>Cyp1a1        Mm.14089 genbank X01681
MPSMYGLPAFVSATELLLAVTVFCLGFWVVRATRTWVPKGLKTP
PGPWGLPFIGHMLTVGKNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVR
QGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASS
CYLEEHVSKEANYLVSKLQKVMAEVGHFDPYKYLVVSVANVICAICFGQRYDHDDQEL
LSIVNLSNEFGEVTGSGYPADFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRT
FEKGHIRDITDSLIEHCQDRKLDENANVQLSDDKVITIVLDLFGAGFDTVTTAISWSL
MYLVTNPRVQRKIQEELDTVIGRDRQPRLSDRPQLPYLEAFILETFRHSSFVPFTIPH
STTRDTSLNGFYIPKGCCVFVNQWQVNHDRELWGDPNEFRPERFLTPSGTLDKRLSEK
VTLFGLGKRKCIGETIGRSEVFLFLAILLQQIEFKVSPGEKVDMTPTYGLTLKHARCE
HFQVQMRSSGPQHLQA

>Cyp1a2        Mm.15537 genbank X00479
MAFSQYISLAPELLLATAIFCLVFWMVRASRTQVPKGLKNPPGP
WGLPFIGHMLTVGKNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVRQGD
DFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSASSCYL
EEHVSKEANHLVSKLQKAMAEVGHFEPVSQVVESVANVIGAMCFGKNFPRKSEEMLNI
VNNSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKTFNDNFVLFLQKTVQEHYQDFNK
NSIQDITSALFKHSENYKDNGGLIPEEKIVNIVNDIFGAGFDTVTTAITWSILLLVTW
PNVQRKIHEELDTVVGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDT
SLNGFHIPKERCIYINQWQVNHDEKQWKDPFVFRPERFLTNNNSAIDKTQSEKVMLFG
LGKRRCIGEIPAKWEVFLFLAILLQHLEFSVPPGVKVDLTPNYGLTMKPGTCEHVQAW
PRFSK

>Cyp1b1        Mm.4443  genbank U03283
MATSLSADSPQQLSSLSTQQTTLLLLFSVLAAVHLGQWLLRQWQ
RKPWSSPPGPFPWPLIGNAAAVGQASHLYFARLARRYGDVFQIRLGSCPVVVLNGESA
IHQALVQQGSIFADRPPFASFRVVSGGRSLAFGHYSEHWKTQRRSAYSTMRAFSTRHP
RSRGLLEGHALAEARELVAVLVRRCAGGAFLDPTQPVIVAVANVMSAVCFGCRYNHDD
AEFLELLSHNEEFGRTVGAGSLVDVLPWLQLFPNPVRTTFRKFEQLNRNFSNFVLDKF
LRHRESLVPGAAPRDMTDAFILSAEKKASGAPGDDSSGLDLEDVPATITDIFGASQDT
LSTALLWLLILFTRYPDVQARVQAELDQVVGRDRLPCMSDQPNLPYVMAFLYESMRFS
SFLPVTIPHATTANTFVLGYYIPKNTVVFVNQWSVNHDPAKWPNPEDFDPARFLDKDG
FINKALASSVMIFSVGKRRCIGEELSKMLLFLFISILAHQCNFKANQNESSNMSFSYG
LTIKPKSFRIHVSLRESMELLDNAVKKLQTEEGCK

>Cyp2a4        Mm.14781 genbank J03549
MLTSGLLLVAAVAFLSVLVLMSV
WKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMK
ISQRYGPVFTIYLGSRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY
GIAFSSGERAKQLRSFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNG
AFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQ
VYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLE
EKKNPNTEFYMKNLVLTTQNLFFAGTETGSTTLRYGFLLLMKYPDIE
AKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPK
GTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKSDAFVPFSI
GKRYCFGEGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSPRLVGFVTIPPTYTMSFLSR

>Cyp2a4 NT_039410.1 + strand 6aa diffs with 2a4
269548 MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMK 269727
269981 ISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY 270142
270843 GIAFSSGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTN 270992
271258 GAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQ 271419
272544 YMDKEFLSLF*MMLGS 272591 exon 4 partial duplication
273037 VYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLE 273213
274519 EKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIE 274659
275098 AKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPK 275286
275887 GTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKSDAFVPFSI 276027
277034 GKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGFVTIPPTYTMSFLSR 277213

>Cyp2a4-de7b = Cyp2g-ps exon 7 AC087157.1 + strand bridges from 2a4 to 2b26p
37037 AKIHEEINQVIGTHRTPRVDDRAKMP 37114
37114 YTDAVIHEIQRLTDIVPLGIPHNVT 37188
37190 RDTHFRGY 37213

>Cyp2a5        Mm.4112 (retired) genbank X89864
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIG
NFLQLNTEQMYNSLMKISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRG
EQATFDWLFKGYGVVFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSF
RKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQ
LYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRML
EEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRV
IGRNRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVF
PMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKNDAFVPFSIGKRYCFGEGLARMELF
LFLTNIMQNFHFKSTQAPQDIDVSPRLVGFATIPPTYTMSFLSR

>Cyp2a12 Mm.20770 genbank L06463 NW_000310.1|Mm7_WIFeb01_156
MLGSGLLLLAILAFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNYLQLNRKDVYSSITQ
LQEHYGPVFTIHLGPRRVVVLYGYDAVKEALVDHAEEFSGRGEQATFNTLFKGY
GVAFSNGERAKQLRRFSIATLRDFGMGKRGVEEHIQEEAGCLIKMLQGTC
GAPIDPTIYLSKTASNVISSIVFGDRFNYEDKEFLSLLQMMGQVNKFAASPTGQ
LYDMFHSVMKYLPGPQQQIIKDSHKLEDFMIQKVKQNQSTLDPNSPRDFIDSFLIHMQK
EKYVNSEFHMKNLVMTSLNLFFAGSETVSSTLRYGFLLLMKHPDVE
AKVHEEIDRVIGRNRQPQYEDHMKMPYTQAVINEIQRFSNFAPLGIPRRITKNTSFRGFFLPK
ATEVFPILGSLMTDPKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFST
GKRFCLGDSLAKMELFFLFTTILQNFRFKFPRKLEDINESPTPEGFTRIIPKYTMSFVPI*

>Cyp2a12 NT_039413.1 + strand
33243 MLGSGLLLLAILAFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNYLQLNRKDVYSSITQ 33419
33699 LQEHYGPVFTIHLGPRRVVVLYGYDAVKEALVDHAEEFSGRGEQATFNTLFKGY 33860
34873 GVAFSNGERAKQLRRFSIATLRDFGMGKRGVEERIQEEAGCLIKMLQGTC 35022
35239 GAPIDPTIYLSKTASNVISSIVFGDRFNYEDKEFLSLLQMMGQVNKFAASPTGQ 35400
36625 LYDMFHSVMKYLPGPQQQIIKDSHKLEDFMIQKVKQNQSTLDPNSPRDFIDSFLIHMQK 36801
38164 EKYVNSEFHMKNLVMTSLNLFFAGSETVSSTLRYGFLLLMKHPDVE 38301
38748 AKVHEEIDRVIGRNRQPQYEDHMKMPYTQAVINEIQRFSNFAPLGIPRRITKDTSFRGFFLPK 38936
39449 ATEVFPILGSLMTDPKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFST 39589
40602 GKRFCLGDSLAKMELFLFFTTILQNFRFKFPRKLEDINESPTPEGFTRIIPKYTMSFVPI* 40784

>2a12-de1b2b old CYP2a20p NW_000310 (52646-53186)
53186 MTLS 
      MLLVAVLTCFIAMITMSVLR*KKLLGK
      MPPGPTPLPFLGNFLELDTKKFYDSFLRVVLGREM (0) 52988
52810 IREWYGPVFTVHLGTYSAVVPWGYDVVKETLVDQAEQFSGRGEQAFLDWFFKGYG 52646

>2a12-de1b2b old Cyp2a20p NT_039413.1 - strand note: nuc. Numbering same as NW_00310
53186 MTLS 53175
53173 MLLVAVLTCFIAMITMSVLR*KKLLGKMPPGPTPLPFLGNFLELDTKKFYDSFLRVVGREM 52988
52810 IREWYGPVFTVHLGTYSAVVPWGYDVVKETLVDQAEQFSGRGEQAFLDWFFKGYG 52646

>Cyp2a21-ps 93% to Cyp2a5 runs off end NW_000308.1|Mm7_WIFeb01_154 also on NW_033707.1|MmUn_WIFeb01_40262
FFLGKRGIEEHIQEEVGLLIDSFRKTN
GAFIDTTFYLSRTVSNVISSIIFRDRFDYEDKEFLSLL*MMLGSFQFTATSMGQ
LYEMFSSVMKHLSGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLE
EKKNPNTEFYMKNLVLTTQNLFFAGTETVSTTLRYGFLLLMKHPDIE
AKVHKEIDWVTGRNWQPKYEDRMKMPYAEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPK
GTEVFPMLGSVLKDPKFFFNPKDFNPKHFLDDKGQFKKSDAFVPFSIG

>Cyp2a21-ps NT_039411.1 + strand seq = 20,879bp runs off end
15607 FFLGKRGIEEHIQEEVGLLIDSFRKTNG 15690
15948 GAFIDTTFYLSRTVSNVISSIIFRDRFDYEDKEFLSLL*MMLGSFQFTATSMGQ 16109
17609 LYEMFSSVMKHLSGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLE 17785
19308 EKKNPNTEFYMKNLVLTTQNLFFAGTETVSTTLRYGFLLLMKHPDIE 19448
19888 AKVHKEIDWVTGRNWQPKYEDRMKMPYAEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPK 20076
20678 GTEVFPMLGSVLKDPKFFFNPKDFNPKHFLDDKGQFKKSDAFVPFSIG 20821

>Cyp2a22 93% to Cyp2a12 NW_000308.1|Mm7_WIFeb01_154
MLGSGLLLVAILVFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNYLQLNRKDVYSSITQ 392
LQEHYGPVFTIHLGPRRVVVLYGYDAVKEALEDNAEEFSGRGEQATFNTLFKGYG 834
VTFSNGERAKQLRRFSIATLKDFGLGKRGMEERIQEEAGCLIKMLQGTC 1495
GAPIDPTMYLSKTVSNVISSIVFGDRFNYEDKEFLSLLQMMSQMNQFAASPTGQ 1874
LYDMFHSVMKYLPGPQQQIIKDSHKLEDFMIQKVKHNHSTLDPNSPRGFIDSFLIHMQK 3263
EKNFNSEFHMKNLVMTSLNLFFAGSETVSSLLRYGFLLLMKHPDVE 4834
AKVHEEIDRVIGRNRQPQYEDHMKMPYTQAVIHEIQR 5365
FSNFAPLGIPRRITKDTSFRGFFLPK 5443
GTDVFPIMGSLMIDPKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFSI 6101
GKRSCLGYSLGKMQLFLFFTTILQNFRFKFPRKLEDINESPKPEGFTRIIP 7191
KYTMSFVPI* 7221

>Cyp2a22 NT_039411.1 - strand
9051 MLGSGLLLVAILVFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNYLQLNRKDVYSSITQ 8875
8594 LQEHYGPVFTIHLGPRRVVVLYGYDAVKEALEDNAEEFSGRGEQATFNTLFKGY 8433
7921 GVTFSNGERAKQLRRFSIATLKDFGLGKRGMEERIQEEAGCLIKMLQGTC 7772
7560 GAPIDPTMYLSKTVSNVISSIVFGDRFNYEDKEFLSLLQMMSQMNQFAASPTGQ 7399
6177 LYDMFHSVMKYLPGPQQQIIKDSHKLEDFMIQKVKHNHSTLDPNSPRGFIDSFLIHMQK 6001
4591 EKNFNSEFHMKNLVMTSLNLFFAGSETVSSLLRYGFLLLMKHPDVE 4454
4009 AKVHEEIDRVIGRNRQPQYEDHMKMPYTQAVIHEIQRFSNFAPLGIPRRITKDTSFRGFFLPK 3821
3312 GTDVFPIMGSLMIDPKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFSI 3172
2225 GKRSCLGYSLGKMQLFLFFTTILQNFRFKFPRKLEDINESPKPEGFTRIIPKYTMSFVPI* 2043

