRKVCNLHLLGGKALDDWQPVREAEMSHMLRSILHHSNRSQPVNLP

EMLNYSMANMLGQIILSKRVFESHG

 

>692448354 CYP752A1 993458568 1028576144 816256171 839352528 see

872833037 26%  to 755686556 complete very low similarity to other P450s

MEKDDDVSFDVALPTIGLETTHSKFPQLVLSAIGLIVVCGGAYVLYNTHYLRVKIKL

PPGPPPWNVFCTSMQSKKPCQALAKICNCEYGGIMTLSLGKFPTILITSTVIATQLH

VLKRYKFKFGHPKNIPRPCEYLHPD

NYQNLKCVLPYNWTQWHKLWQIYIDHLLPVAHNMSFQSINQLDIQIMLKNLENEMTKEGGMKPFGIGLRPHLR

HASFKFIFNICFGRHVDAIAGGVGSHKDPLMMQLEALFIEVIRLGPAFIISDFVPTSLPFH

SPIDIQRAAISGTMKKYKTFYH (0?)

RANIKVPRSEPVDLLDHLVCLQKDEQLQDKEIVWLLSELILAS

TDHVSTILEWTFAHLMANPQVQAKLHQEIDIVCSKRTN (0)

ISTTEFDNMPYLVAIVKESMRVSSPIMLTIPHSTTKELNIGGFQLPMNTQIVCHLGALGQ

DANIYENPSCFDPNRFIGIGVNLNNAFEKQKNIVHLMTQQFCPGRGLEILHVYIF

LVKLLQCFEFSHLYVEIMPFKTSDTVEWGVINVLRKPLVACLNPHL*

 

>692452215 CYP758E5P 30% to 75B1 N-term frameshifted in five different sequences

near KYG region

1006070983 862348410 probable pseudogene finished

686729933 80% to 692452215

note, there is no eact match to this seq in the trace archive

This is probably a poor quality version of 692452215

755690091 CYP81F like2 49% to 81F1, 4 aa  diffs to 692452215

no exact matches in trace archive best matches =  692452215

MDFKSLQSCSNRLQQQDGGLHSTSTILVTAIATIAVLYVAMVYQRRKKLPPGPWPWPIVG

NLPLLLGSQKP (frameshift) SLRKLALKYGGLMY (bad boundary)

VQAGQKPCLVVSTAAAAKEIFRKHDATFASRPPTL

AFNILTAGAYRNLGYAPYGPFWRRLRRIANTQLFSPAVHASHEPIRRKEIHYMLKVLVED

SHKGKPIHLKSWLTSVTANNMTMMLSNKRIFEMGVDNDEKKRDFDEMLRRTFVVNGDFMI

CDYVPYLSFVTKLQGWVSEMQGLRALGASLVGNIF QVDEHRERAQKMYPSDTDYVPDYID

VLLXTSLDDGDRLPDRDIVSL (0)

GLLNAGTDASANTVEWAMAELMANPDIRKKAQAELDAVVQDRLVQESDIPNLPF 395

LQAIVKENYRMHPSAPLSVRHESHESCVISGCEFPAHTELIVNIFAIHRDPSVYENPDKF 575

DPTRFVRSPEVDPVAGNDFYQLMPFGAGRRMCPEQQLGNTMVTSMLANLLQCFEWETATS 755

ERESGGGEGDAVVVDMVDYYSFMSFRQKPLCLLAKPRPLASLLLQASP*

 

>815871008 CYP758E6P 993522654 77% to 692452215 pseudogene finished

755690091 extends downstream, deletion before DRDIVSL

MDLKSSQPCSHWLQHQAGGIPSTSAIL

VTAVATIAVLYVAMVYQS*KKLPPGPWPWPIVGNLPLLLGSQKPKSLRKLTLEYGGLMHFQLG

VQAGQKPCLVVLTASVAKEI

FRKHDATFASRPPCRVFNILSEGTYRNMGYAPCGPFWHRLKRIVTTQLFSPAVYASHEPI RRKEIHYMLKVLVEDSHKGKPIYLKS*LISVTANIMTMMLSNRRIFEIGADDDE*KMQLEELMYRT

FDSFASIIISDYVPYLSFVTKLQGWVSRIQGFRKSGESLIGNIFLDD

DRDIVSL (0)

GLLNAGTDASANTVEWAMAELMANPDIRKKAQAELDAVVQDRLVQESDIPNLPFLQAIVK

ENYRMHPSAPLSVRHESHEPCVISGCEFPALTELIMNIFAIHRDPSVYENPDKFDPTRFV

RSPEVDPVAGNDFYQLMRFGAGRRMCPGQQLGNTMVTSMLANLL

QCFEWETATSERESGGGGGDEVGVDIA

NHYSFINYRQKPLYLLTKPPRLASLL

SQR*P*

 

>755686556 CYP98 like CYP758E1 39% to 98A9 complete

863152685 876249180 815631660 BJ189287 BJ196404 BJ598039 BJ599425

BJ608223 710522627 54% to 692452215 BJ594604 BJ194881 BJ201010

BJ198114

MASAHSHTRRWWSQEAHGIRVSGEGTIATLLISSLVIYVTVVYQRRKKLPPGPWPWPVVGNL

AVLAGLPHRNLQNLAAKYGGLMYLQL (1)

GQVPCLVVSTAAAAKELFRTHDVIFSYRPKRLDHEIISGKSYKSLTSAPYGPYWRQIRRIC

NTELFSPAIHASHVSVRSEEIHSMMKVLLAESRTEKAIDLKSWLTGVTANNMTRMLINKR (2)

FFGTGVSDQQEKKDFEEIFDHIFAAAGTFFISDFIPKLRFVEMLQGKIAKLTAFRK

FLHSVIGKIFEVEKHRQRALERGNDPIYVPDFVDVLLNTPLDNGERLTDREIISILS (0)

SMIGAGTDTTATTVVWAMSELMVNPKIRKQAQEELDAVVGDSRLVEESDIPNLPFLRTIV

KETFRLHAPVPLSLPRCSEQPCEVAGSQFPANTRLILNVFAIHRDPIVYENPDSFQPSRF

VDHPEVDHMSGKDFYGLIPFGAGRRMCPGYHLGNVMVSLMLAHLLHSFDWRLPAGVTEEN

LDMSETYKLVGLRKKPLFLIAKPRSPAYLY*

 

>689472293 CYP758D1 692450239 BJ166421 36% to 92A14 52% to 755686556

863148306 1020712813 997099744 complete

MGFVEMTQNWRLWLQEGSNVSVYGTVLFVMFTTSCILHVLSAIE

RRKKLPPGPWPWPFIGNLGVVLRKTGARHKFLQALGAKYGGLMYLGL (1)

GQIPCLVVSSVRVVESMFKSHDATFSDRLQTYFRKVQYGDSAMRSLSSAGYGSYWRQVRRMCNT

ELFSPGTHASQEGVRREEIQNMLDVLVHECKRRKPIDLGDWLFGVSTNNMTRMLINKR (2)

YYGTGAEIPEKKEEFQGMVKSRTRAAGTFVISDFIPSLTFIAKLQGLPKRFRESH

ESAKAQMESVLDVEEHRKNAIARASVDIKSEYSPDFVDVLLKAPLDDGQPLADSDIKFLLT (0)

DLMIAGTETTGITVEWAMVELMLRPELRKQAQEEIDAVVGADPER

FVQESDIQKLPFLVAILKETFRVHPVAPLNVMRSSYEPCEFAGYYLPAQTRLIVNQYAIH

RDPSVYENPDKFEPRRFMENPEVNPLSGRDSYQLIPFGVGRRMCPASNLAFTMALLMLAN

LLHTFDWSFPDGVTADNFDVSEEFLGTVLRKKTPTILMAKPRSHVQ*

 

>762521418 CYP758E4P N-term 828262863 755809804 816388645 862850609

pseudogene stop codon seen in 9 seqs., 27 aa deletion finished

MDLKNSQSCTEWVQRQIGVQLTWAILVTAVATIVVLYVAVVYQRRKKLPPGPWPWPIV

GNLPVVFGSQKHKLAHKYGGLMI (2)

VQPGQKPCLVVWTAAAAKEIFRKHDATFASRPSMLIFYILTGGRYRNLGFA

PYGPFWRRFRRIANTQLFSPAVHASHEPIREREIHSMLRVLLEDSYKGKPINIKSWLTSV

TANNMTMMLTNKRIFEIGADNDEKKRDLEDLMRRTFALM*SFIISDYVPW

27 aa deletion

GKNFQVDEHRKRAKEMDRNDTEMPDDIDVLLNTSLDDGDWLADRDIASL

GLMNAGTDTSANTVEWGMAELMANPEIRKQAQAELDAVVQDRLVKESDIPNLPF

LQAIVKETYRMHPSVPLSQRHESHQPCVISGWEFPALTELILNLYAIHRDPSVYENPDKF

DPSRFTRNPKVDPLAGNDFYELIPFGAGRRMCAGHHLGNVTVTSMLANLL

 

>686716102 CYP761E3P 713851494 38% to 705A3 stop codons seen in at least 5 seqs

pseudogene finished

VFNIHKVKEIEGPILDKHQAFIDIFLNKMY*QDSNET

YQILTSPSLPCAQNLLVGDIY

451 TSMVTIKWAMFEMLQNSTIKAKLKAKLDTHI*KDKQLSKTNLPNLTHLQAITKETCLHS 275

274 MEHLLIPKQNKLELKI 227

 

>BJ976877 CYP753A1 BJ975911 BJ964760 BJ968388 BJ971180 BJ967389 BJ973295

BJ962654 824724989 830915456 31% to 77A3 complete

Similar to 77 and 89 families

MANYIIASNALVLLAFVTFFFVYFLRAFI

LRDKKLRPKYPPSPWKWPILGNLPQLLRGGPACHTTFRLLAKELGPVYNVWLGGSFPMVI

VTGEETVHEALIKQSSVFSSRPKLLSWQHISAGFKTTMTSPFGPHWQKLRKT

ISVDLLGPSKLASYKPIRDSEIQKLLARLREQA

HANAGLVSPLDQLRTSAVDVIMRIGFGEEFALMEAVNSNRRHAKIVELDRCF

RQLMDAGSIFQLVIDSSVVARTLLFPLARSANRNIE

TVADNTVSLVMPIVQQRKRYLQDHPATETRTFVDALISCKGESALTDLEIVW

NVVELMVGGTDNTSHILEWALANMVKYPHIQEKVYTEVRCAMGPNLERRLVEESELDKLPYLQAVVK

ESMRRHMMTPLAIPKLAAQDCKLSGYDIPKGTMVVFHAGALAMDDDIWTDPLNFRPERFL

AGTGSSNAPVTQTHKHAFMPFGAGRRSCPGAAMGFLHLHHLFANLIYAFEWGPESPRKAV

DFTEKFRMVVTMKNPLRATIKERTHFRMM*

 