>Cyp2a22-de1b2b = old Cyp2a23p 93% to CYP2a20p NW_011833.1|MmUn_WIFeb01_20427
MLLVAILTCFIAMITMSVLR*RKVLGKIPPGPTPLPFLGNFLELDTKKFYDSFLRV
VLGREM
IRELYGPVFTVHLGTHSAVVPWGYDVVKEALVDQAEQFSGRGEQAFLDWFFKDYG

>Cyp2b9        Mm.876   genbank M60273 AH000038
MDPSVLLLLAVLLSLFLLLVRGHAKIHGHLPPGPHPLPLLGNLLQMDRGGLLKCFIQ
LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDY
GIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ
GVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQ
MFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLDPSAPRDYIDTYLLRMEK
EKSNHNTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVT
EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPK
NTEVYPVLSSALHDPQYFEQPDKFNPEHFLDANGALKKCEAFLPFST
GKRICLGESIARNELFIFFTTILQNFSVASPVAPKDIDLTPKESGIGKIPPAHQIYFLAR*

>Cyp2b9 NT_039410.1 + strand missing exon 1, 5-9 are 147,000bp away. frameshift in exon 9
there is something wrong with the assembly here
11854 LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDY 12015
12158 GIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ 12307
12924 GVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQ 13085
160228 MFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLDPSAPRDYIDTYLLRMEK 160404
160854 EKSNHNTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVT 160994
162542 EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPK 62730
162901 NTEVYPVLSSALHDPQYFEQPDKFNPEHFLDANGALKKCEAFLPFST 163041
171866 GKRICLGESIARNELF 171913
171915 IFFTTILQNFSVASPVAPKDIDLTPKESGIGKIPPAHQIYFLAR* 172049

>Cyp2b9-de9b = old Cyp2b25p XM_145463 XP_145463 C-term aa 456-491
NFSVSSPVAPKDIDITLKESGLAKIPPVYKISFLAH

>Cyp2b9-de9b = old Cyp2b25p NT_039410.1 - strand 
196560 SGTRICLGEGIARSELFLFFTTILQ 196486
196484 NFSVSSPVAPKDIDITLKESGLAKIPPVYKISFLAH* 196374

>Cyp2b10/Cyp2b20 Mm.14177, Mm.13091 genbank M21856, AK028103
MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQMDRGGLLKSFIQ
LREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEY
GVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQ
GAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQ
MFELFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEK
EKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVA
EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPK
NTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFST
GKRICLGESIARNELFLFFTSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR

>Cyp2b10 NT_039407.1 + strand 
2015225 MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQMDRGGLLKSFIQ 2015395
2027784 LREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVVEPTFKEY 2027945
2028099 GVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQ 2028248
2030410 GAPLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQ 2030571
2031294 MFELFSGFLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEK 2031470
2031938 EKSNQHTEFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVA 2032078
2033479 EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPK 2033667
2033834 NTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFST 2033974
2042648 GKRICLGESIARNELFLFFTSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR 2042827

>Cyp2b13       Mm.14413 genbank M60358 AH000037
MDPSVLLLLAVLLSLFLLLVRGHAKIHGHLPPGPRPLPLLGNLLQMDRGGLLKCFIH
LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDY
GIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ
GAPLDPTFFFQCVTANIICSIVFGERFDYTDEQFLRLLNLMYQIYSLLRSFSCQ
MFELFSGLLKYFPGVHRQIAKNQQEILNFITHRVEKHRASLDPSEPRDFIDTYLLRMEK
EKSNHNTEFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVA
GKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPK
NTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFST
GKRICLGESIARNELFLFFTSILQNFSVASPVASKDIDLTPKESGIGKIPPTYQICFLAR*

>Cyp2b13 NT_039410.1 + strand missing exon 1
17242 LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAAQLVMQDY 17403
17533 GIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ 17682
18292 GAPLDPTFFFQCVTANIICSIVFGERFDYTDEQFLRLLNLMYQIYSLLRSFSCQ 18453
22812 MFELFSGLLKYFPGVHRQIAKNQQEILNFITHRVEKHRATLDPSEPRDFIDTYLLRMEK 22988
23441 EKSNHNTEFHHQNLMMSVLSLFFAGTETTSTTLCCGFLLMLMYPHVA 23581
26191 GKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDIVPTGAPHRVTKDTMFRGYLLPK 26379
26548 NTEVYPILSSALHDPQYFEQPDSFNPDHFLDANGALKKSEAFLPFST 26688
32685 GKRICLGESIARNELFLFFTSILQNFSVASPVASKDIDLTPKESGIGKIPPTYQICFLAR* 32867

>Cyp2b13-de1b2b7b Cyp2b pseudogene NT_039410.1 + strand 
43894 XXXXXXDIFYMGAQPLLVLCGYEV*WEAPVDHSEVFLVYEDKAIIDPSSKKW 44031 ex 1
44377 XXFFVNGKPWNIVN*FLLTTTKDFEWKKRSIDNQIKVETLDLLLEC*KPHGDP 44529 ex 2
48130 LPVFVHWAQKPYTQASIHEIWRYGDFTHIG 48219 ex 7

>Cyp2b19       Mm.14098 genbank AF047529
MEFSVLLLLALTTGFLIFLVSQSQPKTHGHFPPGPRPLPFLGNLLQMDRRGLLSSFIQ
LQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGY
GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYK
GAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQ
VFELFSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLDPSAPRDFIDTYLLRMEK
EKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVA
EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPK
NTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGALKTNEAFMPFST
GKRICLGEGIARNELFLFFTTILQNFSLASPVAPENIDLIPNNSGATKTPPQYQIHFLSR

>Cyp2b19 NT_039410.1 + strand 
714276 MEFSVLLLLALTTGFLIFLVSQSQPKTHGHFPPGPRPLPFLGNLLQMDRRGLLSSFIQ 714449
716125 LQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIXXXX 716274
716440 GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYK 716589
719343 GAPLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQ 719504
720443 VFELFSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLDPSAPRDFIDTYLLRMEK 720619
721350 EKSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVA 721490
723840 EKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPK 724028
724204 NTEVYPILSSALHDPRYFEQPDSFNPEHFLDANGALKTNEAFMPFST 724344
728220 GKRICLGEGIARNELFLFFTTILQNFSLASPVAPENIDLIPNNSGATKTPPQYQIHFLSR 728399

>Cyp2b19-de7b8b9b = old Cyp2b24p XM_145467 XP_145467 exons 7-9
EKGVLSIVPLF
CSEKVQKETDQVIGSHQLPTLDDRTKMPYTDTVIHEIQRFSDLAAIDLPHRVTIHTLS
QVYLLPKNTEVYPILSSYFEQLDCFNPEHFLDANGTLKKSEAFLPFST
GKHVCLGKGIAHNELFLFFPTILQNFPVSVPLAPKDIDITPKESGTGKIPQCTRSAS

>Cyp2b19-de7b8b9b = old Cyp2b24p NT_039410.1 + strand 
695673 EKVQKETDQVIGSHQLPTLDDRTKMPYTDTVIHEIQRFSDLAAIDLPHRVTIHTLSQVYLLPK 695861
696036 NTEVYPILSSVLLDP 696080
696083 QYFEQLDCFNPEHFLDANGTLKKSEAFLPFST 696178
702801 GKHVCLGKGIAHNELFLFFPTILQNFPVSVPLAPKDIDITPKESGTGKIPQCTRSAS 702971

>Cyp2b23 new mRNA seq XM_145466 Nov. 17, 2002
MEPSVLLLLALLTGFLLLLIRGQPKAYSRLPPGPRPLPFLGNLLQMDRGGLLKSFIK
LRDKHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVIQPIVQDY
GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYE
GAPLDPTFLFQCITANIICSIVFGERFDYTDHQFLHLLDLFYQTLSLISSFSSQ
LFELFSAVMKYFPGTHRQISKNIQEILNYIGHSVEQHKATLDPSAPRDFIDTYLLRMEK
EKSNHHTEFHHQNLLISVLSLFFAGTETTSTTLRYGFLLMLKYPHVA
EKVQKEIDQVISAHHVPTLEDRIKMPYTEAVIHEIQRFSDLAPIGLPHTVTKDTVFRGYLLPK
NTEVYPILSSALHDPQYFEQPDKFNPEHFLDANGALKKSEAFLPFST
GKRICLGEGIARNELFLFFTALLQNFSLSSPVAPEDIDLTPKESGFVKIPPVYRICFLPR

>Cyp2b23 NT_039410.1 - strand 
643237 MEPSVLLLLALLTGFLLLLIRGQPKAYSRLPPGPRPLPFLGNLLQMDRGGLLKSFIK 643067
638566 LRDKHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVIQPIVQDY 638405
638272 GVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYE 638123
636361 GAPLDPTFLFQCITANIICSIVFGERFDYTDHQFLHLLDLFYQTLSLISSFSSQ 636200
631405 LFELFSAVMKYFPGTHRQISKNIQEILNYIGHSVEQHKATLDPSAPRDFIDTYLLRMEK 631229
630677 EKSNHHTEFHHQNLLISVLSLFFAGTETTSTTLRYGFLLMLKYPHVA 630537
629405 EKVQKEIDQVISAHHVPTLEDRIKMPYTEAVIHEIQRFSDLAPIGLPHTVTKDTVFRGYLLPK 629217
629046 NTEVYPILSSALHDPQYFEQPDKFNPEHFLDANGALKKSEAFLPFST 628906
622253 GKRICLGEGIARNELFLFFTALLQNFSLSSPVAPEDIDLTPKESGFVKIPPVYRICFLPR 622074

>Cyp2b26-ps combined with 2b27p
2b26p and 2b27p were thought to be the same pseudogene
but they are nearly exact duplicates
EKCGGVFTVHQGLITLCGTDTMRDALVNHAKAFSGWRTIAVLQPIMQHY 
GVFFVNGECWKTLH*FILATMRDFGMRNWSVEKIKEEVQCLVEELKKYQ
PLDPTFLFQCITANIICSIVFVEHYDYTDHQFLHQLDLLYRTFSLISSFSGQM
VIELSSGFLKYIPGTHRQISK
NL*EILHYTDRSVEKHSANLDPSDPQDFINTYRLHMEK
EKSKHYMEFHQRTL
XXXXXXXXXXXTESTSTALCYDFLLRLK*PHVX
EKVQKEINQVIGSYQVPTLDDHSKVPYTVTVIHKIQRFSEVSPMGLPCRXXXXXXXXXXXXXX
NTEVYPILISVAPMIHSTLDTFNPEHFLDASGAPKKNEAFMPFST
17842 GNHICLGEGIAHNELFLFFTTILQNFSVSSPVAPKDIDITPKESGITKIPTVYQICLL 18015

>Cyp2b26p AC087157 numbering is amino acid position
note: 2b26p and 2b27p were thought to be the same pseudogene
but they are nearly exact duplicates
164 PLDPTFLFQCITANIICSIVFVEHYDYTDHQFLHQLDLLYRTFSLISSFSGQ 216
217 VIELSSGFLKYIPGTHRQISK 236
237 NL*EILHYTDRSVEKHSANLDPSDPQDFINTYRLHMEK 274
275 EKSKHYMEFHQRTLXXXXXXXXXXX 288
300 TESTSTALCYDFLLRLK*PHV 320

>Cyp2b27-ps XM_145461 XP_145461 XM_145462 XP_145462 NW_029749.1|MmUn_WIFeb01_36697
2b26p and 2b27p were thought to be the same pseudogene
but they are nearly exact duplicates EKCGGVFTVHQGLITLCGTDTMRDALVNHAKAFSGWRTIAVLQPIMQHY 
GVFFVNGECWKTLH*FILATMRDFGMRNWSVEKIKEEVQCLVEELKKYQ
PLDPTFLFQCITANIICSIVFVEHYDYTDHQFLHQLDLLYRTFSLISSFSGQM
EILHYTDRSVEKHSANLDPSDPQDFINTYRLHMEK
EKVQKEINQVIGSYQVPTLDDHSKVPYTVTVIHKIQRFSEVSPMGLPCR
NTEVYPILISVAPMIHSTLDTFNPEHFLDASGAPKKNEAFMPFST
17842 GNHICLGEGIAHNELFLFFTTILQNFSVSSPVAPKDIDITPKESGITKIPTVYQICLL 18015

>Cyp2b27-ps  NT_039407.1 - strand note: 2b26p and 2b27p were thought to be the same pseudogene but they are nearly exact duplicates
2140720 EKCGGVFTVHQGLITLCGTDTMRDALVNHAKAFSGWRTIAVLQPIMQHY 2140574
2140431 GVFFVNGECWKTLH*FILATMRDFGMRNWSVEKIKEEVQCLVEELKKYQ 2140285
2133215 XXPLDPTFLFQCITANIICSIVFVEHYDYTDHQFLHQLDLLYRTFSLISSFSGQ 2133060
2131112 VIELSSGFLKYIPGTHRQISK 2131050
2131048 NL*EILHYTDRSVEKHSANLDPSDPQDFINTYRLHMEK 2130935
2130475 EKSKHYMEFHQRTLXXXXXXXXXXX 2130434 
2130429 TESTSTALCYDFLLRLK*PHVX 2130367
2127511 EKVQKEINQVIGSYQVPTLDDHSKVPYTVTVIHKIQRFSEVSPMGLPCR 2127365
2127161 NTEVYPILISVAPMIHSTLDTFNPEHFLDASGAPKKNEAFMPFST 2127027

>Cyp2b28-ps XM_133252.2 XP_133252.1
MEPSVLLLLAVLLSLFLLLVRGHAKVHGHLPPGPRPLPLLGNLLQMDRGGLLKYFIQ
LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGGTIAAAQLVMQDY
GIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ
GAPLDPTFLFQ

>Cyp2b28-ps NT_039407.1 + strand 
2066838 MEPSVLLLLAVLLSLFLLLVRGHAKVHGHLPPGPRPLPLLGNLLQMDRGGLLKYFIQ 2067008
2096010 LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSG 2096129
2096129 GTIAAAQLVMQDY 2096167
2096317 XXFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ 2096460
2097064 GAPLDPTFLFQCITANIICSIVFGEHFDYTDDQFLHLLNLMC*IYSLLSSFSCQ 2097225
2100114 MFELFSGFLKYFPGVHRQIAKSQQEIIDFIAHHVEKHRATLEPSAPRDFIDTYLLRMEK 2100290
2100742 EKSNHNTEFHHQNLIMSVLDLFFAGPETTSTTLRSGFLLMLKYPHVA 2100882

>Cyp2c29       Mm.20764 genbank D17674
MDLVVFLALTLSCLILLSLWRQSSGRGKLPPGPTPLPIIGNFLQIDVKNISQSFTN
FSKAYGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKMIKGF
GVVFSNGNRWKEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTK
GSPCDPTFILSCAPCNVICSIIFQNRFDYKDKEFLILMDKINENVKILSSPWLQ
VCNSFPSLIDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVTNPRDFIDYYLIKQKQ
VNHIEQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVT
AKVQEEIDRVVGRHRSPCMQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPK
GTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFKKSDYFMPFST
GKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNGFASLPPPYQLCFIPL*

>Cyp2c29 NT_039689.1 + strand 
5621921 MDLVVFLALTLSCLILLSLWRQSSGRGKLPPGPTPLPIIGNFLQIDVKNISQSFTN 5622088
5625532 FSKAYGPVFTLYLGSKPTVILHGYEAVKEALIDRGEEFAGRGSFPMAEKIIKGF 5625693
5625859 GVVFSNGNRWKEMRRFTLMTLRNLGMGKRNIEDRVQEEAQCLVEELRKTK 5626008
5642413 GSPCDPTFILSCAPCNVICSIIFQNRFDYKDKEFLILMDKINENVKILSSPWLQ 5642574
5644461 VCNSFPSLIDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVTNPRDFIDYYLIKQKQ 5644637
5656344 VNHIEQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVT 5656484
5659698 AKVQEEIDRVVGRHRSPCMQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPK 5659886
5663898 GTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNGNFKKSDYFMPFST 5664038
5665045 GKRICAGEGLARMELFLILTTILQNFKLKSLVHPKEIDITPVMNGFASLPPPYQLCFIPL* 5665227

>Cyp2c37       Mm.28533 genbank AF047542 ESTs AI255551
              AI255553, AI315987, AI119584
MDPILVLVLTLSCLFLLSLWRQSSERGKLPPGPTPLPIIGNILQIDVKDICQSFTN
LSKVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGEEFAGRGRFPVFDKATNGM
GLAFSKGNVWKNTRRFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTN
GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLMEKLNEITKILSSPWLQ
ICNTYPALLDYCPGSHKQFFKNYACIKNFLLEKIKEHEESLDVTIPRDFIDYFLINGGQ
EDGNQPLQNRLEHLAITVTDLFSAGTETTSTTLRYALLLLLKYPHVT
AKVQKEIEHVIGKHRSPCMQDRSRMPYTDAMIHEVQRFIDLIPNSLPHEVTCDIKFRNYFIPK
GTTVITSLSSVLHDSTEFPNPEVFDPGHFLDGNGKFKKSDYFMPFST
GKRICAGEGLARMELFLFLTSILQSFNLKPLVHPKDIDVTPMLIGLGSVPPAFQLCFIPS*

>Cyp2c37 NT_039692 missing exon 6
77756 MDPILVLVLTLSCLFLLSLWRQSSERGKLPPGPTPLPIIGNILQIDVKDICQSFTN 77923
79041 LSKVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGEEFAGRGRFPVFDKATNGM 79202
79366 GLAFSKGNVWKNTRRFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTN 79515
79765 GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLMEKLNEITKILSSPWLQ 79926
81028 ICNTYPALLDYCPGSHKQFFKNYASIKNFLLEKIKEHEESLDVTIPRDFIDYFLINGGQ 81204

87213 AKVQEEIEHVIGKHRSPCMQDRSRMPYTDAMIHEVQRFIDLIPNSLPHEVTSDIKFRNYFIPK 87401
95208 GTTVITSLSSVLHDSTEFPNPEKFDPGHFLDENGKFKKSDYFIPFST 95348
97119 GKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDVTPMLIGLASVPPAFQLCFIPS* 97301

>Cyp2c38       no UNIGENE entry genbank AF047725 no ESTs
DLVTFLVLTLSSLILLSLWRQRSRRGRLPPGPTPFPIIGNFLQIDVKNFNQSLTN
FSKAYGPVFTLYLGSRPIVVLHGYEAVKEALIDHGEEFSGRGNIPMSEKINNGL
GITFSNGNSWKETRHFTLMTLRNLGMGKRNIEDRVREEAQCLVEELRKTK
GSPCDPTFILSCAPCNVICSIIFQDRFHYKDKDFLMLMKKLNENVKILSSPWLQ
VCNNFPLLIDYCPGSHHKVLKNFKYIRSYLLEKVKEHQASLDFTNPRDFIDYFLIKQKQ
ANHIEQAEYSLENLVCTINNLFAAGTETTSTTLRYALLLLMKYPDVT
AKVQEEIDHVVGRHRSPCMQDRSHMPYTDAMIHEVQRFINLVPNNLPHAVTCDIKFRNYIIPK
GTTVVTSLTSVLHDSKEFPNPEMFDPGHFLDANGNFKKSDYFMTFSA
GKRVCAGEGLARMELFLILTTILQNFKLKSLVHPKDIDMMPFVNGLIALPPHYQLCFIPL*

>Cyp2c38 NT_039689.1 - strand missing exons 8,9
5794411 MDLVTFLVLTLSSLILLSLWRQRSRRGRLPPGPTPFPIIGNFLQIDVKNFNQSLTN 5794244
5792096 FSKTYGPVFTLYLGSRPIVVLHGYEAVKEALIDHGEEFSGRENIPMSEKINNGL 791935
5791770 GITFSNGNSWKETRRFTLMTLRNLGMGKRNIEDRVREEAQCLVEELRKTK 5791621
5769621 GSPCDPTFILSCAPCNVICSIIFQDRFDYKDKDFLMLMKKLNENVKILSSPWLQ 5769460
5767476 VCNNFPLLIDYCPGSHHKVLKNFKYIRSYLLEKVKEHQESLDVTNPRDFIDYFLIKQKQ 5767300
5735481 ANHIEQAEYSLENLVCTINNLFAAGTETTSTTLRYALLLLMKYPDVT 5735341
5732473 AKVQEEIDHVVGRHRSPCMQDRSRMPYTDAMIHEVQRFINLVPNNLPHAVTCDIKFRNYIIPK 5732285

>Cyp2c39 no UNIGENE entry genbank AF047726 EST AA882179 BF659956.1
DLVTFLVLTLSSLILLSLWRQSCGRGSLPPGPTPFPIIGNFLQIDMKNFSQSLTN
FSKAYGPVFTLYLGSRPTVVLHGYEAVKEALIDHGEEFSDRGSIPMVEKINNGL
GIVFSNGNRWKEIRRFTLTTLRNLGMGKRNIEDRVQEEAQCLVEELRKTK
GSPCDPTFILSCAPCNVICSIIFQDRFDYKDKDFLMLMEKLNENVKILSSPWLQ
VCNNFPLLIDYCPGSHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQ
ANHIQQAEFSLENLACTINNLFAAGTETTSTTLRYALLLLMKYPDVT
AKVQEEIDHVIGRHRSPCMQDRNHMPYTDAMIHEVQRFINLVPNNIPRAVTCDIKFRNYLIPK
GTTVVTSLTSVLHDSKEFPNPELFDPGHFLDANGNFKKSDHFMPFSA
GKRVCAGEGLARMELFLFLTTILQNFKLKPLVHPKDIDMIPFVNGLIALPPHYQVCIIPR*

>BF659956.1 maa25f10.y1 NCI_CGAP_Li10 cDNA clone Length = 579
supports the weak genomic region with a gap and duplicate exons 4,6
Query: 69  SHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQANHIQQAEFSLENLA 128
           SHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQANHIQQAEFSLENLA
Sbjct: 1   SHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQANHIQQAEFSLENLA 180

Query: 129 CTINNLFAAGTETTSTTLRYALLLLMKYPD 158
           CTINNLFAAGTETTSTTLRYALLLLMKYPD
Sbjct: 181 CTINNLFAAGTETTSTTLRYALLLLMKYPD 270