>713878499 CYP753A2 716050461 716050845 716050461 710547221 complete

859967265 33% to 71P1 32% to 98A3 857998092 No ESTs

1003442146 61% to BJ976877

MEADHNRASDSLLILCVVTFLSMTLLLGYLGNVLGKEIKPKLPPSPPQWPVLGNLPHIMRKSAAL

HTTLRLLGKKLGPIYTLWLGRSFPLVIVTGEETAREAFVDQGHIFSARPTLISWQYISSG 619

YRTTMTTPAGAHWQKLRKIISHHLISPTNLARYIPVRDSEIQKLLERFRDQSRENEGVV 442

HPLQQLRISAVDIIMRIAFGDEFATLDNEGRKGNAVVLDRLFQEIMDAGSIFQIALDSSP 262

LTRTLLFSASRKCYSNIRTIAGQITDLVMPIVMERKRLLKERPLTEVKTFVDSLIMLKG 85

DDALTDMEIVWVVELMVGATDNTSHILEWIFANMITYPHVQQKAYEEVKRAMGPNLDRGLVQENHI

PNLPYIQAIVKESMRRHMMAVLAIPRIASRDCKLRGYDIPKGT

MVVLHAGALALNEEIWSDPLEFRPERFL NLDNEATHMHKMAFLPFGVGRRSCPGASMGLLHLHMLLANLIYRFEWGPE

SPGQAVDFSEKFRMVVTMKSRLRATITERSPV*

 

>686737904 CYP757A1 change to 758G1 36% to 92A9 36% to 703A2 no ESTs complete

815805623 856865465 857893627 39% to 755686556

MGALDHSNDMWLQILLALTLVSVVLTWILQCSSSAQKVHPPGPTPWP (1)

VIGNLFLFFRAPL

PHRMLHNLAEKYGDLMYLRLGFTPCIVVSSPALADYIHKNHDTEFSSRPDGLITGILNGD

SQSVSMAKHGDLWKTLRSICWQILRPANIARYETRRMEEINIMLQSIQIAAEAGETVD

LSSMLYKLSSNSMTQMLINRR (2)

YFTAGGNEENLREAVIF

KKMISERLKIASQFAIGDYIPYLRFIDYLFRYNAKAQEIQSMTMRVCDEIMNLEERRRRLTREENGDAQAVREEDFVDDLLSIQAEYTADNSRKIKLTDHQIKLLVQ (0)

DMLVAGTETSATTVDWAMAELLCHPKVLQQLRSEIVTVVGSRSAVTE

QDTKQMPYLNAVVMETLRLHPAAPLNLPRESKGACLFLGRYQLPAKTRVIFNTHSIHRSL

EAYDSPNAFKPERFLGVPQANVSGSSFFQLSPFGFGKRVCPGQALGTISVCAALANLVHR

FAWSLPCGLPPSHLDMIESFGLTAPRRCPLILLPTPRLKV*

 

>710925967 CYP758B2P 50% to 71A25 heme stop codon and frameshift seen in 5 seqs.

Pseudogene finished 61% to CYP758B1

GRRICPGMSLAAINAPPILAHRVHSFD*RLTETLVN

RNPRELDMTEKSDSVMASRLYPLLIIAQPRKPAFLYYPKEA*

 

>755729305 CYP701B1 717596741 40% to 701A3 43% to 701A7 complete no ESTs

44% to 701A10, 43% to 701A5

755836365 970783504 828200861 yellow region uncertain

830512365 85% to 755729305 only seq in trace archive

closest match =  848389444 = 755729305

This is probably a poor seq version of 755729305

MLNESTSGHSSDTCVQTSLGCRDGKRRLNEMLETKVIAHHVSHSPCAAIPGGLPVL

GNLLQLTEKKPHRTFTAWSKEHGPIFTIKVGSVPQAVVNNSEIAKEVLVTKFASISKRQM

PMALRVLTRDKTMVAMSDYGEEHRMLKKLVMTNLLGPTQVHDHR

VQQNPPCLKMCHVYASHSKGTPEEKIVCSPAFYRRISPSGMEFGCAEQKPI (0)

VEVLELGTCVSTWDMFDALVVAPLSAVINVDWRDFFPALRWIPNRSVEDL

VRTVDFKRNSIMKGLIRAQRMRLANLK (0)

EPPRCYADIALTEATHLTEKQLEMSLWEPIIESADTTLVTSEWAMYEIAKNPDCQDRLYR

EIVSVAGTERMVTEDDLPNMPYLGAIIKETLRKYTPVPLIPSRFVEEDITLGGYDIPK

GYQILVNLFAIANDPAVWSNPEKWDPERMLANKKVDMGFRDFSLMPFGAGKRMCAGITQ (0)

AMFIIPMNVAALVQHCEWRLSPQEISNINNKIEDVVYLTTHKLSPLSCEATPRISHRLP*

 

>759473441 CYP761E4P 38% to 76C1 N-term pseudogene seen in 6 sequences finished

KQENGIGSSVRFLATRFCSQIMF*SQFVLHIIWHCRKLPPAPPEWPLI

GHLHLLGTHAHQSMAELAAK*QGILHLKFGLKGGVVVSIEAMSREIFKKHDLALSQR

 

CYP72 Clan sequences (4 complete sequences, 1 finished pseudogene)

 

>DR578536 Picea glauca N-term half CYP72 clan seq.

MKIIWVGLAIASGYLVAPRVKQLWVDWIWTPNCLVQCCKRQGIPGFSHHEILKVLQL

RSMDTGQSWTILNSLRNHGMIFYTRVGKFVRLCVADPVFVRQILIDNAACYEKPSFIRSL

SAIGDGIFSAAGKDWFHQRQIFQPRFLSKEIKRKLELIKEAAIEALYDCEQNLQFNNEK

EIDIYQKFLELTLNSFGKFTFGSDLRSPMGEIFRSFDRYLYNNRKRMFGLASRLPGLLSLP

TSVNQEIKEDEYRLKMIAVDLLEKETTRQHFETDEEESLLALML

  1 tttttttttt tttttgcaat ttgcgatgat gctactccga attagatttt tgtcatgaag

 61 ataatctggg taggattagc gattgcatcg ggatatctgg tggcaccaag agttaagcaa

121 ttgtgggttg attggatttg gacacccaat tgtctagtcc agtgctgtaa gagacaaggc

181 attcctggtt tttctcacca tgaaattctc aaggtcttgc aattgagaag tatggatact

241 ggacaaagtt ggactatctt gaatagtcta agaaaccatg gaatgatctt ctacactagg

301 gttgggaagt ttgtcaggtt atgtgttgca gatcctgttt ttgttcgcca aatcctaatt

361 gataatgcag cttgttatga gaaaccatca tttattcgtt cattgtcagc tattggtgat

421 ggcatatttt cagctgctgg aaaagattgg tttcatcaac gacaaatatt tcaacctcgt

481 ttcctttcta aggaaatcaa gaggaagctg gagctgataa aggaagctgc aattgaggct

541 ttgtatgatt gcgaacagaa tttacagttc aacaacgaga aagaaataga tatttatcaa

601 aaatttctgg agttaacatt gaacagcttt ggaaagttca cttttggtag tgatttaaga

661 agcccgatgg gtgagatctt tcgtagcttt gatcgctatc tttataacaa cagaaaacgc

721 atgtttggac ttgcttcccg attacctggg ttgctgtcac tgccaacaag tgtcaaccag

781 gagatcaagg aagatgaata ccgacttaaa atgattgcag tggacctttt ggaaaaggaa

841 acgacccgtc aacattttga aacagatgag gaggaaagtt tgcttgcctt aatgctt

 

>686708190 CYP766A1 711871885 36% to 735A4 in CYP72 clan complete  44% to 715970850

BJ596980 mate = BJ193144

BJ601506 mate = BJ204578

BJ168764  825662336 936994386 1017450974 692499678

MMVEYSQSWTALAVVELSVVAITAVFVPLWNVCSTFLLEPLRLRRVMGKQDVRLAPFNLVFGNA

FEIGAHAQSFPETLPLKFDDLEPTATPQFDLYFSKY (1)

GKRFLYHVGSETRLVVRDPEMAKEVLFNRMGWYERSPLDL

HIFSQVIGKGMFVVKGEEWEMQRRMLNPCFSNESLK (0)

PMVERMVKSAAQEMRNWEEMAAQAGGRVEHDVEHDIHIIA

YNIISYTAFNEGFDKGKQIYLMIYLMQDEIMGHLFAAGNPSFWIPGLR (2)

VLAGLLPTKHATAIAQLNGRTEKLIMELVKDRREAVQKGERDSYGDDLLGRMLTATERTDG

SSHKFILDAVINNCKNFFFAGSDSAANLTTFSLLMLANY

PEWQDRARKEVLEVFGDNDPCEMNDISRLKI (0)

VGMISQEIARIFAVSPSIARLAVKDCELGDLLIPKGLVIEIATLAMHRDPELWGKDVAEFRP

ERFANGASAACTHHQAFLPFGAGPRSCIAEKISWLEVKVVLCMILRRFRILPSPKYK

HHPHFAMVNRPKYGLPLILEILPQSRSDSIMAEI*

 

>DR013841.1 Pinus taeda

EYTELIREALAQPMHNISHDIVPRITPQYHKWCQLYGETFFYWYGTHPRLYISEPELIKE

VLSNKFGYYGKETPRPFVLALLGRGLIFVDRLGWVKHRRIVGPVFNVDKLKPMVKKMAAC

TSSMLENWQEMMSQADSNGKEIDVHSEFRTLTADIIAHTAFSSSYNEGKEVFELQRELQA

MVAEAERSVYIPGSQSIPTRRNRYAWKIDRRIKEILNSIIQSRLESRTTSRTQVGYGSDL

LGIMMTANQKELGGSQRDLSMTIDEIMDECKTF

 

>715970850 CYP766C1 755717789 755842297 710486501 755717789 44% to 714A2

890572813 832104723 complete 44% to 686708190 no ESTs

MVFTQWVRFAALAIPEDVRN

ALGVVLLAFVASAIVRVVFSLVKTYLYDPLSIGRIMAKQGIEGPPFHPIFGTTAELNAY

VKSVPESLPLDEDHDSMRTVSPHFHMYFPKF (1)

GKRFLYWRGPHAKLVSKDPGLAKEVLLSQYEFFQRHPQDIKMLSNFVGMGLDNLTGEKWA

IERRTLNPFFYHDPLK (0)

GMVEGMVKGAEPVLKSWEEEVARAGGTAEFNLEEDLHTISGNIIAHTAFGT

DHEKAKEIYQTQREYVNLLFQNLHSGWYWIPGFT (2)

YLPTQTNVTMARLRSTIDSSLHELITERRKAAERGDTASYGNDLLGIMLAAASNST

DETATEFNLASVFNNAKLFFFAGQDTVATVLTFTLLQLARYPEWQDRARQEVLEEVGE

TEAYDSTTLNRLKI (0)

VGMIVNETMRLFPAVISVSKVATKDMQINELFIPKGLTVEIPIVSYNQDPEIWGDDAHKFKP

DRFEHGVSKACKHPRAFLPFSMGPKMCIGKEFALMELKLVVAMVLRRFLSVSPHYK

HHPYSSLLTRPKYGMKLIFSSRQASKLEH*

 

>BJ196684 CYP766B1 complete

BQ827188 mate pair = BU052459 816039785 883669031 755835841

33% to 709B2

    METVPVNVRNALAVVVASVIVYSVIKFLRVSVWQPLRLRRIMAKQGVSGPPF 168

169 RFVRGQFVEMWKFTESFPDALPIDDFANLTPTVTPQNALYYPKYGKIYLYWWGTITRLAV 348

349 RDPKIVKELMVSNHESLTRLQSESQFLAEVVGKGLLTQVGEKWASERRTLGPFFHQKSLE (0)

GMVGAIMEGAATELQKWEQEVEERGGTAELDVEPDLHKISGRIISRTAFGDEFEIGEQIF

KFQTLLSQELLKGFRSTAYWLVPGYR (2)

NLPTKRNRSMNLYGSQVDALVRGIINARREAVQKGVTSSYGDDLLGRMLTAATEGWSANTKEFNQL

AVFNICKFFYFAGQDTVANAIGFMILMLALYPEWQDRCRQEVTEILGDEQDWRASDISRL

KVVGMVFNETLRIFPPASTLTRVAAKDLQLEGLFIPKGMAIEFSLAAMHQDKDYWGDDVGKF

NPERFVNGAASACTHPQAFSPFGLGPKFCIGNNFAVMEAKIVLA

MMLRRFQLVLSPNYKHHPTSIMVQSPKFGLPIILKALKIT*

 

>857906422 CYP766B2P 857979019 80% to BJ196684, pseudogene finished

defective at EXXR and PERF motifs

1029015881 goes upstream

982645139 goes upstream

1036166944 goes upstream

756808170 goes upstream

MEAVSVNVRNAVAVVVASVIVYSVIKFLRDSVWEPLRLSRIMAKQGVSGPPFRFLLGQYMEMVK

FTESFPDVMPINDFANMSPTVTPQNALYYLKY (1?)