>Cyp2c39 NT_039689.1 + strand duplicate exon 6
5842265 MDLVTFLVLTLSSLILLSLWRQSCGRGSLPPGPTPFPIIGNFLQIDIKNVSQSLTN 5842432
5844567 FSKAYGPVFTLYLGSRPTVVLHGYEAVKEALIDHGEEFSDRGSIPMVEKINNGL 5844728
5844893 GIVFSNGNRWKEIRRFTLTTLRNLGMGKRNIEDRVQEEAQCLVEELRKTK 5845042
5871194 GSPCDPTFILSCAPCNVICSIIFQDRFDYKDKDFLMLMEKLNENVKILSSPWLQ 5871355
5873314 VCNNFPLLIDYCPGSHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQ 5873490
5895354 ANHIQQAEFSLENLACTINNLFAAGTETTSTTLRYALLLLMKYPDVT 5895494
5895730 ANHIQQAEFSLENLACTINNLFAAGTETTSTSLINARLLFVRDPNVT 5895870 = Cyp2c39-ie6b
5898697 AKVQEEIDHVIGRHRSPCMQDRNHMPYTDAMIHEVQRFINLVPNNIPRAVTCDIKFRNYLIPK 5898885
5901759 GTTVVTSLTSVLHDSKEFPNPELFDPGHFLDANGNFKKSDHFMPFSA 5901899
5903001 GKRVCAGEGLARMELFLFLTTILQNFKLKSLVHPKDIDMIPFVNGLIALPPHYQVCIIPR* 5903183

>Cyp2c39-ie6b NT_039689.1 + strand duplicate exon 6
5895730 ANHIQQAEFSLENLACTINNLFAAGTETTSTSLINARLLFVRDPNVT 5895870 = Cyp2c39-ie6b

>Cyp2c40       Mm.29973 genbank AF047727 86 ESTs follow AI255979
MDPFVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDMKDIGQCLTN
FSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTGK
GIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTN
GSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKVNECTEILSSPGCQ
IFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQ
KNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHIT
AKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPK
GTQVMTSLTSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFMPFSA
GKRICVGESLARMELFLFLTTILQNFKLKPLVDPKDIDMTPKHSGFSKIPPNFQMCFIPVE*

>Cyp2c40 NT_039691 exons 2-6
26048 FSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTGK 25887
25687 GIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTN 25538
22316 GSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKVNECTEILSSPGCQ 22155
21038 IFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQ 20862
 5279 KNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHIT 5139

>Cyp2c44       Mm.26457 23 ESTs follow AI317668
MELLGLPTLALLVLVMSLSLLSVWTKMRTGGRLPPGPTPLPIIGNILQLDLKDIPASLSK
LAKEYGPVYTLYFGSWPTVVLHGYDVVKEALLNQGDEFLGRGPLPIIEDSQKGH
GIVFSEGERWKLLRRFSLMTLKNFGMGKRSLEERVQEEARCLVEELHKTE
AQPFDPTFILACAPCNVICSILFNERFPYNDKTFLNLMDLLNKNFYQLNSIWIQ
MYNLWPTIMKYIPGKHREFSKRLGGVKNFILEKVKEHQEFLDPANPRDYIDCFLSKIEE
EKHSLKSDFNLENLAICGSNLFTAGTETTSTTLRFGLLLLVKHPEVQ
AKVHEELDRVIGRHQPPSMKDKMKLPYTDAVLHEIQRYITLLPSSLPHAVVQDTKFRHYVIPK
GTAVFPFLSSILLDQKEFPNPEKFDPGHFLDKNGCFKKTDYFVPFSL
GKRSCVGEGLARMELFLFFTTILQKFSLKALVEPKDLDIKPVTTGLFNLPPPYKLRLVPR

>Cyp2c50 BC011222.1
MDPILVLVFTLSCLFLLSLWRQSSERGKLPPGPTPLPIIGNILQINVKDICQSFTN
LSKVYGPVYTLYLGNKPTVVLHGYEAVKEALVDHGEEFAGRGRLPVFDKATNGM
GIIFSKGNVWKNTRRFSLTTLRNLGMGKRSIEDRVQEEARCLVEELRKTN
GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLMEKLNEITKIMSTPWLQ
VCNTFPVLLDYCPGSHNKVFKNYACIKNFLLEKIKEHEESLDVTIPRDFIDYFLINGGQ
EDGNYPLKNRLEHLAITVTDLFSAGTETTSTTLRYALLLLLKYPHVT
AKVQEEIEHVIGKHRSPCMQDRSRMPYTDAMIHEVQRFIDLVPNSLPHEVTCDIKFRNYFIPK
GTNVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFKKSDYFMPFST
GKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDVTPMLIGLASVPPAFQLCFIPS

>Cyp2c50 NT_039692 + strand
176707 MDPILVLVFTLSCLFLLSLWRQSSERGKLPPGPTPLPIIGNILQINVKDICQSFTN 176874
177228 LSKVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGEEFAGRGRLPVFDKATNGM 177389
177552 GIIFSKGNVWKNTRRFSLTTLRNLGMGKRSIEDRVQEEARCLVEELRKTN 177701
177951 GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLMEKLNEITKIMSTPWLQ 178112
179211 VCNTFPVLLDYCPGSHNKVFKNYACIKNFLLEKIKEHEESLDVTIPRDFIDYFLINGGQ 179387
183835 ENGNYPLKNRLEHLAITVTDLFSAGTETTSTTLRYALLLLLKYPHVT 183975
185072 AKVQEEIEHVIGKHRRPCMQDRSHMPYTDAMIHEVQRFIDLVPNSLPHEVTCDIKFRNYFIPK 185260
198149 GTNVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFKKSDYFMPFST 198289
200344 GKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDVTPMLIGLASVPPAFQLCFIPS 200523

>Cyp2c52p sequence shown is from Ensembl mouse version 3
19.38000001-39000000 chromosome 19 add 38 million to numbers for global location
Cyp2c52p one stop codon two frameshifts and a deletion
XM_140720 missing first 70 aa, insertion of 33 aa before WXXR motif,
missing 11 aa after WXXR motif, missing 14 aa before EXXR motif 
628318 MDPVLVLVLTLSCLLLLS*WRQNSGRGKLPPGPTPLPIIGNILQIDVKNTGQSVGK 628367
630645 FSKVYGPVFTLYFGMKPSVVLHGYEAVKEALVDLGEGFSGRGSFPVAEKASKGL 630806
630954 GIIFSNGMKWKEIRRFSVMT 631013  frameshift                        
631012 LRNFGMGKRSVEDRVQEEARCLVEELRNGK 631101                        
636385 XAPCDPTFILGCAPCNVICSIIFQKRFDYKDQTFLNLMDKFNENFRILSTPWIQ 636425
639913 VCNTFPAIIDYFPGSHNQVLKNFSYIKKNYVLEKVKKHQESLDMENPRDFIDCFLIKMKQ 639972
710041 EKHSLQSEFTHESLVATVTDMFGAGTETTSNTLRYGLLLLLKHVDIT 710181     
713060 AKVQEEIERVVGRHRSPCVQDRSHM 713134  4 aa deletion and f.s.         
713136 AVVHETQRYIVLIPTNLPHSVTCDAKFRNYFIPK 713237                        
715864 GTTVITSLTSMLHDDKEFPNPEKFDPGYFLDERGNVKKSDYFVPFSA 716004       
717828 GKRMCAGEGLTGMELFLFFTIILQNFNLKPLVDVKDIDTTPVVSGFGHVPPLYQARFIPV* 718010

>Cyp2c52p NT_039689.1 + strand
5253584 MDPVLVLVLTLSCLLLLS*WRQNSGRGKLPPGPTPLPIIGNILQIDVKNTGQSVGK 5253751
5255911 FSKVYGPVFTLYFGMKPSVVLHGYEAVKEALVDLGEGFSGRGSFPVAEKASKGL 5256072
5256220 GIIFSNGMKWKEIRRFSVMT 5256279
5256278 LRNFGMGKRSVEDRVQEEARCLVEELRNGK 5256367
5261648 GAPCDPTFILGCAPCNVICSIIFQKRFDYKDQTFLNLMDKFNENFRILSTPWIQ 5261809
5265179 VCNTFPAIIDYFPGSHNQVLKNFSYIKKNYVLEKVKKHQESLDMENPRDFIDCFLIKMKQ 5265358
5335307 EKHSLQSEFTHESLVATVTDMFGAGTETTSNTLRYGLLLLLKHVDIT 5335447
5338326 AKVQEEIERVVGRHRSPCVQDRSHM 5338400 4 aa deletion and f.s.
5338402 AVVHETQRYIVLIPTNLPHSVTCDAKFRNYFIPK 5338503
5341130 GTTVITSLTSMLHDDKEFPNPEKFDPGYFLDERGNVKKSDYFVPFSA 5341270
5343094 GKRMCAGEGLTGMELFLFFTIILQNFNLKPLVDVKDIDTTPVVSGFGHVPPLYQARFIPV* 5343276

>Cyp2c53-ps 2CN6 currently 3 stop codons in frame
MDLISFLMLTLFCLILLSLWSQSSGRGKLPPGPTPVPIIVSLLQLDVKNITQSSTN
FSKVYGPVFTLYLGMKPTVVLHGYEAVKEALIDHGEEFAVKGIFPLAEKNSKAL
LSGFML*FLFLFV*EFTLMTLKNLGMGKRNIEDRVQEEAQCLVEELRKTN
GSLCDPTFILGCAPCNVTCSIIFQNHFDYKDQDFLSLMEKINENTKIVSTPWIQ
VVKFSPVLIVYCPGSHKTVPENAYYIEIYILKKIKEHQESLDVTNPLDFIDYYLIKCKQ
EYHNHYSELTLKILSTTVTDFFGAGTETTSTTLRYALLLLMTYPEVT
AKIQDENDHVVGKHRNLCMQDRSHMPYTFAMIH*VQRFIDLLPTNLPHAVTCDIKFRNYIILK
GTAVITSLSSVLHDRKEFLNPEMFDPGHFLDGNGNFKKSDHFMPFSA
GKRVCVGEGLACMELFLFLTTALQNFKLKPLVHPKDINTTPVLNGFASVPLFYELCSIPL*

>Cyp2c53-ps NT_055131.1|MmUn_55171_30 Length = 29105 + strand exon 1
28409 MDLISFLMLTLFCLILLSLWSQSSGRGKLPPGPTPVPIL 28525

>Cyp2c53-ps NT_052356.1|MmUn_52396_30 Length = 3105 + strand exons 2,3
1412 FSKVYGPVFTLYLGMKPTVVLHGYEAVKEALIDHGEEFAVKGIFPLAEKNSKGL 1573
1882 LSGFML*FLFLFV*EFTLMTLKNLGMGKRNIEDRVQEEAQCLVEELRKTN 2031

>Cyp2c53-ps NT_039689.1 + strand exons 4-9 (8 diffs)
5586471 GSLCDPTF 5586494
5586494 LLGCAPCNVTCSIIFQNHFDYKDQDFLSLMEKINENTKIVSTPWIQ 5586631
5587710 VM*FSPVLIVYCPGSHKTVPENAYYIEIYILKKIKEHQESLDVTNPLDFIDYYLIKCKQ 5587886
5589527 EYHNHYSELTLKILSTTVTDFF 5589592
5589594 GAGTETSTTLRYALLLLMTYPEVT 5589665
5606248 AKIQDEIDHVVGQHRSLYMQDRSHMSYTFAMIH*VQRFIDLLPTNLPHAVTCDIKFRNYIILK 5606436
5608018 GTAVITSLSSVLHDRKEFLNPEMFDPGHFLDGNGNFKKSDHFMPFSA 5608158
5609301 GKRVCVGEDLACMELFLFLTTALQNFKLKPLVHPKDINTTPVLNGFASVPLFYELCSIPL* 5609483

>22. Cyp2c54     mouse 92% to 2c50 from mouse Ensembl version 3
19.39000001-40000000 chr 19 add 39 million to these numbers for global location
777086 MDPILVLVLTLSCLFLLSLWRQSYERGKLPPGPTPLPIIGNILQIDVKDICQSFTN 777039
775804 LSRVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGDVFAGRGRLPVFDKATNGM 775643   
775480 GIGFSNGSVWKNTRHFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTN 775331      
774882 GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLLEKLDEISKILSTPWLQ 774721
773617 VCNTFPALLDYCPGSHNQFFKNYAYIKNFLLEKIREHKESLDVTIPRDFIDYFLIKGAQ 773441 
751132 EDDNHPLKNNFEHLAITVTDLFIGGTESMSTTLRYALLLLLKYPHVT 750992   
749751 AKVQEEIEHVIGKHRRPCMQDRSHMPYTNAMIHEVQRFIDLVPNNLPHEVTCDIKFRNYFIPK 749563 
743820 GTTVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFKKSDYFMPFST 743680         
741906 GKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDITPMLIGLGSVPPAFQLCFIPS 741727 

>Cyp2c54 NT_039692 - strand
160912 MDPILVLVLTLSCLFLLSLWRQSYERGKLPPGPTPLPIIGNILQIDVKDICQSFTN 160745
159630 LSRVYGPVYTLYLGRKPTVVLHGYEAVKEALVDHGDVFAGRGRLPVFDKATNGM 159469
159306 GIGFSNGSVWKNTRHFSLMTLRNLGMGKRSIEDRVQEEARCLVEELRKTN 159157
158708 GSPCDPTFILGCAPCNVICSIIFQDRFDYKDRDFLNLLEKLDEISKILSTPWLQ 158547
157443 VCNTFPALLDYCPGSHNQFFKNYAYIKNFLLEKIREHKESLDVTIPRDFIDYFLIKGAQ 157267
134958 EDDNHPLKNNFEHLAITVTDLFIGGTESMSTTLRYALLLLLKYPHVT 134818
133577 AKVQEEIEHVIGKHRRPCMQDRSHMPYTNAMIHEVQRFIDLVPNNLPHEVTCDIKFRNYFIPK 133389
127646 GTTVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFKKSDYFMPFST 127506
125732 GKRICAGEGLARMELFLFLTSILQNFNLKPLVHPKDIDITPMLIGLGSVPPAFQLCFIPS 125553

>Cyp2c55     mouse 19.38000001-39000000 
chr 19 add 38 million to numbers to get global position
721844 MDPVLVLVLTLSCLLLLSLWRQNSGRGKLPPGPTPFPIIGNILQIDIKNISKSFNY 722011
725818 FSKVYGPVFTLYFGSKPTVVVHGYEAVKEALDDLGEEFSGRGSFQIFERINNDL 725979
726487 GVIFSNGTKWKELRRFSIMTLRSFGMGKRSIEDRIQEEASCLVEELRKAN 726636
733440 GSLCDPTFILSCAPSNVICSVIFHNRFDYKDEKFLNLMERLNENFKILNSPWMQ 733601
746116 VYNALPTLINYLPGSHNKVIKNFTEIKSYILGRVKEHQETLDMDNPRDFIDCFLIKMEQ 746292
749093 EKHNPHSEFTIESLMATVTDIFVAGTETTNITLRYGLLLLLKHTEVT 749233
750298 AKVQAEIDHVIGRHRSPCMQDRTRMPYTDAMVHEIQRYIDLIPNNVPHAATCNVRFRSYFIPK 750367
753216 GTELVTSLTSVLHDDKEFPNPEVFDPGHFLDENGNFKKSDYFMPFSI 753356 
757132 GKRMCVGEALARTELFLILTTILQNFNLKSLVDTKDIDTTPVANTFGRVPPSYQLYFIPR 757311

>Cyp2c55 NT_039689.1 + strand
5347110 MDPVLVLVLTLSCLLLLSLWRQNSGRGKLPPGPTPFPIIGNILQIDIKNISKSFNY 5347277
5351084 FSKVYGPVFTLYFGSKPTVVVHGYEAVKEALDDLGEEFSGRGSFQIFERINNDL 5351245
5351753 GVIFSNGTKWKELRRFSIMTLRSFGMGKRSIEDRIQEEASCLVEELRKAN 5351902
5358706 GSLCDPTFILSCAPSNVICSVIFHNRFDYKDEKFLNLMERLNENFKILNSPWMQ 5358867
5371382 VYNALPTLINYLPGSHNKVIKNFTEIKSYILGRVKEHQETLDMDNPRDFIDCFLIKMEQ 5371558
5374359 EKHNPHSEFTIESLMATVTDIFVAGTETTNITLRYGLLLLLKHTEVT 5374499
5375564 AKVQAEIDHVIGRHRSPCMQDRTRMPYTDAMVHEIQRYIDLIPNNVPHAATCNVRFRSYFIPK 5375752
5378482 GTELVTSLTSVLHDDKEFPNPEVFDPGHFLDENGNFKKSDYFMPFSI 5378622
5382398 GKRMCVGEALARTELFLILTTILQNFNLKSLVDTKDIDTTPVANTFGRVPPSYQLYFIPR 5382577

>Cyp2c65 2CN4
MVLGVFLGLLLTCLLLLSLWRQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRN
FSKVYGPVFTLYLGRNPAVVLHGYEAVKEAFTDHGEEFAGRGVFPVFDKFKKNC
GVVFSSGRTWKEMRRFSLMTLRNFGMGRRSIEDRIQEEARCLVDELRKTKG
EPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFLDILNENVEILSSPWIQ
ICNNFPAVIDYLPGRHRKLHKNFAFAEHYFLSKVKQHQESLDINNPRDFIDCFLIKMEQ
EKHNPKTEFTCENLVFTASDLFAAGTETTSTTLRYSLLLLLKYPEVT
AKVQEEIDCVIGRHRSPCMQDRHSMPYTDAVLHEIQRYIDLLPTSLPHAVTRDVKFREYLIPK
GTTVIASLTSVLYDDKEFPNPEKFDPSHFLDERGKFKKSDYFFPFST
GKRICVGEGLARAELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFASVPPKFQICFIPI* 5422612

>Cyp2c65 NT_039689.1 + strand
5398093 MVLGVFLGLLLTCLLLLSLWRQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRN 5398260
5406366 FSKVYGPVFTLYLGRNPAVVLHGYEAVKEAFTDHGEEFAGRGVFPVFDKFKKNC 5406527
5406732 GVVFSSGRTWKEMRRFSLMTLRNFGMGRRSIEDRIQEEARCLVDELRKTKG 5406884
5409456 EPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFLDILNENVEILSSPWIQ 5409614
5410489 ICNNFPAVIDYLPGRHRKLHKNFAFAEHYFLSKVKQHQESLDINNPRDFIDCFLIKMEQ 5410665
5419474 EKHNPKTEFTCENLVFTASDLFAAGTETTSTTLRYSLLLLLKYPEVT 5419614
5424846 AKVQEEIDCVIGRHRSPCMQDRHSMPYTDAVLHEIQRYIDLLPTSLPHAVTRDVKFREYLIPK 5425034
5427909 GTTVIASLTSVLYDDKEFPNPEKFDPSHFLDERGKFKKSDYFFPFST 5428049
5430603 GKRICVGEGLARAELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFASVPPKFQICFIPI* 5430785

>Cyp2c65-de9b  1400bp from end of 2c65 New exon 9 fragment 2c like 
5424064 RS*LYIPPTPGKCICVRDNLAQMKLFLFLTTILYNFNLKSVDPQELDTT 5424210

>Cyp2c65-de9b NT_039689.1 + strand
5432237 RS*LYIPPTPGKCICVRDNLAQMKLFLFLTTILYNFNLKSVDPQELDTT 5432383

>Cyp2c65-de9b NT_050681.1|MmUn_50721_30 + strand
8225 FFSGKCICVRDNLAQMKLFLFLTTIL*NFNLKSVDPQELDTT 8350

>Cyp2c66 2CN5
MVLGVFLGLLLTCLLLLSLWKQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRN
FSKVYGPVFTLYLGKKPAVVLHGYKAVKEALIDHGEEFAGRGTFPVADKFIRVL
GVVFSSGRTWKEMRRFSLMTLRNFGMGKRSIEDRVQEEARCLVDELRKTK
GVPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFIDILNENVEILSSPWIQ
VCNNFPAIIDYLPGRHRKLLKNFDFAKHYFLAKVIQHKESLDINNPRDFIDCFLIKMEQ
EKHNPKTEFTCENLIFTASDLFAAGTETTSTTLRYSLLLLLKYPEVT
AKVQAEIDCVIGRHRSPCMQDRHSMPYTDAVLHEIQRYIDLLPTSLPHAVTRDVKFREYLIPK
GTTVIASLTSVLYDDKEFLNPERFDPSHFLDESGKFKKSDYFFPFST
GKRICVGEGLARTELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFVSVPPKFQICFISI*

>Cyp2c66 NT_039689.1 + strand exon 1
5452323 MVLGVFLGLLLTCLLLLSLWKQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRN 5452490

>Cyp2c66 NT_054348.1|MmUn_54388_30 Length = 4800 exon 2 - strand
457 FSKVYGPVFTLYLGKKPAVVLHGYKAVKEALIDHGEEFAGRGTFPVADKFIRRC 295

>Cyp2c66 NT_039802.1|MmUn_39842_30 Length = 15356 exons 4,5,6
 2469 GVPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFIDILNENVEILSSPWIQ 2630
 3652 VCNNFPAIIDYLPGRHRKLLKNFDFAKHYFLAKVIQHKESLDINNPRDFIDCFLIKMEQ 3828
10072 EKHNPKTEFTCENLIFTASDLFAAGTETTSTTLRYSLLLLLKYPEVT 10212

>Cyp2c66 NT_039803.1|MmUn_39843_30 Length = 8260 exon 8
6943 GTTVIASLTSVLYDDKEFLNPERFDPSHFLDESGKFKKSDYFFPFST 7083

>Cyp2c66 NT_050681.1|MmUn_50721_30 Length = 10154 exons 8,9
2857 GTTVIASLTSVLYDDKEFL 2913
2915 NPERFDPSHFLDESGKFKKSDYFFPFST 2996
5514 GKRICVGEGLARTELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFVSVPPKFQICFISI 5693

>Cyp2c67 2CN7
MDPFVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDMKDIGQCLTN
FSKTYGPVFTLYFGSQPIVVLHGYEAMKEAFIDHGEEFSGRGRFPFFDKVTKGK
GIGFSHGNVWKATRVFTINTLRNLGMGKRTIENKVQEEAQWLMKELKKTN
GLPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGK
VNECTEILSSPGCQIFNAVPILIDYCPGRHNKFFKNHTWIKSYLLEKIKE
HEESLDVTNPRDFIDYFLIQRCQKKGIEHMEYTIEHLATLVTDLVFGGTE
SLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRNHMPYTNA
MVHEVQRYVDLGPISLVHEVTCDTKFRNYFIPKGTQVMTSLTSVLHDSTE
FPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLT
TILQNFKLKPLVDPKDIDMTPKHSGFSKIPPNFQMCFIPVE*

>Cyp2c67 NT_070904.1|MmUn_70944_30 Length = 6991 - strand exons 1-3
6014 MDPFVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDMKDIGQCLTN 5847
 735 FSKTYGPVFTLYFGSQPIVVLHGYEAMKEAFIDHGEEFSGRGRFPFFDKVTKGK 574
 402 GIGFSHGNVWKATRVFTINTLRNLGMGKRTIENKVQEEAQWLMKELKKTNG 250