GKMYLYWWGTMTRLAVGDPKFVKELLITNHDSLTRSRIENQFVAEVVGKGLLSQEGEKWT

SERRTLGPFFHQKSLE ()

GMVGAMVEGAATELQKWEQEVEKRGGTAELDVEPDLQKISRRIISCTAFGDDFE

IGEQICKRQILHSNELWKTFRSAAYWLVPSYR ()

NLPTKGNRSMNLYGSQVDALVRGLINARREAVQKGVTSSYGDDLLGWMLTVATEGWSAN

TKEFNQLSVINNCKLFYFAGQDTVAKAIVFTVLMLALHPEWQDRCR

 25 QEVTEILGDEQDWRACDISHLNV (0) 96

195 VGMVLN*SMRLFPTAFQLTREVVKDLQLEGLFIPKGMHIEFSVMAMHQDKDLWGDDVGNEIC

    NGVASACTHPQAFNPFGLGPKYCIGNNFAVMEAKIVIAMILRRFQLVYSPNYRHHPT 552

553 VTMLQEPKFGMPIILKALKIN* 618

 

>BJ581794 mate = BJ176571 CYP765A1 (N-term), BJ611461 mate = BJ192135 untranslated 5 prime end

 BJ585659 mate = BJ180400 (N-term)

759450777 850637393 876269284 830401001 complete

Extend upstream with 860052391

Extend downstream with 756812101

Extend downstream with 832110254

Extend downstream with 830750922

32% to 734A1 31% to 72A7, 31% to 709E1 (72 clan), intron boundaries not very certain

green and cyan supported by ESTs from moss, grey supported by ESTs from Picea, Pinus

MPLAVAILYAANKLALAPALLHTMTIITILTWILGGALTLGLGFIVKEWLWNPLMLIEL

CKRQGIKGFPFVPFVGQMPAIDE (0?)

VLSGRNRRVQKQDNDEVEDEDRLTAVTNCYRNH

GSTFYFTVGRTVRLSIADPPLIKDILIANSESYSKPLHIRKLGVLGDGIFASSGSTWSP

QRSLFTGAFHTKEVK (0?)

SKIPTMIDCAHSAVEKWSRELNDGYSELDMYQKFAELTLDVIGKTAFGTEEIGGASEAAS

VIGSFNRYLLYCRELVFGPPATFPTSL (?)

KWLRTYMGRIISARRNSHHSGAAETVSDRHDLLDVIIG

AVDNIGHSEEGAKKALNEAPDQTISEKRKRAAEMTRLTEKRLLDNALTV

LLAGHETTASLLTWTIYLLAEHPLWQKRARAEVEEFCPGGVVEPQVLSHLKLLGMILL

ESLRLFPPVPLIGRMCIKDNKVGPDLLIPEGLEIVIPVAVLHRDRTIWGDNADEFAPARF

GNGISGACGNPLAFLPFGAGPRTCIGQTLALSEAKAVLAVMLPLFSWKLSTSYRHSPDV

TLTMMPEFGMPVVLEKIEK*

 

CYP74 Clan sequences (3 complete sequences)

 

>CYP74x CYP74G1 AJ316567 divinyl ether synthase 12-AUG-2002 ESTs BJ969377.1 complete

hydroperoxide lyase (hpl gene) later designation 21-SEP-2005

39% to 74D1 39% to 74C1 41% to 74B2 42% to 74A5 39% to 74E2

38% to 74F1

BJ583519 BJ158039 BJ600124 BQ039802 BJ588073 BJ167917

BJ965095 BJ588288 BJ172167 BJ170523 BJ166295 BJ596848

BJ604932 BJ606484 BJ166967 BJ167535 BJ971827 BJ165862

BJ609895 BJ604409 BJ198021 BJ159658 BJ191836 BJ162716

BJ158982 BJ158406 BJ973612 BJ182787 BJ963293 BJ962527

BJ198621 BJ178387 BJ203304 BJ196986 BJ971054 BJ193013

MDRTLVLTCTTTCSHSAFRQSALPSNTSISVRLGTCSVRTQKR

RTVVASLGNIETTSTSTVGQESNLPLREIPGSYGIPYLSQLLDR

WTFFYREGEPQFWQSRMAKYGSTVIRSNMPPGWFWTDSRCIMLLDQKSYPTVFDYDKV

DKYKAFAGTIMPSTEYNGGYEVCAYLDASDKKHEQLKGYCFELLKFSSSKWAREFHTA

ISETFNQWEGKLAQKTPALINPTLPESLFSFVINALTTARFDDSSIPDAEKPVCGDLQ

KWAGFQLMPVIRTGAPIYIEEMLHVAPIPASLTKGGYDKMVVFLQKYAAETLSIAEKF

GLSQDEAVHNLIFFLILNAHGGFCRFLPVILREVAKNGQLQADLREEVRAAVKASGSD

QVTMKAVMNDMPLVASTVFEALRFDPPVPFQYARAKKDFIIESHDARYQIKTGDFLGG

VNYMVSRDPKVFTDRPNEFNARRFMGPEGDKLLAHLVWSNGRQTDETTVYTKQCAGKE

IVPLTGRLLLAELFMRFDSFNIEGLEMEATFTSLTPRSD*

 

>CYP74y CYP74A1 AJ316566.1 Allene oxide synthase complete BJ588378

BJ158304 BJ166090 BJ174856 BJ177756 BJ178183 BJ166090 BJ174856

BJ177756 BJ178183 BJ180158 BJ183079 BJ186758 BJ187084 BJ187922

BJ191679 BJ194574 BJ195562 BJ197445 BJ580030 BJ583315 BJ585498

BJ587579 BJ592267 BJ597789 BJ598633

46% to 74A1 40% to 74E1, 40% to 74F1 47% to 74C1 40% to 74B3

37% to 74D1

MAVPSSKLPLKAIPGDYGVPYFGAIKDRLDYFWLQGEEQFYRSR

MAKYNSTVFRVNMPPGPPISEHPQVICLLDQKSFPILFDVSKVEKKDVFTGTYMPSVS

FTSGYRVCSYLDPSEERHTKLKQWCFEVIAMNGRNFLPEFHKSIEESMVLWETSLAKG

EKTSVSDEVKQFAFNFLMRAVCHHDPAAPGEYSLGRNGGPYATAWANPQLAPIAGQTG

LPHVVEELVLHTVPLPSALVKKNYDALYNFIKNYATEALDRAEAMGIERNDATANLLF

FLCFNAYGGFSIFFPLITILISSCGPELMHDLHDEVTKAVAATDGKVTLQSIENMPLV

KSVVYEAFRFKPPVPYQYGKAKFDFTIENHENSFEVKKGEMLYGYQPIVMHDPKVFSD

PDQFLPRRFMGPDGEKLIKYIFWSNGYETDEPTTANKQCAGKDLVVTMARAFVAEMFL

RYKEYTLTMEGAGNATKVFFSDLKK

 

>CYP74z CYP74A8 856891456 70% to 74A1moss no ESTs complete

1028581451 1009321611 moves upstream

goes downstream 1036017357

MAVPVSNLPLRAIPGGYGISYLGAIKDRLDYFWIQGEEEF

YRSRVEKYNSTVFRVSMPPGPPIAKDARVICVLDQKSFPILFDVNKCEKRDLFLG

TYMPDLSYTSGHRVLSYLDPSEVRHEKLKQWCFDLIARNGRKFLPEFHTAMEESFAVWEE

AMEKGENANLSEEVQQFAFNFLVRAVLHHDPVAPGEASLGKNGGPYASAWHGPQLAPIAGQT

GLPHAVEELLHTIRLPSSVVKEQYDALYNFFKTYGGEELDRAVALGIKRDDAIANLLFL

LGFNAYGGFNFFFPQLTVHIAQCVPELMHELHEEVVAAVQATEGKVTPKSLENMPLLSSV

VYEGFRMKPPVPYQYARAKTDFLIESHENSFEVKKGEMLYGFQPYVMHDPNVFENPDKFL

PRRFMGPEGEALLGNVFWSNGRETDDPTVHDKQCAGKDLAVTISRAYVAEM

FLRYKEFTLEVQGSGVQTTLLFSALQKA*

 

>CYP74B3v1   Lycopersicon esculentum (tomato) AJ239065 58% to 74B2

IPIMNPAPLSTPAPVTLPVRSIPGSYGLPLVGPIADRLDYFWFQ

KPENFFTKRMEKHKSTVFRTNVPPCFPFFGSVNPNVVAVLDVKSFSHLFDMEIVEKAN

VLVGDFMPSVVYTGDMRVCAYLDTSEPKHAQIKNFSQDILKRGSKTWVPTLLKELDTM

FTTFEADLSKSNTASLLPALQKFLFNFFSLTILGADPSVSPEIANSGYIFLDSWLAIQ

LAPTVSIGVLQPLEEILVHSFAYPFFLVKGNYEKLVQFVKNEAKEVLSRAQTEFQLTE

QEAIHNLWFILGFNAFGGFSIFLPTLLGNLGDEKNADMQEKLRKEVRDKVGVNPENLS

FESVKEMELVQSFVYETLRLSPPVPSQYARARKDFKLSSHDSVYEIKKGELLRGYQPL

VMKDPKVFDEPEKFVLERFTKEKGKELLNYLFWSNGPQTGRPTESNKQCAAKDMVTLT

ASLIVAYIFQKYDSVSFSSGSLTSVKKAS

 

>CYP74C1 Cucumis sativus fatty acid hydroperoxide lyase AF229811

MASSSPELPLKPIPGGYGFPFLGPIKDRYDYFYFQGRDEFFRSR

ITKYNSTVFHANMPPGPFISSDSRVVVLLDALSFPILFDTTKVEKRNILDGTYMPSLS

FTGGIRTCAYLDPSETEHTVLKRLFLSFLASHHDRFIPLFRSSLSEMFVKLEDKLADK

NKIADFNSISDAVSFDYVFRLFSDGTPDSTLAADGPGMFDLWLGLQLAPLASIGLPKI

FSVFEDLIIHTIPLPFFPVKSRYRKLYKAFYSSSGSFLDEAEKQGIDREKACHNLVFL

AGFNAYGGMKVLFPTILKWVGTGGEDLHRKLAEEVRTTVKEEGGLTFSALEKMSLLKS

VVYEALRIEPPVPFQYGKAKEDIVIQSHDSCFKIKKGETIFGYQPFATKDPKIFKDSE

KFVGDRFVGEEGEKLLKYVYWSNERETVEPTAENKQCPGKNLVVMMGRIIVVEFFLRY

DTFTVDVADLALGPAVKFKSLTRATASV

 

>CYP74D1 Lycopersicon esculentum divinyl ether synthase (LeDES)

AF317515

MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFH

NKAEKYKSTVVKINMAPGPFTSNDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPG

KEYYGGYRPVAFIDTKDPNHAALKGYILSSFAKRHNLFIPLFRNTLSDHLFNNLEKQV

TEQGKADFNALLPTMTFDFIFRLLCDQKNPSDTVLGAQGPEHLRKWLFPQLIPSLSAK

KLPNIIEDMLFHNFLIPFGFIKSDYNKLVDAFSKSAVSMLDEAEKLGIKREEAVQNIL

FLVGINMFAGLNAFFPHLFRFVGEAGASLHTQLAKEIRSVIKEEGGAITLSAINKMSL

VKSVVYETLRLRPPVPLQYGKAKKEFMVQSHDASYKINKGQFVVGYQPMASRDPKIFA

NPDEFVPDRFMNDGEKMLKHVLWSNGRETESPAPDNKQCPGKDLVHLLGRLILVEFFI

RYDTFTLEITPLFRAPNVAFNTLTKASK

 

CYP85 clan sequences (5 complete sequences, 2 finished pseudogenes,

1 unfinished pseudogene)

 

>BJ975178 mate = BJ966664 (N-term) CYP763B1 34% to 90C1 complete 85 clan

890330488 982549587 35% to 85A1 rice, 41% to BJ580390

MDGRLFLQGLETVAFVCVSVLLISQLWPKNEERAKINTR

LPRGSYGLPLVGETLKYMASMMTSAPAFMAEHRQKYG

EMFKSKLMGAFCIITTKADTIKWVLNHEGKQFVTGYPKSFRKVLGEYAALSLHGDQWKSTRR

FLVNSLRVELLRERIPTIEQAVLENLNPWAAKESVSIREETKTLAFNVVAQYLLGSR 696

LKSGPVNDSLRNDFYTLTEGLFALPINLPGTQYRKGLEARARIIETLERDVVSHARPVGD 876

EDQYADYMDYMRKENLPGTTEELL

LEKTRCHVLGMLFAGHETAASA

MLFAVKYIMDNPRVLNELRAEHENIRISKFEGGSLTWDDYKNMRFTQSVITETLRLAN

PVALLWREATEDVQLNG

YVIPKGWKTVCAIREAHHDPALFDRPSEFNPWRHEQEVMNPAKKLPLLGFGGGPRYCPGA  587

ELARAEICIFLHHLVTKFDLKSCGEETVSFFPVPKFSNGLQVQVQERDLSTRISHKIRVH*

 

>755830456 CYP763B2 85% to BJ975178 CYP85 clan 34% to 90C1 complete no introns

824727620 821875103 no ESTs

MDTTLVLHGLEIVAFICVSLTLIMQLWSRNNEQAKINKRLPGGSFGLPLLGETLKYMASMKTSM

PTFMAEHRQKYGEMLKSKMMGAFCIVTTKSDTIKWVLAHEGKQFVTGIPKSFRKVLGEYT

ALSLHGEQWKSTRRFLVNSLRVELLKERIPMIEQTVLENLNSWAIKGCVSIREETKTLAF

NVVAQYLLGSRLKSGPVNDSLRNDFYVLTEGLFALPINFPGTNFRNALEARARILKTLEE

DIVSKPRPAGDEDQYVDYMDYMRKENLPGTTDELLREKTRCHILGLLFAGHETAASAMLF

AVKYIMDNPRVWNELRAEHDNIQVSKFEGGNLTWDDYKNMRFSQSVITETLRLANPVALL

WREATEDVQLNGSLIPKGWKTVCAIREAHHDPEFFDHPHE

FNPWRHQHEVLNPAKKPPLLAFGGGPRYCPGAELARAELCIFLHHLVTKF

DLKACETEIVSFFPVPMFSNGLQVRVQERDPATKCSQKIMAY*

 

>815711319 CYP763B3P 76% to BJ975178 pseudogene 692447055 816362600 finished

KNIQISKFEGGSLTWDDYKTMRFTQSVITKTLRLGNPVALLWREAMENVKLNEKVIPK

CWKMVCAIQEAQLNSALFDPPYEFNPWRHKQEVMNPA*K

LPLLAFGGAPRYCPGAELAPAKICI

FLHYLVTKFNLKSCGEDTVSFFPVPKFSNGLQVQMHEHDSSTKI*HKIKVY*

 

>774548359 CYP763B4P 993478971 978014995 finished

34% to 707A2 seq middle may be a pseudogene fragment

cannot extend up or downstream

DQIRHELHTLLRGLRALPINLPGFTYYKSRK (0)

AKLVLVSLMLKSIAKRREANIELNDFRNNLMKMTAIEVPDYDICCIMVVFMF

ASTDTTSALISWVVKYLHDFPEVRQRVQ (0)

 

>BJ580390.1 mate pair = BJ175156 CYP763A1 36% to 90A1 complete 85 clan

BJ186430.1 mate = BJ593857

BJ186356.1 no mate

BJ175895.1 Mate pair = BJ581114

1020660301 1020679587 883835965

MAELGVSEMERMNTFGIGADAQRGLGAGMTLPLLFLATVVW

WIWQRHKANLESGLPGTFGLPFIGETLTYVAKMKSPLGNFVDEKTKR (2)

YNGAQAFKSSLFFQPTVIATEVETVKMIVAKEGRSFVSNYPSSFALLLGRFNGLNMNGENWKRL 343

RKFVISHIMRVDLLKERMADIEDLVVRTLDSWADDEGRTIYVEDETKT (0)

IAFNITALIVLNLKPGKVSQTMQRDYYPLIEGMFSLPINLPWTIYGKATQ (0)

ARVRILKTLEEFLQSRTVK

DDVFDNYVQLLQEELPPGSPPALKHEMGLDLLTSLLFAGHDTTAATMVFSVKYIGENPKVLAELR

REHEELLKRKQPGERISWDDCKTLSFSNS (0)

IITETLRMCNISTTVFRKSLEDVHVG (1)

DYVIPKGWLVLPYFRAVHFNPSIYPDPYTFNPFRYQDAAGSKLPFFGFG

GGARLCPGMDLARAELCLFLHHLVMKFESWELLGNDVVSYFPFPRLSA

RLPIRVKRRTPPQQPST*

 

>755808818 CYP762A1 33% to CYP707A3 complete in CYP85 clan

831702982 785869234 836314374 BJ969496.1 BJ160608 BJ162335 BJ977796

BJ168851 green supported by ESTs BJ170173 BJ965146

MATVSLQEPGLVVGLFLGAPLLLFLYILYYAISLHTTSVEGVR

VPRGNFWLLPLLGESISALTVPPKQFIDRQTRK (2)

YGAMFTTHIGGDPMIMTTDVDLTRWVYQQTNRLFSVLSPKATYELLGHESIFYAKGDHH

LRLRKVFAGYLSTQKLVPFTPRIDKMAASIMESWKRKERVIVFDEAKM (0)

YAIHLALAQLISIDTQEYPCMDHIFAHVPGENRLEKLVYLHYDIESGMMSVPLNIPGTAYHKANK (0)

AKILFRKALKVIINERRTGDVKCNDLLEGLLSPLEDGTLLDDEQVMDN

VITGVGAAEVTTTTALVWMVKWIQENPELHRELQ (0)

NEMDAIKKTKANGEELTYDDIKKMNLTLW (0)

TMYETLRLRKVTGFFIARTADQDVRYKDVVIPKNWVVAMTHGYHLDPNYYPEPEKFNPYRFQTMP

PAHTFTPFGASVRLCPGKEMAKIEILTFMYHMLTSFSWEPAEPEGETIWHLFPHPRNKLPIKVTPRT*

 

>CYP716 like CYP716F1 complete AW739242 AW497090 BJ610569.1 BJ600055.1

BJ599808.1  BJ597366.1 BJ592026.1 BJ167019 BJ586914 BJ172516

BJ590596 BJ590880 BJ606611 BJ599271 BJ611487 BJ164618

BJ608000 BJ193730 (N-term) opposite end of BJ597366

BJ181980 opposite end of BJ586914

BJ192165 BJ187702 BJ159038 BJ160786 BJ206410

BJ196921 BJ196248 BJ194582 BJ196596 BJ187985 BJ184639 BJ200159

BJ161170 BJ164034 BJ191214 BJ159266 BJ169016 BJ171514 BJ167564

830444348

44% to Picea AY779542.1 CYP716B1, 38% to 716A2

MAHQQHGFLEGHAESTPAWAAVAAVVAMLVGWLFWRLFSVSPESQ

GKLPVPPGSFKWPLLGETLDYLDCARRNRVADFFNARVAKYGETFKTHILFNPTVSVTAP

DGNKFLFANENKLVQNHWPPSVSRLLGEHSMATKVGEEHRRARRVYTNFFK

PEGLQSFVPRIDELARSHNSKYWEGKEFILGGPTVRDFTFAVAADLFL

SLKHDDPMFRPFELAACDYLAGILQVPINLPGTAYRKGILGRESQLRVIDMSLKQRRQ (0)

EMKEGRV PPQQDLMSVLLNTLNEDGTPMSDDQIKDNMLLFVFAGHDTSSSALAG

LLKYLSLNPECLKKVLEEQMEIRKEKGGEDIPLSWDDTRKMKYTWRTIQETLRLQPSVQA

AFRTVIEEFEYDGYTIPKGWTIFWSVGRSHRNPKFFPDPEKFDPSRFEGTGPAPFTFVPF

GGGPHICPGNEFARTEILVYIHYLVLNYEWEMVDPTEDVCIDPMPLFTKQLQLRVRKRFPSL*

 

>830745357 CYP716F2P 830636975 37% to CYP716A1  44% to 716B1

53% to CYP716 like

Frameshift and small deletion after DKRR seen in 3 seqs

(937552998, 830636975, 717629207)

pseudogene finished

986842815

MEGLHYVWKQVGAHTGVWTVGATLLAVLTGWLLWSTTAVPTRNPPVPPGSFGWPLVGET

LDQLDAAKANQVVKFYATRVAKYGE (0)

VFRTHFLFNPAVSMGAPEGNKFLFGNENKLVQNSWPGPVTRLLGKNSLTVLVGEEHKC

VLAPCQLFCWNWFQISLC (0)