>Cyp2c68 2CN8
  1  MDPFVVLVLC LSFLLLLSLW RQRSARGNLP PGPTPLPIIG NYHLIDMKDI 
 51  GQCLTNFSKI YGPVFTLYFG SQPIVILHGY EAMKEAFIDY GEEFSGRGRI 
101  PVFDKVSKGK GIGFSHGNVW KATRVFTVNT LRNLGMGKRT IETKVQEEAQ 
151  WLMKELKKTN GSPCDPQFII GCAPCNVICS IVFQNRFDYK DKDFLSLIGK 
201  VNECTEILSS PECQIFNAVP ILIDYCPGSH NKFLKNHTWI KSYLLEKIKE 
251  HEESLDVTNP RDFVDYFLIQ RRQKNGIEHM DYTIEHLATL VTDLVFGGTE 
301  TLSSTMRFAL LLLMKHTHIT AKVQEEIDNV IGRHRSPCMQ DRNHMPYTNA 
351  MVHEVQRYID LGPNGVVHEV TCDTKFRNYF IPKGTQVMTS LTSVLHDSTE 
401  FPNPEVFDPG HFLDDNGNFK KSDYFVPFSA 

>Cyp2c69 2CN9
  1  MDPFVVLVLC LSFMLLLSLW RQRSARRNLP PGPTPLPIIG NYHLIDMKDI 
 51  GQCLTNFSKT YGPVFTLYFG SQPIVVLHGY EAIKEALIDH GEVFSGRGRF 
101  PFFDKVSKGK GIGFSHGNVW KATRVFTVNT LRNLGMGKRT IENKVQEEAQ 
151  WLMKELKKTN GSPCDPQFII GCAPCNVICS IVFQNRFDYK DKDFLSLIGK 
201  VNECTEILSS PGCQIFNAVP ILIDYCPGRH NKFFKNHTWI KSYLLEKIKE 
251  HEESLDVTNP RDFIDYFLIQ RRQKNGIEHM EYTIEHLATL VTDLVFGGTE 
301  TLSSTMRFAL LLLMKHTHIT AKVQEEIDNV IGRHRSPCMQ DRKHMPYTNA 
351  MVHEVQRYVD LGPTSLVHEV TCDTKFRNYF IPKGTQVMTS LSSVLHDSTE 
401  FPNPEVFDPG HFLDDNGNFK KSDYFVPFSA GKRICVGESL ARMELFLFLT 
451  TILQNFKLKP LVDPKDIDTT PKYSGFSKIP PKFQMCFIPV E*

>Cyp2c69 NT_044177.1|MmUn_44217_30 Length = 18144 2 diffs exons 7-9
 8530 AKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYVDLGPISLVHEVTCDTKFRNYFIPK 8718
10262 GTQVMTSLSSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSA 10402
16675 GKRICVGESLARMELFLFLTTILQNFKLKPLVDPKDIDTTPKYSGFSKIPPKFQMCFIPVE 16857

>Cyp2c70 2CN10
MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVYVKNISKSMGM
LAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGL
GIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTN
GSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQ
LCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEK
EKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVT
AKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPK
GTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSA
GRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV

>Cyp2c70 NT_039692 - strand part of exon 8 missing
274679 MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVDVKNISKSMGM 274512
271445 LAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGL 271284
267928 GIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTN 267779
255035 GSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQ 254874
252912 LCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEK 252739
251904 EKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVT 251764
248154 AKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPK 247966
242859 XXXXXXXXXSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSA 242746
239356 GRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV* 239174

>Cyp2c71-ps chr 19 between 2c69 and 2c37 
note ex 1 is facing in the opposite direction so = Cyp2c71-de1b
VVLVLRLSFLLLLSL*RQRSGRGKLPPGLTPCSINGNFLQIDMKD ex 1
GTTVLTPLSSVLHDSKEFPNPEMFDPDHFLDGNGNFK*SDYFMPFSAGNR ex 8
MCMGESLALMELILFLTTILQNF*LKSLVDLKDNNITPVYSGL ex 9
F*VPPTFLVCFISV

Cyp2c71-ps NT_039692
14397 CP*SYNIFF*IIHVLSYLLEKIKENEELMDVTNP*DFIDYFLIQRHQ 14537 (+) strand ex5
32761 GTTVLTPLSSVLHDSKEFPNPEMFDPDHFLDGNGNFK*SDYFMPFSAGNR 32910 (+) strand ex8
39051 MCMGESLALMELILFLTTILQNF*LKSLVDLKDNNITPVYSGLF*VPPTFLVCFISV 39221 (+) strand ex9

Cyp2c71-de1b  NT_039692 
 8628 MGPFVVLVLRLSFLLLLSL*RQRSGRGKLPPGLTPCSINGNFLQIDMKDTHQSLTN 8461 (-) strand ex1

>Cyp2c72-ps 2CN11 XM_140723 XP_140723 chr 19 between 2c29 and 2c38 
MDLITFLVLTLSSLILLLLWRQRSGRGRLPPGPTPFPIIGNFLQIDGKNFSQSLTN
FSKAYGPMFTLYLGSQPIAVLHGYEAVKEALIDHGEEFSGRRNIPMAEKINNSL 
GVIFSNGNRWKEIRHFTLTILRNLGMGKRNIEDRVQEEAQCLVEELRKTN

>Cyp2c72-ps NT_039689.1 + strand missing exon 3
5682121 MDLITFLVLTLSSLILLLLWRQRSGRGRLPPGPTPFPIIGNFLQIDGKNFSQSLTN 5682288
5698550 FSKAYGPMFTLYLGSQPIAVLHGYEAVKEALIDHGEEFSGRRNIPMAEKINNSL 5698711

>Cyp2c73-ps A chr 14 2C seq 55% to 2C29 NW_000100.1 Mm14_WIFeb01_281
27513950 GMGNRTIEDHI*EEACSLVDELRKTNGVRCNSTFILGC 27514063
27514066 PCNVICFIFFFQNRFDYKYQGILNENVEIVSSPWIQICNNFPAIIDHLPERHRKFLEDFAFDK ILVKVIQHQESLNINNPQEFINSFLIEMKQEEYNPKIEFAYENLILTASDMFAAGTETS TTLR*SLLLLFKDP*VTAKVQEETDHVIVRHRSPCIQDKNLMPYTNALLHEIQRYLDLLP
T*LYHGKTCCMKFKNCLIYKGIIVIESSTYVLHDDNEFSNPERFDPSHF

>Cyp2c-se5[9] 2c exon 9 fragment NW_000107.1|Mm16_WIFeb01_286
42687727 PFSTGKLICVGEGLARAELLLLLTTILQNFNLKSPVDLKDLDTIPVANG 42687873

>Cyp2d9 Mm.3164 gene ca M23998 J04471 M24262 (846bp) M24267 NT_039621.1 + strand
43888767 MELLTGTDLWPVAIFTVIFILLVDLTHQRQRWTSRYPPGPVPWPVLGNLLQVDLGNMPYSLYK 88955
43889913 LQNRYGDVFSLQMAWKPMVVINGLKAMKEMLLTCGEDTADRPPVPIFEYLGVKPGSQ 90083
43890352 GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEANHLCDAFTAQAG 90507
43890598 QPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGLIPE 90756
43891389 VLNAFPILLRIPRLADKALQGQKSFIAILDNLLTENRTTWDPVQAPRNLTDAFLAEIK 91562
43891749 AKGNPESSFNDENLLMVVRDLFGAGMLTTSTTLSWALMLMILHPDVQ 91889
43892090 RVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPVNLPRITSHDIEVQDFLIPK 92275
43892650 GTILLPNMSSMLKDESVWEKPLRFHPEHF 92736
43892738 LDAQGHFVKPEAFMPFSA 92791
43892892 GRRSCLGEALARMELFLFFTCLLQRFSFSVPDGQPQPSNSGVYGILVAPSPYQLCAVVRDQGH 93080

>Cyp2d9-de1b2b exon 1 and 2  8-10kb upstream of 2d9 NT_039621.1 + strand
43879793 MELLTGTDLWSVAIFTVIFILPVDLLHRRQRWTSRCPPGPVPWPVLGNLLQVDLDNMPYSLYK 79981
43880823 XXNRYGDMFSLHMAWKPMVVINGLKAMKEVLLTCGEDTADSPPVPIYEHRGXXXXXX 80969

>Cyp2d9-de1d6d7d - strand exon 1,6,7 NT_039621.1 10kb upstream of 2duup
43859756 MELLTGTSLWPVAILTVIFILLQDLMHQQKCCTSCYLPGTVLWTLQRNLLQVDLHSMPHSLCK 59568
43858655 AKGNLESSFNDANLSLVVLDQFGTGIVASSVTLTWGLLLTILNPDVQ 58515
43858292 RMQQEIDKVIEHVW*TEMVHQAYMPYTNAAIHEVQRYKDIIPIPLPHRTSSDVEMQDFLITK 58107

>Cyp2d9-de1c5c6c7c (uup) exons 1,5,6,7 NT_039621.1 + strand
43869836 MELLTGTELWPVAIITVIFILLVDLMHYHQLWTSHY 69943
43869943 PPGPVLWPVLGNLLQMDLHNMPHSMYK 70023
43872058 VLNTFPILLCIPGWADKVFPG*STFLTMVDKLVTEPKRT*DPDQPPCDLIDAFLAEMXX 72228
43872341 AKGNPSSNFNDANLRLVVFNLFGAGIVTSSITLTWVLLLMVLHPDVQ 72481
43872703 RLHQETDEVIGHVWWPERQSQX 72765
43872768 LMPYTNAVIHEVQHYTGIIPIPLPHRTSSDIEMQDFLITK 72887

>Cyp2d10 Mm.27803 genbank gene cb M24263 NT_039621.1 - strand
43843798 MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYSLYK 43610
43842754 LQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYLGVKPGSQ 42584
43842315 GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHLCDAFTAQAG 42160
43842069 QPINPNTMLNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEIS 41926
43841280 VLNMFPILLRIPGLPGKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAEIEK 41104
43840917 XKGNAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQ 40780
43840580 RVQQEIDAVIGQVRHPEMADQARMPYTNAVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPK 40395
43840014 GSILIPNMSSVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSA 39874
43839773 GRRSCLGEPLARMELFLFFTCLLQHFSFSVPNGQPRPRNLGVFPFPVAPYPYQLCAVMREQGH 39585

>Cyp2d11 most like M24264 about 18 aa diffs plus M24264 looks frameshifted
frameshift exons 1,6 NT_039621.1 - strand 
43830762 MELLTGAGLWSVAIF 30718
43830715 SVIFILLVDLMHRHQHWTSRCPPGPVPWPVLGNLLQVDLGNMPYSLYK 30572
43829360 LQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYLGVKPGSQ 29190
43828921 GVVLAPYGPEWQEQRRFSVSTLRNFGLGKKSLEDWVTKEARHLCDAFTAQAG 28766
43828674 QSINPNTMLNNAVCNVIASLIFARRFEYEDPYLIRMLKMLKECFTEIS 28531
43827881 VLNEFPIFLRIPGLADMVFQGQKSFMAILDNLLTENRTTWDPDQPPRNLTDAFLAEIEK 27705
43827334 AKGNPESSFNDENLRMVVGDLFTAGMVTT 27248
43827246 STTLSWALLLMILHPDVQ 27193
43826992 RVQQEIDAVIGQVQHPEMADQARMPYTNAVIHEVQRFGDIAPLPLPRITSRDIEVQDFLVTK 26807
43826403 GSTLIPNMSSVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFS 26266
43826154 GHRSCLGEALARMELFLFFTCLLQRFSISVPDGQPQPSNYRVHAIPVAPFPYQLCAVMREQGH 25966