RQLYVGTPPSTGEGKGARILGVPTAKEFAFTVAADLFMSMDNHDPLYRLFAQA

HEEFVTGFFKIPIYLPGSAYRKALQGREEQRRIIGTIIDKRR

EGINPPHDLLNVMLTVPYENDSFMTDDAIKDNILLMMTASHDTSSTTIAFVLKYLYLNPECLKEVIR (1)

EQLAIAKDKRADAAVTWEDTKNMKYTWRAIQETMRLQPPVQAGFRRAIKDFEFGGFSIPKGWT (0)

LIWSVARSHMSPKFFPDPEKFDPSRFEGSGPPPYVFIPFGGGPHICLGNEFARLE

MLLFLHHIVLNYEWEMVDPNEQVSITPVTHFKKGLELILRKRRFE*

 

>picea sitchensis 716B1

MVWKEAVSVLQKAQELKEPPLMFTVFLASFIGLAFFFYLISNHR

TKAWRGIPPGTFGWPLIGETLEFLGCQRKGNPRDFFDSRTQKYGNVFTTSLVGHPTVV

FCSPEGNRFLFSNENKLVVNSWPSSVGNLFRSSLITTVGDDAKRLRRILMTFLRPEAL

REFVGRVDSMTKRHLAEHWIGKDEVMALPLLKRYTFSLACDLFASINTKDDLDRLWLH

FMVFVKGVMQIPIDLPGTRYNKTKHAANAIRQQLGSIINERK IALEAGNAS PEQDLLS

FLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEVLREQ

LNIAGSKEEGQLLEWEDLQRMKYSWRVAQEALRLFPAVQGSFRKAIKEFIYDGFTIPK

GWKLHWTVNSTHQKSEYFSNPEKFDPSRFEGEGPPPYTFVPFGGGPRMCPGNEFARME

ILIFLHNIVKNFNWNLVNPLEKVIVDPMPAPVNGLPIKLVPHD

 

 

CYP86 Clan sequences (10 complete sequences and

5 finished pseudogenes, 1 artefact seq.)

 

>CYP86 like1 CYP86F1 710546622 831723548 complete

BJ183632.1 BJ976817 BJ584415 BJ585375

839341101 830649952 774610095

711878238 CYP86 like 48% to 86A8 Arab., 48% to 86B3 rice

MQYLVMSRGDNCTHFHSQNQGQTGLGMCTGPNR

MDSWMLTQVMLAGVVTFLVWHVIKYSRIKGPIVWPVFGTTPQFLWNLPRMHDWTTDMLVKHDGTYTS

IAPKCTCLTAVATCR (2)

PENLEYVLKTNFANYPKGRSFTYPSHDLLGQGIFNTDHDLWKMQRKTASLEFSTRTLRDLM

VKANRSSVGQRLLPVLADVARNRA

PIDFQDLFLRYTFDNICMVGFGVDPGCLAP

GLPTVPFAQAFDLATEGTLTRMVVPEIFWRITRALGWGMEGRLAKAIST

IDKFAADVITERRRELNMLKTLNATEYPCDLLSRFMQTTDHEGNPYTDRFLRDVTTNFIL

AGRDTTAIALSWFFYLITQNPAVEEKILNEIREILQSRRQSGGVGEPDDDDAGRTTQEAS

LSFEELKQLHYLHAALSESMRLYPSVPIDNKDVTADDFLPDGTFVRKGTRLMYSIYSMGR

MESIWGKDCLEYKPERWLRNGVFTPESPFKYAVFNAGPRLCLGKELAYLQMKSVASAILR

NYHVKLVPEHKVEYKLSLTLFMKYGLHVTLHPRVTVAY*

 

>755797498 CYP86B like2 CYP86F2 49% to 86A8 91% to 86 like1 complete

1000171656 774610095 BJ183632 BJ180038 759454272

MAMNEGDNYTQFHSHNQAYAGMEMYIGQYRVESWMLTQAIITCVVAFLVWHVLKYS

RIKGPIVWPVFGTTPQFLWNLPRMHDWTTDMLVKFDGTYTSIAPKCTCLTAVATCR (2)

PENLEYVLKTNFANYPKGRSFTYPSHDLLGQGIFNTDHDLWKMQRKTASLEF

STRTLRDLMVKANRSSVGQRLLPVLADVAK (2)

KRIPIDFQDLFLRYTFDNICMVGFGVDPGCLAPGLPTVPFAQAFDLATEGTL

TRMVVPEIFWRITRALGWGMEGRLAKAINVLDKFAMDVITERRKELAMLKTLNATDYPCD

LLSRFMQTTDHEGNPYTDKFLRDVTTNFILAGRDTTAIALSWFFYLITQH

PAVEEKILLEIGEILRSRNHGQDKEAADDDATRIT

QEASLSFEELKQLNYLHAALSESMRLYPSVPIDNKDVTADDFLPDGTFVRKGTRLMYSIY

SMGRMDSIWGKDCMEYKPERWLRKGVFTPESPFKYAVFNAGPRLCLGKELAYLQMKSVAS

AILRNYHVKLVPGHKVEYKLSLTLFMKYGLRVTLHPRVTVAY*

 

>815804922 CYP94G1 852116747 830503673 1020611714 complete

cyan = possible intron with GC boundary

46% to 94D2 after subtracting insertions

MMDRELVTLLYTAGILLVVTLWCIWYHHPKYGKNRGPKVY

PLLGSYLSLLHNKSRILDWMVDLIRDSPTMTVRTVRPGGRQ

FHITAGPANVEHILKTNFENYPKGENSYANLHDLLGNGIFNIDGKSWKLQRKVAS

HEFTTQSLKNFMVGAVHDELRGRFIPVLQECCNTGRTVDLQDLLARFTFDTICKLGFGVD

PACLDLCFPSVRFANAFDTATSITANRFITFASVWKTMRALNVGS

EKKLRAAVADIDDFAMFVIQNRRKQVAGQSNRQTDNSSDADDAAHLDLLSRFMGLTA

ADQDRRDFDTQDPSCDQ

NEGPQLGYSDEFLRDIVISFILAGRDTSTSSLTWFFWNLEHHRQV

EDAICKEVSEILKNRLVEDKDHNKHVPTSFFSFEELKKMHYLHAAVSESLRLYPPVPIEM

KLAHSSDEWPDGTRIDPNSTIIYHPYAMGRMERIWGPDCMKFKPERWLKDGVFVQESPYKHAVFQ (0)

AGPRMCLGRELALMQIKMVVAVLLQRFRFSSQKGFTPEYDLNLTLPMKNGFPVSVQSKVPM*

 

>CYP94D like CYP94H1 AW561645 44% to 94D2 complete

816253695 1020656227 876286269 BJ606150 BJ606502

MSTPNYMSPEMGRFEKWALLLREESEEHTLAFVATILFVAVNALIFIWWHHPLYGKN

IGPRVYPFVGSLPSAIQHAHRLLDFSVETLRKSPTLTIRYVQSGYTAYSTANVENVEYVL

KTKFDNFVKGERMGDVLFDLLGRGIFNADGNLWKLQRKLASHEFSSRSLREFGVE

CVQKELQNRLVPVLSQFSENGNVVDLQDLLMRFSFDNICQLGFGVDPNCLEPSLPPVKFA

EAFDKANECTLLRFRTFPIMLRLYKFFNIGIERGLKESMAVVHNFAQEVIEARRKEFNEN

HGDIGHARQDLLSR (2)

DAKEKQKASDIFLRDMVISFVLAGR

DTTSLGLSWFFYALGHNPHVEAKIYDEIKEQLQLQAQEDDSLPSSRPPGQLFTFEQLKKL

HYLHAALHESLRLFPPVPWDSKHAVRDDVLPDGTVILKGERVTFNIYAMARMEANWGPDC

NEFKPERWLKDGVFVPESPFKFATFQAGPRICLGKEMALIQMKLVASSLVYCFKFTLLED

PPRTCLSFVFKMLNGFPGDVHKRAVST*

 

>815609477 CYP94H2P 61% to 94D like pseudogene stop codon seen in 13 seqs

finished cannot extend

DGFLRDIATSFVFTGRDSTSVTLSWFFPSLCLNP*AEAK 466

 

>710485080 CYP94H3P 713838121 40% to 94D4 probably a pseudogene finished

it has frameshifts, deletions and stop codons

997462133 998782531 713858321

824686025 = poor seq version of 710485080 58% to 710485080 artifact

note: top part of this seq has only one match in trace archive

as we move down it begins to match 710485080

bottom part matches 710485080

This is probably a poor quality version of 710485080

MDNSTVTLHKLECNPPKLFESSFGVWTATCIVALSFLYKWWKNHPLYGKN

PGAKAYPLIGNLVEFLWNITRIYDYETDLMRSKKILTIRNSLTYCRTTYMTANPAN

VE*ILKKNFANYPKGEYIRNTFQDYLGEGILNADGDIWKMQRKITSNEFSLRFMRNFMID

NAQQEIDIRLLPILLRASDDQKQ

LLDMQDILKRFNFDNICTLTVGINPGCLDLSLPNVEFEQAFDEAAACIAHRFTNVFWT

LYKALNIGYERRLRDSVPHIRNFIMPVI*ERRKEMTESSNKVHRVDLLSRFIDHGTDD

SEKLSDQFLCDMLVSFFQAGRDTIAMGMTWFFLELTSH

DFSNPQFQLRGCVL

SFDELKSMHYLQAALFESMRLHPSIPADQKVAASDDVWPDGTVIRKGETAGYSPYIMGRMEAL

WGPDVMEYKPERWLKDGVFVPENSYKFPVFQARPRICLGKDMGIMTMKLIAAS

LLQRFTLSVPDGFQSLYHVSVVLPMSGGLPVRVRRRS*

 

>BJ589415 CYP704B5 BJ592550 BJ584707 BJ588917 BJ593364 BJ581728

49% to BJ957091 55% to 704B2 complete

976083649 869925771 1006228277 869807368 859499381

830613907 contains an isertion between J-helix and K-helix

compared to 704B2 TTIDESWTLNQRIIQ seen in EST

MAEEISWAAPRSGAATSVVLAVTTLLWIIVFRWRQRHRLGPKEWPILGSALEI

TSHFGDMHDWLLSYFEKGLKTFRVVIPGVVYTYTVDQANVEYILKTNFANFPK (0)

GELYHRHMETLLGSGIFNVDGEEWRQQRKTASFEFASRILRDYSTVVFRNNAVKLAE

IIARMSQTQEPIEMQ (0)

DLFMRLTLDGICTVGFGVEIGTLSPSLPAVPFATNFDNANEAVTY

RFFDPIWPLKQRLNIGNEAVLARSVKVVDDFTYKVIQTRRTELQYISSQGKEM (0)

KADLLSRFILMGENSEESLTDKMLRDVILNFIIA (1)

GRDTTAVTLSWFVYLLSTHPEVADKVYEELRHLEEETTIDESWTLNQRIIQ

QASLLTYDALSKLNYLHAAITETVRLYPAVPQNPKGILEDDILPDGTLVKKGGL

VTYVPYAQGRMKELWGKDADEFRPERWLKDGIFIPASPSKFPAFQAGPRICLGKDSAYLQ

MKMAMAVLCRFFKFKLMPGHVVKYRMMATLSMQKGVRVYVSGRDV*

 

>820957973 CYP704B8P 66% to BJ589415 pseudogene seen on 8 seqs finished

cannot extend upstream

755734545  865099818  1036028198

824622763  863035796  859709615  982621777 824721912

LKTYVP*GHGRMSQLWGKDPNEVQPERCLEGSIFIPVSPSVFPAFQ (?)

AGPRICIGIKSAALHMKMATA

LCRLSSSELMRGHPVDCQPTANFSIQKRTALGREKAMFK*

 

>774439634 CYP704B6 774616817 872730703 1005941337 1006178134

79% to BJ604836 55% to CYP704B1 complete

MEEVMRASFSSGSVVAFVIIATLSYLWIFRW

RQRHRIEPKEWPIIGGALETIQHFDVMHDWILSYFNKGLKTFHVKYPGITYTYTIDP

NNIEYILKTNFANFPKVKFKNITS ()

LETLLGDGIFNSDGEAWRQQRKTASFEFTSRVLRDYSTVVFRENALKVGDILSSVCQKHQPIDMQ (0)

DLFMRFTLEGICKVGFGVEIGTLSESLPAVPFATNFDNANEAVTYRFFDPFWPLKQMFNIGNEAVLSRSVKVVDDFTYKVIKIRRAEMDLATSEGHDK (0)

KADLLSRFILLGKDPEQNFTDKTLRDVILNFIIA (1)

GRDTTAATLSWFVYLLSIYPHVADKIYDELHALEKDANINASQTLNQKMREYSSILS

YDVLTKVQYLHAAITETIRLYPAVPQ (0)

DPKGILADDVLPDGTVLKKGGLVSYVPYAQGRAKVIWGDDAESFRPERWIKDGVFIPLSPFRFSAFQ ()

AGPRICLGKDSAYLQMKMVTALLCRFFKFDLMPGHQVKYRTMATLAMENGVKMFVTRR*

 

>BJ604836 CYP704 like CYP704B7 59% to 704B2 mate = BJ198529 complete

830772551 993524135 997128890 713796384

BJ598232.1 mate = BJ195079

BJ595821 mate = BJ190416

MEALISVPFSTESAVTFVIIATLSWLWIFRWQQRHRLAPKEWPVIGAAVETIR

NFDDLHDWVLSYFQKGIKTFRVKFPGTMYTYTVDPKDIEYILKTNFANFPK (0)

GDLYHKNMETLLGDGIFNADGEVWRQQRKTASFEFASRVLR

DYSTVIFRENALKVGDIVVGASQTHNAVDMQ (0)

DLFMRLTLEGICKVGFGVEIGTLSPSLPAIPFASNFDNANEAVTYRFFDPFWRLKQLFNIG

NEAVLSRSVKVVDDFTYNVIRTRRVELQSTEGENK (0)

KADLLSRFILLGEDPEQNFTDKTLRDIILNFIIA

GRDTTAATLSWFFYLLGNHPRVADKIYDELHALDDDANVNKSQSLNQEMSEYATQLT

YDVLLKLQYLHAAITETIRL

YPAVPQDPKGILADDVLPDGTVLKKGGLITYVPYSQGRMKDIWGEDAEDFRPERWIKDGV

FTPLSPFKFSAFQAGPRICLGKDSAYLQMKMASALLCRFFKFELAPGHPVKYRTMATLSM

QRGVKMYVTRR*

 

>BE643294.1 fern Ceratopteris richardii, CYP704B like, 47% to 704B2

50% to 704B7

SKLPQLSKGDRIHERFVDVLGDGIFNVDGEKWLHQRKVAILEFSSAKLRDFSTRAYRTHA

LRLLNVLLDAWKSGLVVDMQDLFMRLTLDSICNIGFGVNLGSLSSELPDVPFMRSFDDSN

KLIIRRYVDYAWKIKRALNVGGEAKLKKCVEIVDGFIYNVINIRRMEMTASRARGEELQK

EDLLSRFMSLSNEDGSPYSDKQLRDIVVNFIIAGRDTTALTLSWLFFMLCKNPTGIKNFC

RELTKSSTT*

 

>BJ967820 CYP704D1 993596810 46% to 704B1, 49% to 704B2 complete

835928964 903863118 862810596 833249970

MDFAQGWGSESIAGMMKTIVTAFSGILSLLLAYLLWAAADNWVLHRERKGPVQWPIL (1)

GVTLEALKNYQTLNDWVVYYFLRDGLTFSCKMMHLDLTFTADPVNVKHILKTNFANYDKRKFFH

ENFEIFLGDGIFNVDGEIWRTQRKTASFEFASRKLRDFSTVVFRDYSVKLASILARAATAQQSMDMQ (0)

DLFMRFTLDSIFKVTFDYDVGTLQPGLPNIPFAQAFEITNEITSSRLINPIWKLNRAL

KIGSERVLLQSAKDVDEFIYGVIEAKKAEMANS

KSDLFSRFMRLEEDDSDIQFTDKNFRDTLLNFIIAGRDTTAVSLSWFVYRMAQNPEMTAR

LQQELRDFDTVRNWKQQPEGDEGLRRRVLGFAELLTFDNLVKLQYLHACILETLRLHPAVP

QDPKHAINDDILSDGTQIKKGSLIYYTPYAMGRMPALWGPDAMEFNP

QRWFVDGVVQTEQPFKFTAFQ (0)

AGPRICLGKDSAMLQLRMVLALLYRFFTFQIVEGTDIRYRQMATLLLANGLPAKIIKQKN*

 

>713859399 CYP704 like1 CYP704F1 complete 43% to 704B2 BJ588705.1 mate pair BJ183392

BJ181412 mate = BJ586316, BJ181232 mate = BJ594159

BJ944527 mate = BJ955305

1010161410 831733082 AW598874

MGDEGATLFGAFKSGNVLPAGVGQQEVWIM

AAVSLVVVTASMWLWLLSLRRRPPGPMIWPWLGSMLEIAPQFDTMNDWYLNYFSADVKTF

SFGMPGFPSCTKFVATVDPVIVEHILTNVYKYGKGDQLRDRLGDFLGRGIFLADGEDWRR

HRKIASTEFSTRKLRGHSASVFRGEGVKLANCLKVAMAADQPVEIQ (0)

DLFLRMTLDSICKVAFGVEIGSLSPDLPDVQFAKDFDNAQAHISKRVVRPMFKILRA

LDIGEEHHFRIATNSVHSFAMDVIAKRRKEIAAAHDAGEEY (0)

HRDDLLSKFMANLTQDENSYDDKELRDVIISFMLAGRDTTAVTLSWFTYEMCCHPEIADKIY

EEGVAVIGKHTVVESAVEHLTHEALGQMHYLHAALSESLRLHPAVPRDGKCVLEEDVLPNGIKVKK

GDFVQYVPYSMGRMPFLWGPDALEFKPERWLKDGVYQSVSPYIHSAFQAGPRICLGKDSA

YLQLKVTAALITHFFKFHLVPGQEIAYTTTLVMPIKKGLKVTLSPRQ*

 

>816126256 CYP704F2P 870348294 816042352 85% to 713859399 CYP704 like1 finished

no sequence upstream matches P450 sequence, possible pseudogene fragment

AGPRICLGRDSACLQLKLTIALIAHFFKFHLVPGQEITYTTTLVMPIKNGLKVTLPSR

 

>710547862 CYP704A like2, CYP704F3P 59% to 704 like1 finished

41% to 704A2 717627085 1012795691 762523153 839344697 1003398464

815674025 cannot find last 68 aa

pseudogene stop codon seen in 12 sequences

784301641 884956166

MGDEGPKLLEVLNGTKSFIGNAGRVEAWITVVVALVVIVSSTWLWLCKRS

GRRKRIPGPAIWPVIGSMLDIVQNFDTLNDWYL

SYFSDDVKTFAFAIPEFPRSLKFFATVDPVNVEYILTNIHKYGKLSTLTKI (0)

GPGLQERAGDFLGSGMLMTDGAAWKRHRR

IASTEFSTSKLRDHCDTVFREGAILANVLKSAMAVKDPVEIQ (0)

DLAIRLTLDNICKMAFGVELGCLAITLPDVPFARAFDDAQSLVVRRAMNPLFKI*RA

LNIGDECCFREAIRNLDMFAVNVINKRRKEISAAHDAGREF (0)

NKEDLLSRFMSHRAGGDDSYNDKELRDVRVDFLLARRDTSAVTIAWFTYAMCRHSDI

ADKIHKEGVDVVGYHTDFESMAQRLKHEVLGRMHYLHAALSESLRLHPPLAR (0)

DSKYVFEDDALPDGTKVRKDDFVHHVPYSMGRMPFLRDSDVLEFKPERWLKDGAFQS (0)

 

>BJ957091 CYP704E1 45% to 704 like1 mate = BJ946301 complete

48% to 704B1, 50% to 704B2 BJ172920 BJ199044 BJ200146 BJ596315 BJ598545

BJ599748 BJ605379 BJ608983 BJ942257 BJ942853 BJ944859 BJ952929 BJ953251

BJ940397 BJ942576 BJ955633 BJ958706 982651912 830779862 862331944

BJ946301 BJ947855 AW509793

MLSGGPLETFSVWFAMNGESSFPVKTCLSLTWVTAESFLVAAIAWSFAAWIWWHWREQRKLPGPFAWPL

IGCLPELSANWDRLHDWVLEQFSDDRRTIYVQFGYPDVAVFTVDPANVEHLLKTNFSNYP

KGESNCNLMRELFGVGIFTTDGELWKEQRRMASYEFSSASLRDFSTDVFREYALKLVFIL

SRFASTGADFDLQEMCMRMTLGTTCKIGFGVVLDCLSPSLPKIQF

AQCFDDANFISYHRFVDPLWHVKRALNIGRERKLKHCVKVLNTFTYNVIEKRRQEMASFNTKVWSW (0)

AAQSDLLSRLTDLCNRGGEISHYVDTALRDMILNFIVAGRDTTAGTLTWFFYMMSSHPEIADKIFDE

LSTVVAVAGKH (1)

IVEFSKLLTYEKLGKLHYLHAALSETLRLYPAVP

LDSKQAAEDDVLPDGTVVKKGSMVGYVPYSMGRMKCLWGDYAAEFKPERWIQEGE

FVPQSLFKFTAFQAGPRTCLGKDSAYLQMKMTAALVMRFFTIRVVPGHSMQYRTMLTLNM

KHGLRAVVSRR*

 

CYP97 clan sequences (4 complete sequences)

 

>756728820 CYP97A8 CYP97A 62% to 755832269 61% to 97A4, 65% to 97A3

838595928 1017487654 1006241304 836332432 997378091

978023017 1012791403 863070727 993681861 957177019

993681765 1017433301 complete

MDLASDGRARTIRAALNGGDKMEMVLDDADEAERLRVWQKQDELASRIASGEFTVSQPS (2)

NDFLLTIRRILANSGPAGRALALQLAIYEARIKAEQSER

MPESRGDVGAIVGEPFFKPLQKLFLIYGGVFRLTFGPK (0)

SFVIVSDPMVXKHLLKDNAKAYSK (0)

GILAEILEFVMGTGLIPADGEVWRVRRRAIVPAVHRK (0)