>cyp2d11 M24264 gene cc 1993 sequence probably with some errors
compared to newer genomic sequence above
MELLTGAGLWSVAIFTVIFILLVDLMHRHQHWTSRCPPGPVPWP
VLGNLLQVDLDNMPYSLYKLQNRYGDVFSLQMAWKPMVVINGLKAMKEMLLTCGEDTA
DRPPVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEEWVTKEA
RHLCDAFTAQAGQPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRMLKMLKECFTE
ISGFIPGVLNEFPIFLRIPGLADMVFQGQKSFMAILDNLLTENRTTWDPDQPPRNLTD
AFLAEIEKAKGNAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRV
QQEIDAVIGQVQHPEMADQARMPYTNAVIHEVQRFGTLLHCLCHASQVVTFTQVQDFL
VTKGSTLIPNLSSVLKGETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAGHRSCLGE
ALARMELFLFFTCLLQRFSISVPDGQPQPSNYRVHAIPVAPFPYQLCAVMHEQGH

>Cyp2d12 no UNIGENE entry EST AA114047 gene cd AC118710.1 GSS AZ417526.1 NT_039621.1 + strand
44012211 MELLTGTDLWSVAIFTVIFILLVDLMHRRQSWTSCYPPGPVPWPVLGNLLQVDLNNMPYSLYK 44012399
44013265 LQNRYGDVFSLQMAWKPMVVINRMKAMKEVLLTCGEDTADRPPVPIFEHLGFKPRSQ 44013435
44013707 GMIFAPYGPEWREQRRFSLSSLRNFGLGRKSLEEWVIKEAGHLCDAFTTQAG 44013862
44013942 QYINPNTMLKKATCNVIASLIFARRFEYEDPYLIRMLKVLEDSLTELSGLIPE 44014100
44014722 VINTFPILLHIPRLADKFLQSQKSFIAIVDNLLTENRTTWDPAQSPRNLTDAFLAEIEK 44014898
44015082 AKGNPESSFNDENLRMVVIDLFTAGILTTSTTLSWALLLMILHPDVQ 44015222
44015415 RRVQQEIDEVIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPLHLPRITSRDIEVQDFLIPK 44015603
44015985 GTILLPNMSSVHMDDTVWEKPLRFHPEHFLDAQGHFVKHEAFITFSAG 44016128
44016229 RRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPQPSDHRVFSIMVAPSPYQLCAVIREQGH* 44016417

>Cyp2d12-de1b5b6b7b exon 1,5,6,7  fragments 7kb upstream of 2d12 NT_039621.1 - strand
44005713 M*LLTGTGLWPVAIFTIIFILLQDLMHHLKLWTSCYPPGTVPWPL 44005579
44003512 NTLPDSPAHPRVA*QVSPGTMTFLTMMDKLVTEQKRTWDPDHPLCNLTDAFLAEMEK 44003342
44003204 AKGSPQSSFKGANLCLVVLDQFDAGIVTTSITLT*GLLLTILNPRVQ 44003064
44002849 RVQQEINKVIGHV**PEMVDQDHMSYSNAVMYEVQHYADIITIPLAHKTFSDVEVQGSLITK 44002664

>Cyp2d12-de5c6c7c exons 5,6,7 NT_039621.1 - strand
43998271          PRVA*QVSPGTMTFLTMMDKLVTEHKRTWDPGHPLCNLTDAFLAEMEK 33998128
43997989 AKGSPQSSFKGANLCLVVLDQFDAGIVTASITLTWGLLLTILHPGVQS 33997846
43997629 RVQQEINKVIGHVW*PEMVDQDRMSYSNAVMYEVQRYADIITIPLAHKTFSDVEVQGSLITK 33997444

>Cyp2d13 AC087902.4 17 April 2001 no UNIGENE entry EST BF533324 gene ce NT_039621.1 - strand
44100884 MELLTGTGLWPVAIFTVIFILLVDLMHRRQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYSLYK 44100696
44099867 LQNRYGDVFSLQMAWKPVVVISGLKAVREVLVTCGEDTADRPEMPIFQHLGYGEKAK 44099697
44099412 GVVFAPYGPEWRELRRFSVSTLRNLGLGKKSLEQWVTEEAGHLCDAFTAQAG 44099257
44099169 SPLDPYTLLNKAVCNVIASLIYARRFEYGDPDFIKMLKILKENMGENTGLFPE 44099017
44098352 VLNTFPILLHIPGLADKVFPGQKTFLTLVNKLVTEHKRTWDPDQPPRDLTDAFLAEMEK 44098176
44098036 AKGNPKSSFNEANLRLVVFDLFGAGIVTSSITLTWALLLMILHPDVQ 44097896
44097675 RRVQEEIDEVIGQVRCPEMADQAHMPYTNAVIHEVQRFADIVPMNLPHKTSHDI 44097514
44097515 LEVQGFLIPK 44097486
44097091 GTTLIPNLSSALKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAG 44096948
44095907 RRACLGEPLARMELFLFFTCLLQRFSFLVPAGQPQPSDYGIFTFLVSPSPYQLCAFTR* 44095731

>Cyp2d22 AF221525 NM_019823 frameshift x2 in exon 6 NT_039621.1 - strand
43812601 MRLPTGAELWPIAIFTVIFLILVNLMHWRQRWTAHYPPGPMPWPVLGNLLHMDFQNMPAGFQK 12413
43811089 LRGRYGDLFSLQLASESVVVLNGLTALREALVKHSEDTADRPPLHFNDLLGFGPRSQ 10919
43810677 GIVLARYGPAWRQQRRFSVSTMHHFGLGKKSLEQWVTEEARCLCAAFADHTG 10522
43810448 PFSPNTLLDKAVCNVIASLLYACRFEYDDPRFIRLLGLLKETLKE 10314
43809907 FLNVFPMLLRIPGLVGKVFPGKRAFVTMLDELLAEHKTTWDPTQPPRDLTDAFLAEVEK 9731
43809546 AKGNPESSFNDE 9511
43809509 NLRTVVGDLFSAGM 9468
43809466 VTTSTTLSWALMLMILHPDVQ 9404
43809193 RVQQEIDEVIGQVQCPEMADQARMPYTNAVIHEVQRFADILPLGVPHKTSRDIELQGFLIPK 9008
43808581 GTTLITNLSSALKDETVWEKPLCFHPEHFLDAQGHFVKPEAFMPFSA 8441
43808344 GRRSCLGEPLARMELFLFFTCLLQRFSISVPDGQPQPSDHGVFRALTTPCPYQLCALPR 8168

>Cyp2d26 Mm.29064 68ESTs follow AA982292 NT_039621.1 - strand
44253087 MGLLVGDDLWAVVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYSFYK 44252899
44252211 LQNRYGNVFSLQMAWKPVVVVNGLKAVRELLVTYGEDTSDRPLMPIYNHIGYGHKSK 44252041
44251775 GVILAPYGPEWREQRRFSVSTLRDFGLGKKSLEQWVTEEAGHLCDAFTKEA 44251623
44251544 EHPFNPSPLLSKAVSNVIASLIYARRFEYEDPFFNRMLKTLKESLGEDTGFVGE 44251383
44250748 VLNAIPMLLHIPGLPDKAFPKLNSFIALVNKMLIEHDSTWDPAQPPRDLTDAFLAEVEK 44250572
44250388 AKGNPESSFNDKNLRIVVIDLFMAGMVTTSTTLSWALLLMILHPDVQ 44250248
44250072 RRVHQEIDEVIGHVRHPEMADQARMPYTNAVIHEVQRFADIVPTNLPHMTSRDIKFQDFFIPK 44249884
44249511 GTTLIPNLSSVLKDETVWEKPLRFYPEHFLDAQGHFVKHEAFMPFSA 44249371
44249270 GRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSDYGIYTMPVTPEPYQLCAVAR 44249094

>Cyp2d26-de1b7b8b 10kb upstream of 2d26 exon 1 aa 1-19, 36-57, exon 7,8
NT_039621.1 - strand
44262890 MGLQTGLWPMVISTALFCM 44262834
44262801 YPPSPVPLPELGSLLQVKFENM 44262736
44260947 GHVQKETDGIMGQVWLPQMSHQACMSFT 44260864
44260862 NAMIREV*HFRDTILVNLSHVTFCEIEI*GFXXXX 44260770
44260251 XXXXLITNLSLVLKNEITWEMPSPTPS*TFLESEGHLMKQETFMPXXX 44260129

>Cyp2d32-ps (vvp) exons 4,5,6,7,8,9 NT_039621.1 + strand
43898939 AMSPHNPNHLLDKAICNVIASLIYACRFKYGDPDIIK 33899049
         ILKVLKESM*KKIVFIPD 
43899746 VLNIFPIVLSISGLGDKVLPGKKVSLAIVDKMLTDXXX 33899850
43899865 TWDPD*SHCDLTDAFLAEMEQ 33899927
43900101 LHLLILHLLGAGIVMSSVTLTWTLLLMI*NPDVQ 33900202
43900439 XXXXEIDKVIGQVWHPEMADQVLMPFTNAVIHEVKCSEDITAMALPHRNSLHSNVQGFLIPK 33900612
43901007 GKSLITNLSSELKDEAIWEKPLCFHPEYFLDAKGHFV*HEPFMAFSE 33901147
43901248 GHQACLREPLACMELFLFFTFLLQRFSFSMSDGQPLPSEYSIYAMPVTPEPCQFCAVVQYQG 33901433

>Cyp2d33-ps exons 4,5,6,7,8,9 NT_039621.1 + strand 3kb downstream of 2d12
44019279 XXXNPYHLLDKAVCNVIPSLIYACCFNYGDPDNRMLKLLKKKSMKKKIGFISD 44019428
44020071 VLNTFPTLLGISGLAEKVFSGQKTSFTIVNKMFTEH 44020178 
44020190 DPDQPPRDLTDAFLAEMEK 44020246
44020381 AKGNSERSFREPNLYLIILDLLGPGIVTSLVTLTWSLLLVIQQPDVQ 44020521
44020745 XXXXEIDKVIG*VWHPEMAD*ILMPFTNVVIHEVKRFEDITAMVLPQRTSPDIDVHGF 44020906
44022181 XXXLIPDLSSMLKDETVWEKPLHFHPKNFLDAQGHFL*FEAFMPFSEG 44022315
44022418 QACLGQPLDQIVLFLFITCLLQCFSFSLPKGQPPPSD*GIYAMPVTPAPSQLCAVVVR*EEQWH 44022609

>Cyp2d34-de1b2b7b8b exons 1,2,7,8 about 4 kb downstream of 2dtt NT_039621.1 - strand
44070344 MELLTGTGL 44070318
44070324 WPVAIFTVIFILLVDLMHRHQHWTSRCPPGPVPWPVLGDLLQVNVYNIPYSLYK 44070163
44069514 LKKSCGDMFSLHMGWKPMVMIKGLKSVQDVLVTCGEDTADCPKIPVFHYI 44069365
44067376 QVQKEIDKVIGQVWHPEMADLGLMPFKKSVIHEVHHFADITAIP 44067245
44066770 QGKSFIPNLCSMLKDETVWEKPLHFHPKHFLDAQGHFVKHEVFMPFSAG 44066624

>Cyp2d34 (tt) 85% to 2d10 87% TO 2dww/2d11 NT_039621.1 - strand
44079756 MELLTGTGLWSVAIFTVIFLILVDLMHRRQHWTSRYPPGPVPWPVLGNLLQVDLDNIPYSLYK 44079568 
44077878 LQNRYGDVFSLQMAWKPVVVINGLKAMQEVLLTCGKDTADHPPVPIFEYLGFKSKSQ 44077708
44077439 GVVLASYGPEWREQRQFSVSTLRNFGLGKKSLEEWVTKEAKHLCDAFTARAG 44077284
44077192 QSINPNTMLNNAVCNVIASLIFARRFEYEDPFLIRMLKMREESLKEVTGFIPG 44077037
44076407 VLNTFPILLRIPGLADMVFQSQKTFMAILDNLVTENRTTWDPDQPPRNLADAFLAEIQK 44076231
44076048 AKGNPESSFNDENLCMVVSDLFTAGMVTTSTTLSCALLLMILHPDVQ 44075908
44075711 RRVQQEIDAVIGQVRCPEMADQARMPYTNAVIHEVQRFGDIIPLNIPRITSRDIEVQDFLIPK 44075523
44075229 GTILIPNMSSMLKDETVWEKPLRFYPEHFLDAQGHFVKPEAFMPFSAG 44075086
44074985 RRSCLGEPLARMELFLFFTCLLQRFSFSVPAGQPQPSDHRIFAIPVAPYPYQVCAIMREQGH* 44074797