YVAAMMEVFGQATQRLCDKLDEAAVSETSVEMESLFSRLTLDVIGKAVFNYEFDSLSNDAGIVE (0)

AVYITLREAEDRSIAIFPYWNIPILRAIVPRQRRVAKALNLINEVLDNLIAICK (0)

RMVEEEDVQFEDEYVNDRDPSILHFLLAAGDE (0)

VSSKQLRDDLMTLLIAGHETSAAVLTWTFYLLAQ (0)

NPGAVAKLQEE (0)

VDRVLGDRIPTVEDMKKLRYTTRVINE (0)

SLRLYPQPPVLIRRSLESDMLGKYRINK (2)

GEDIFISTWNIHRSPYLWEDPESFLPERFPLDGPDPTESNQNFR (2)

YLPFGGGPRKCLGDMFATFE (0)

NITALAMLVRRLEFALAPDAPP (0)

VGMTTGATIHTSNGLHMSVVRRKIKSDSAKETPVTQTQSSNGLVSQGTS*

 

>755832269 CYP97B8 CYP97B like1 70% to 97B3 Arab. 70% to 97B4 rice. complete

824710406 832112555 859647155 1006315928 1006354442 863063893

755832108 879804344 1006116672 713862054 BJ590155 BJ606606

ESTs BJ206405.1 BJ200097.1 BJ187250.1 14 exons

MAMASALPNAGPASLMNQNSGSRRLSSSKSTILGHSFLLRHLPSKTRSRGIQC (2)

LKTDRKPENERTLLDNASNLLTNLLSGGNMGTMPIAEGAVSDLFGRPLFFALYDWFMQ (0)

HGPVYKLAFGPKAYVVVSDPIVARHILRENTFSYDK (0)

GVLADILEPIMGKGLIPADLETWKVRRR (1)

AIVPGFHAAYLEAMVEVFDNCAERTVEKIEGLLDAVQKECKSQ

IEIEMESEYSNLALDIIGLSVFNYDFGSVTRESP (0)

VLQAVYGTLSEAEHRSTFYIPYWKFPLSRWLVPRQRKFNEDLKVINDCLDDLIKRAQSTRQ (0)

EEDVESLQQRDLSAAQ (0)

DSSLLRFLVDMRGEDATNKQ (0)

LRDDLMTMLIAGHETTAAVLTWATFHLAQ (0)

NPDMVAKAQAEIDRVLQGRRPTLKDIQNLT (2)

YIKLIVAESLRLFPQPPLLIRRSLQPDTLP (1)

GGHKGDPNGYSIPKGVDLFIS (0)

VYNLHRSPYFWDEPEKFNPERFLKAKLSDGIEGWAGFDPKRGQGALYPNE (0)

VMADFAFLPFGGGARKCVGDQFALMESTVALAMLLQKFEVELRGSPEDVELVTGATIHTK

DGLWCKLSRRKSITNLN*

 

>BJ955568 CYP97C5 71% to 97C2 opposite end = BJ944795 complete

890401623 839322423 not all introns shown, most of seq from ESTs

MASPSLHVGIGTRRPGCCNRTIGPIHYDSKFSGAYKMGLRGGPAGRVGNFCDQGRLRVR

CSGGAEDNDNGRSSVEKSGAGKSWVSPDWLTKIVSLGKGPDTSGIPVADAKLEDVKDLLG

GALFLPLFKWMMENGPVYRLAAGPRNFVIVGDPAVAKHVLKGYGTKYSKGLVAEVSEFLF

GSGFAIAEDQLWTARRRAVVPSLHKKYLSTMVDRVFCRCSDALVAKLEKVVASGAPVNME

AQMSQLTLDIIGLSVFNYEFDSLKTDSPVIDAVYTALKETESRSTDILPYWQ (0)

IPLLCKIVPRQQKAAKAVEIIRETVEKLVAQMQEMVEAEKETIEG

EEYVNESDPSVLRFLLASREE (0)

VSSVQLRDDLLSMLVAGHETTGSVL

TWTVYLLSKNPAALAKVHEELDRVLAGRKPQFADIKELKYLTRCINESMRIYPHPPVLLR

RARVADELPGGYKIEAGQDVMISVYNIHHSPQVWDNAEEFVPERFDVDGPVPNETNTDFK

YIPFSGGPRKCVGDQFAMLEATVALAVLLQRFKFDLVPNQTIGMTTGATIHTTTGLYMTV

TDRQQTKVPDLVVA*

 

>AW097933 ga03g06.y1 Moss EST library Ceratodon purpureus 79% to BJ955568 97C

194 LLCKIVPRQQKVAKAVQIIRETVHRLVAQCKEIVEAEKETLQGEEYMNVSDPSVVRFLLAS*EE 385

 

>710502520 CYP764A1 name changed to CYP746B1

42% to 705A EXXR region BJ587261 BJ182326 complete

869797323 1006121234 710534477 755806706

27% to Chlamydomonas SCAF 1399, 28% to 97A4, 31% to 734A1

most like chlamydomonas CYP746A1, revised May 4, 2006

MGSISAANLELIATLASHCLQRTTESVKQGQAVLQQAVQPLPSCFPPGPNGDVA

LDFARDPLECLASLKSRYGSLVGFKLASRPIVLVSSPNFSREVFVTQSSTFIKAGTAFFP

GSSLAGNGLLVSDGDIWKRQRRLSNPAFRRAAIQTYAE (0)

QAMVNITEKMVDKVWRTGGVRDVYADFNELTMEIVASALFGASEASEEMAQVGPAITQAF

QFFTRRATSMFI (1)

     VPEWVPTFDNIQYNNAVTDLNKVVFRLINERRRQLANSSAPPRKDLLTRLLHV (1)

     NEDGSGMDNQSLRDELMTFLVA (0)

     GQETSAILLTWALLMFALHPHTQELVFQEISEVLNGQLPRQTDVSKLR (2)

708  YLEAFIWETLRLMPPAYVVGRCACHPTELGGYKIPQGTTILVSPYLLHQDPAFWPRV  529

528  SEFDPSRWMPGGDATEHMENDSFWPFGGGPRNCIGMGFAMMEVTLVLAVISSRFRVSL  355

354  PVGEPIPSPRAMITLRPESEVKLRLTSR 271

     RQQRQRKSEAADEMKVIVCLN*

 

>Chlamydomonas CYP746A1

C_28140001 = C_250032 C-helix exon duplication

This is a bacterial related seq like CYP252A1, CYP197A1, CYP208A1

N-term is probably in a seq gap.  C-term runs off the end

scaf 2814 is a repeat of the C-helix exon

39% to CYP252A1 from Streptomyces peucetius,

but not bacterial because it has introns.

Intron boundaries not well supported

LQASASQISAAAAQLTAAAAGAATRLQRLSSPPPPAFPAGPSGDQTLPLLTDPLRFLTDAT

 

(1) GNGLLVSDGPVWQRQRRLSNPAFRRAAVEAYGGAMVAATEDMMRRVWGPA (1)

GGTRDVYADFNELTLQVTLEALFGFGSAERRQQQQQQVEGQEGAAGA

GAAGAQAAGPSFAASSSAASSEDAAQIVAAVEKAFTFFTQR (2)

AATGFVIPEWLPTWDNLEFAAAVQQLDRVVYGMINRRRQELAAAFG (2)

GGGGGGGSAGVPSDLLTSLLLARDEDGSGMSDQALRDELMTLLVAGQ (0) 30502

ETSAILLGWASALLAAHPEVQAAAAAEVAAVCG

VRHMPYLESVVLETLRLYSPAYMVGRCARRDAALGPYVLPAG

TTVLVSPYVMHRDPEVWEEPEVFRPERWQELQRR 29548

EGYSGYMGLMSNLGPNGAYLPFGGGPRN 29261 (SEQ GAP HERE)

 

>746A1 bottom seq compared to 710502520 top seq (parts only)

      Length = 237

 

 Score = 680 (239.4 bits), Expect = 2.0e-70, P = 2.0e-70

 Identities = 137/237 (57%), Positives = 165/237 (69%)

 

Query:   120 GNGLLVSDGDIWKRQRRLSNPAFRRAAIQTYAEQAMVNITEKMVDKVWR-TGGVRDVYAD 178

             GNGLLVSDG +W+RQRRLSNPAFRRAA++ Y   AMV  TE M+ +VW   GG RDVYAD

Sbjct:     1 GNGLLVSDGPVWQRQRRLSNPAFRRAAVEAYGG-AMVAATEDMMRRVWGPAGGTRDVYAD 59

 

Query:   179 FNELTMEIVASALFG ADLLTRLLHV-NEDGSGMDNQSLRDELMTFLVAGQETSAILLTW 236

             FNELT+++   ALFG +DLLT LL   +EDGSGM +Q+LRDELMT LVAGQETSAILL W

Sbjct:    60 FNELTLQVTLEALFG SDLLTSLLLARDEDGSGMSDQALRDELMTLLVAGQETSAILLGW 119

 

Query:   237 ALLMFALHPHTQELVFQEISEVLNVSKLRYLEAFIWETLRLMPPAYVVGRCACHPTELGG 296

             A  + A HP  Q     E++ V  V  + YLE+ + ETLRL  PAY+VGRCA     LG

Sbjct:   120 ASALLAAHPEVQAAAAAEVAAVCGVRHMPYLESVVLETLRLYSPAYMVGRCARRDAALGP 179

 

Query:   297 YKIPQGTTILVSPYLLHQDPAFWPRVSEFDPSRWMPGGDATEHMENDSFWPFGGGPRN 354

             Y +P GTT+LVSPY++H+DP  W     F P RW   G  +    N ++ PFGGGPRN

Sbjct:   180 YVLPAGTTVLVSPYVMHRDPEVWEEPEVFRPERWQEMGLMSNLGPNGAYLPFGGGPRN 237

 

CYP710 clan sequences (2 complete sequences)

 

>CYP710Axx CYP710A13 gnl|ti|755830097 54% to 710A1 complete

BJ604054.1 mate = BJ195509

gnl|ti|785870283 ASYA328762.b1

gnl|ti|785844289 ASYA190398.b1

METLIGAVSRIEWRVGLVLVVSAYVVYEQLSFMTKRKHLPGPSFVLPFVGNVIAMVVDPAGFWDQQANYALK  (0)

VGVSWNALLGKFVLFVRDSQLSQKVFANV

RPDAFHLVGHPLGRKLFGEHNLIFMFGEEHKDLRRRLAPLFTTKSLGVYISIQE

KTQKEHIAKWMAIAKDLGDD

PIRVRMLCRNMNLETSQNVFVGPYLTPDMRRQFDE 233

DYKNFNTGLMSLPINLPAFSFYKATRSVRNIQNMLTKCATASKARMAMGENPSCLMDFWM 413

IETVRELRDAEAANTPPPPHSSDYEIGCHLFDFLFAAQDASTSSLVWAITLIESHPYVL 590

EKLREELLCLRPDPLAPYTPESLREMKYTEMVVKEVLRYRPPATLVPHIANTDFALT 761

DTYTVPKGTIVFPSLLDSSFQGFKDPEVFDPERFSPERMEDLVYKKNWLLFGAG 923

PHQCIGQRYAINQLMLFISLFFTQVDVKRARKPGCDDLVYTPTIAPKDEGLVYLSPRIVKQKD

 

>CYP710Ayy CYP710A14 gnl|ti|692479609 54% to 710A1 complete

BJ954143.1 BJ599532.1 BJ603752.1 BJ601705.1

BJ606683.1 BJ603803.1 BJ598741.1 BG361639.1

BJ607040.1 AW496913.1 BI740999.1 AW699711

BJ206552 BJ196180 BJ206140 BJ943450

Mate pairs join these two seqs

BJ197697 CYP710 N-term BJ204777.1 BJ193269.1

AW145717 88% to CYP710ayy heme signature chimeric EST with errors

MEGLFEVMPGLGWREGLGLVIFGYIIFEQLSFFSKRKHLPGPSFVLPFVGSVIAMVVNPTGFWVNQAKDASK

VGVSWNALLGKFVLFVRDSQLSQKIFANV

RPDAFHLVGHPLGKKLFGDHNLIFMFGEEHKDLRRRLAPLFTLKALGVYVSIQE

KTQKEHITKWLDRADKLKNN

PIRIRLLCRDMNLETSQNVFVGPYLTPDMRERFNEDYKNF 540

NVGLMSLPIYFPGFSFYKATKSVKNIQNSLARCAAASKARMATGAEPSCLMDFWMVETVR 360

ELGEAEAAGMPPPSHSSDFEIGCHIFDFLFAAQDASTSSLVWAITLTESHPHVLEKLREE 180

QSLLRPNPLAPYTPESLRELKYTEMVVKEVLRYRPPATMVPHIASTDFALTDTYTIPKGTIVFPSL

LESSFQGFTDPEVFDPERFSPERMEDQVYRKNWLLFGAGPHQCIGQRYAINQLILFTSLF

TTFVDYKRARTPGCDDLLYTPTITPKDEGLVYISPRIVSEH*

 

CYP711 clan no sequences found yet

 

CYP727 clan 1 complete sequence

 

>815606257 CYP751A1 710918567 776043366 33% to 727A1 complete

MAAWKRESVVSVFATNESAAIGVCDVTPVHETPLWR

YVKHEQNTLAWVSLIVVTFLLSRRLCSVLRLLILGYRLPGPRARAFDGRSQC (?)

DDIVELLARLHQEHGPLVKVWTGPAQLLVSVKDVDILQHVFERAHDRVPVLRMALQLLYGRRSLFTSNYSKVSCRSL (0)

INGLVLRQAHISSIEVAEKMTQLGGLSKNGCHD

LDCMTFSKLMAFAALGTSLYGDGYMIWPVAREFERVMMEVMEALPIWMRYSVPPLWNAKF

VVFWKQCLRLRDLARELAAHGNQTSIQESEDRVEGLNILGKLLEEF

VSVLFSRMGMGSSTVAEPGAAGMMSHGSLNTAGVLCNVLAQLARHPHIQTK

VHNEISTISGFDKSLTETDVQKMIYLNATVLEAARLLPTVPFLQRCSDEH (1)

DIALLPGVVIPAGAILTAPIQLIQRDTVYWGDDAAIFNPDRFLKPRRIASGELASEQNQ

NIPHPCNFTKEPLQLNPAFLVFGAGSRSCIGSSLAVKQISILVTVILKRFEVMLYPTLFISKL*

 

Three probable bacterial contaminants

 

>815725399 830616790 870054233 29% to 709C9

39% to CYP109B1 bacterial contamination

next gene 303 bp downstream 29% to CP000116.1  Thiobacillus denitrificans

778231-779040 (best genbank hit)

mate pair of 870054233 = 870054137 same as Thiobacillus hit above

GCSHLKKGKRGCCFMKWNANGLLPLEWYKKMRRDSPVVQSNDGQVWDVYGYDDVKTVLRN

HDIFSSSAFPDSEDPREHSILRQEPPKHRQLRRLGPRRSRRASSNRWLPRSIRSPPRCWR

EAGEKKGGMSAIADLPSPLPIVVIAEMLGVSLDHREQFKAWSDALVGDSGEDFYQCQREMSEYF

SEIAEDRRRHPQDDLVTKLVEARIDNEHLTDLEIIGFCILLLVAGNETTTNLISSAMLGI

DTLPDVRAQLLADRSLIPGALEEVFRYFSPVQVMFRRVKQDTVLGGQEMKVGQFVHIWMA

SANHDEKVFERPEEFNIHRNPNPHLGLGSGIHYCLGSQLARLESKIAIETLLARFPEYRR

DRSAELARMDSMMMFALKELPIYLT*

 

>862312623

bacterial seq. only one hit to trace archive

58% to CYP152A2 Clostridium acetobutylicum bacterial P450

69% to AP006627.1 unnamed P450 from Bacillus clausii

GYGLAGTLTMLDLYGTNHHPDLWDKPEKFMPDRFQHWRGSPFRFIPQGGGDHD

TGHRCAGEWITLEIMKESLDFLANRMSYDVPQQDLSYSFSDIPSLPHSNIVIQNVRSV*

 

>862809891 also = 975706812, 884004771, 884935229, 717626545

862809508

looks like a bacterial seq, many accessions, not just one

but high seq similarity to bacterial P450s

next gene 87bp upstream is 61% to

Oceanobacillus iheyensis BA000028.3

complement(1763606..1764175) biotin  synthase

New 45% to CYP205A1 Chloroflexus aurantiacus

40% to CYP197B1 Nostoc punctiforme

43% to CYP197A1 Bacillus halodurans

MLYDTRRTKMNETITGPKGLPITGNLLSFRRNPLQFIRSASKSHGDVVLFRFGPKRNVYLLTNPDHIKEVL

VTKQAHFRKGKGLQVAKAVVGDGILTSEGKKHLRQRRLMQPAFHRERIAAYGDVMVKQGV

DLMSEWRDGDVRDIHHDMMKVTLAIITETMFGKSVKEG

ASEIGHAIDVGLRYVANKASSFIDIPLSVPTRS

NREFLESNELLDKTIFSLIEARRNNDEPGNDLLGMLLAARDEEDGTGMTDEQVRDEVMTI

FVAGHETTANTMSWIFYLLARHPEAEKKLQEELATVLGERLPTVEDLPELKYTNLVVYES

LRLYPAAWTINREVVEEVEIG

GHTYQPGETLMMSQYVMHRDERFYENPDAFIPERFATDLLKQIPTFAFFPFGGGPRVCI

GNNFALMEATLLLATFAQRYQLRLAEPGQVVEPEPLVTLRPKNGLWMRLEKRG*

 

>AP006354.1 Lotus corniculatus var. japonicus genomic

CYP711 73% to 711A1

       MVFMDFEWLFQIPSVPWSS

33449  AMFTLLATIGGFLVYLYGPYWGVRKVPGPPSVPLIGHL

       PLLAKYGPDVFSVLAKQYGPIYR  (2) 33631

35424  FHMGRQPLIIIADAELCKEAGIKKFKDITNRSIPSPISASPLHQKGLFFTK (2)  35576

36301  RDSQWSTMRNTILSLYQPSHLSRLVPTMQSFIESATQNLDSQNEDFIFSNLSLSLATDVI  36480

36481  GQAAFGVDFGLSRPQSVRDESGNKEVRGSGAGNEVSDFINQHIYSTTQLKMDLSGSFSII  36660

36661  LGLLVPILQEPFRQILKRIPGTMDWKIECTNRKLSGRLDEIVEKRMKDKVRSSKDFLSLI  36840

36841  LNARESKTVSENVFTPDYISAVTYEHLLAGSATTSFTLSSIVYLVAGHPEVEKKMLQEID  37020

37021  GFGPVDQTPTSQDLQEKFPYLDQ (0) 37089

37517  VIKEAMRYYTVSPLVARETSNEVEIGGYLLPK (0) 37612

37756  GTWVWLALGVVAKDPRNFPEPEKFKPERFDPKCEEMKRRHPYAFIPFGIGPRACI  37920

37921  GQKFSLQEIKLSLIHLYRKYLFRHSPNMENPLELEYGIVLNFKHGVKVRAIKRTERSC*  38097

 

>AC152551.31 Medicago truncatula CYP711 71% to 711A1

64274  MLFISVILNVPLASTIFILVTLMGG

64199  LVGYLYWPFWKLRKVPGPPSLPLVGHLPLLAKYGPDVFSVLAKQYGPIYR (2) 64050

63581  FHMGRQPLIIIADAELCKEVGIKKFKEIPNRSIPSPISASPLHQKGLFFTR (2) 63429

62783  NSQWSTMRNTILSVYQPSHLANLVPKMQSFIESATQNLDDTSKEDIIFSNLSLRLATDV  62607

62606  IGDAAFGVNFGLSKPHSICESMNNVEQSSANSDEVSIFINQHIYSTTQLKMDLSGSFSII  62427

62426  IGLIAPILQEPIRQILKRIPGTMDWKMECTNKNLTGRLDDIVKKRMEDKSRTSKNFLSLI  62247

62246  LNTRESKSVSENVFSFDYISAVTYEHLLAGSATTSFTLSSIVYLVAGHPNVEEKLLQEID  62067

62066  GFGPHDKIPNAKDLNESFPYLDQ (0)

61892  VIKEAMRIYTVSPLVARETSNEVEIGGYLLPK (0) 61797

61455  GTWVWLALGVLAKDSRNYAEPEKFKPERFDPKCGEMKRRHPYAFIPFGIGPRACIGQKF  61279

61278  SLQEIKLTLIHLYRKYIFRHSLNMEKPVELEYGLVLNFKHGIKLRVIKRT*  61126

 

>CO485377.1 Picea glauca 58% to 711A1 Arab. N-term

DR542186.1 CO484132.1 Picea sitchensis DR544135.1 64% to CYP711A1

1    DLCREVGIKKFKQFSNRSIPSPIASSPLHQKGLFFTRDSRWSSMRGAIQPLYQTGRISNL  180

181  LPVMERVVCVLKRKLAAKEETDDIDFSELLLRVATDIIGEAAFGERFGLTEETTTISSSN  360

361  PAEVSEFIKQHVYSTSSLKMDLNGTFSILVGILFPIAQELFRQILSRIPGTGDWKVCINN  540

541  RRLTHRLNAIVEKRKKDVVGKEKRMDFLSTVTGSKFSRELFSEEYISALTYEHLLA  708

709  XSATTSFTISVILYLVSAHPDVESKLLREIDEFXXPDRXPAAEDLDIKFPYLTQVI

KEAMRFYTVSPLVAREASEPVQIGGYMLPKGTWVWMALNALAKDPRYFPEPEMFNPERFD

PDCEEEKNRHPYANSPFGIGPRACIGMKFAFQEIKVVLIHLYQLYTFDHSPAMENPLEFQ

FGIVVSVKYGIRLRLQHRRAQSPV*

 

>Helicosporidium sp. CX129156 CX128716.1 CYP711 like fragment

44% to CYP711A1

non-photosynthetic, pathogenic green alga

LSQCPFVEAVINETLRIFPPAHAVIRECT

QACEIGNGIFIPQGTEVHLAIYTLHHDPSLWHKPEAFRPERFLPGEEADTRHPNAFMPFG

IGPRMCIGWRFAMQELMLILIRLYQRYTFELSPAQKSTPLKIRQRLTLSPLEGVWVTPVP

RSCTAMQDDAATTNAL*