>Cyp2d35-ps 13de2b exons 1,2,3,4,5,7,8 12kb upstream of 2d13 exon 1 fragment 13 kb upstream NT_039621.1 - strand
Cyp2d13de7b8b exon 4,7,8 fragment 9kb, 10kb upstream of 2d13 NT_039621.1 - strand
44113633 VIWLLTGTGL 44113604
44113610 WPVAIFTVIFILLVDLIHLCQHWTSCYPPGPVPCPVLGNLLQVDLYNMPYSLYK 44113449
44112585 MFSLQMVWKPMVLIKELKSVQDVLVTCGGGTVDRPEIPIFHHIGCGPKAK 44112436
44112148 XXLLASYGPEW*EQRPFSVSILCNFSQGKKFLEQSVTDEAGHICDTFTAQAG 44111999
44111917 SPLKPYTLLDKTLCNVIVSLIYAHRFKYGGPDIIKMLKVLKDNMGGKIGLIPE 44111759
44111115 VLNTFPVLLHIPGLADKVFPGKKTFLTIMDKLVTEHKKIWDLYQPSCDLTGAFLAEMEK 44110939
44110801 AKGNPESSFRESNLCLVVLDLLGDGIVTSSVTLTWGLLLTILHLDVQ 44110661
44110375 MPYTNAVIHEVPCYDDIIPIFLPHRTSSDVEMQDFLITK 44110259
44109226 SVLNDETVWEKSLCFLPDHFLDAQGNFVKPEAFMPFSAG 44109110
44109006 XQACLREPLAHMELFLFFTCLLQHFSFSVPAGQPLLSDYGIYTMPVSPEPYQLCAVVC* 44108833

>Cyp2d36-ps   hhpde1c2c exon 1,2 fragment about 5-6kb downstream of dhhp NT_039621.1 - strand
Cyp2dhhde7b8b  exon 7,8,9 fragments 10kb downstream of 2dhhp
44142171 MELLTETDLWPVAIFTVIFILLVELMHQCQR*TSFYTPGPVPWPLLGNLLQVDLDNMPYSLYK 44141983
44141174 NHYGDMSSLHMG*KSMVVISGLKAVQDVLVTC 44141079
44139955 GEDTTDCPEIPIFQHIGCGPKAK 44139887
44139615 GVVPAPYGLEWQEQR*FSVSTLCNFGL 44139535
44139535 GKKSLKQWVMEEAGH 44139491
44139399 SPLNPFPLLDKAGLNVSASLIYAHCFE*EDPVIIKMLTVLRK 44139274
44139026 VLNTFSIPLHIRGLADKAFPVQKTFLTIVDKMLTEHKRT*DPDKPP*DLIDAYLAKMKK 44138850
44138722 XXGNPESSFNETNLXX 44138687
44138681 VVLDQLGARIMTISITLT*VLLLMILHPHVQ 44138589
44138362 VGQYINKVISQVWHSGMADQGLMPFINVVIHEVQHFADIIAIPLPHRTSPDIKVLGSLIPK 44138180
44130610 GMNLIPNLSSVFKDNTVWEKPFCFHPEQFLDAQGHFVKHKAFMPFSAG 44130467
44130363 XQACLGDPLACMELFLFFTCILQRFSFSVPAGQPLHSDYGIYAMPVTPEPCQFCLV 44130199

>Cyp2d37-ps (hhp) 3 frameshifts and a stop codon 81% to 2d13 NT_039621.1 - strand
44151915 MELLTGTGLWPVVIVTVIFILLVDMLHRCQRWTSCCPPDPVPWPVLGNLLQVDLDNMPYNLYK 44151727
44150957 LHNRYGDVFSLQMGWNHMAVINGLKVIQEVLVTCGEDTADRPEMPIFPHLGYGQKAK 44150787
44150509 GVVLAPYGPEWKEQR*FSASTLCNFSLGKKSLEQWVMEEVGHLFDVFTAHA 44150357
44150275 GSPLNPYPLLDKAVCNVIVSLIYAHRFEYGDPDFIKMLKVLKENMGENIGLFSE 44150114
44149452 VLNTFPILLRIPGLADKVFPGQKTFLIMVDKLVTEHKRTWNSDQPPRDLTDAFMAEMEK 44149276
44149137 AKGNPESSFNDANLCLVVLDLLGAATVTTSTTLSWALLLMILHPDVQ 44148997
44148774 QVQQEIDEVIWYVWLPEMADQVCMPFTNAVIHEVQ 44148670
44148653 XXXDIIPITLPHRTSRDIEVWGFLIPK 44148582
44148149 GMTLISNLF 44148123
44148124 SVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSA 44148011
44147914 GHRSCLGEPLALMELFLFFTCLLQRFSFSMPAGQSLPSDYGIYTMPVTPAPYQLCAVV 44147741

>Cyp2d38-ps XP_194978 pseudogene LOC271298 chr 15 XM_194978 NT_039621.1 - strand
Cyp2dhhpde1b exon 1 fragment 19kb downstream of 2dhhp
Cyp2dhhde2b exon 2 fragment 14kb upstream of 2dhhp NT_039621.1 - strand
44166184 PVAIFTVILILLVNLMHRLQCWTSRYPPGPVPWLVLGNLLQADLHNMTYNLYK 44166026
44165213 LQNWCGDVFSLQMISKPVVVIKGLNAVGE 44165127 
44165125 LLVSCGEGTAEWPEIPIFHHIVCGPKTK 44165042
44164762 GVILAP*GCEWREQR 44164718
44164722 RGSVSILCNFSLGKKSLEQCVMEKAGHICDAFTVQAG 44164612 
44164557 SSLNPLSLLDKSLCNVVAYLIYA 44164489

>Cyp2d39-ps jj Cyp2d26 like pseudogene exons 4,5,6,7,8(partial),9 NT_039621.1 - strand
44178330 FDYGDPDIIKMLKALKENKGEKIGMIPH 44178247
44177610 VLNTFPILLHILELADKVFPGQKT 44177539
44177539 ILTMVDKLVIAHKRTGDCEKPHQELTD 44177459
44177454 AFLAEREX 44177434
44177299 AKGNPESSFNDANLCLVVLDLFGGGILTSSITLTWAL*LVILHP 44177168
44176934 RVQQDEVIVHVW*PKMANQANMSYSNAAIHEIQCYADIIPIHLPDRTSLDI*VQGFLLPK 44176755
44176344 GTKIIPNLSSVI 44176309
44175091 GHQVCLGEPLASMELFLFFTCLLQCFSFLVPTG*PQPSNYGIYAMPVTPEPYQLCAVV 44174918
44175055 MELFLFFTCLLQCFSFLV 44175002 note 9kb from rest of N-term at 2d32p

>Cyp2d40-de7b9b exons 7,9 fragment NT_039621.1 - strand
44201031 VQQEINKFIGQVWRPETAVIHEVQCFANITPITLPHRTSCDIEVQGFLTPK 44200879
44200789 PSDYGIYSMPVTLEPYQLCVVVQ 44200721

>Cyp2d40 (rr) 84% to 2d13 NT_039621.1 - strand
44223024 MELLTGTDLWPVAIFTVIFILLVDLLHRRQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYSFYK 44222836
44222037 LQNHYGDMFSLQMGWNAMVIVNGLKAVQEALVTCGEYTADRPEMPIFPHLGYGQKDK 44221867
44221588 GLVLAPYGPEWQEQRRFSMSTMRNFGLGKKSLEQWVTEEAGHLCDAFTDQA 44221436
44221354 GSPLNPYTLLNKAVCNVIASLIYAHRFKYKDPDFIKMLKVLKENTREKIGLIPE 44221193
44220527 VVKMFPIVLRIPGLADKIFPGQKTFLTMVDKLVTEHKRTWDPDQPPRDLTDAFMAEMET 44220351
44220212 AKGNPESSFNEANLRLVVLDLFGGGIVTTSATLTWALLLMILHPDVQ 44220072
44219854 RRVQEEIDEVIGQARRPEMADQARMPYTNAVIHEVQRFADIAPMTLPHRTSCDIEVQGFLIPK 44219666
44219246 GTTLICNLSSVLKDETVWEKPLRFYPEHFLDAQGHFVKPEAFMPFSA 44219100
44218999 GRRACLGEPLVRMELFLFFTCLLQRFSFSVPDGQPLPSDYGIYSMVVSPAPYQLCAVVR* 44218820

>Cyp2d41-ps (ssp) 82% to 2d13 one stop codon possible pseudogene NT_039621.1 - strand
44241024 MELLTGTDLWPVAIFTVIFILLVDLMHRHQRWTSRYPPGPVLWPVLGNLLQVDLDNMPYSLYK 44240836
44240062 LQNRYGDVFSLKLGRNPMVIVNRLMAVQEVLVTCGENTADRPEMPIFLPPSNGQKAK 44239892
44239602 GLAFAPYGPEWQEQKRFSMSTLRNFGLGKKLLEQ*MTKEAGHLCDAFTAQA 44239450
44239368 GSPLNPYTLLEKAMCNVIASLVYAHCFEYEDPDCIKMLRALKEYMIEKIGLIPEV 44239204
44238543 VKMFPIVLRIPGLADKIFPGQTTFLTMVDKLLTEHKRTWDPDQPPRDLIDAFLAEMEK 44238370
44238242 AKGNPESSFNEANLRQIVLDLFGAGTAPTSTTLSWALLLMILHPDVQ 44238102
44237884 SLVQEEIDEVIGQARRPEMADQARMPYTNAVIHEVQRFADIAPMTLPHRTSCDIEVQGFLIPK 44237696
44237268 QGTTLIPNLSSVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSA 44237125
44237024 GRRSCLGESLARMELFLFFTCLLQRFSFSVPDGQPQPSDYGIYSILVSPAPYQLCAVVR 44236848

>Cyp2d-se1[1:8:9] (xxp) + strand exons 1,8(partial),9 frameshift exon 1 NT_039621.1
43401344 MGLLTS 1361
43401361 LLSVAIFAAIFLLLVDIMQRCQCWATCYLLLLDFQNMPYSLYK 1489
43402076 EETVWEKPLRFHPELFLDAQGHFVKPEAFMPFSA 2177
43402729 GHRSCLGEPLACMKLFLFFTCLLQRFSFSVPDGQPQPSNCGVFPFLVAPSLYQLCAVLLKQGH 2917

>Cyp2e1        Mm.13020 genbank L11650
MAVLGITVALLVWIATLLLVSIWKQIYRSWNLPPGPFPIPFFGN
IFQLDLKDIPKSLTKLAKRFGPVFTLHLGQRRIVVLHGYKAVKEVLLNHKNEFSGRGD
IPVFQEYKNKGIIFNNGPTWKDVRRFSLSILRDWGMGKQGNEARIQREAHFLVEELKK
TKGQPFDPTFLIGCAPCNVIADILFNKRFDYDDKKCLELMSLFNENFYLLSTPWIQAY
NYFSDYLQYLPGSHRKVMKNVSEIRQYTLGKAKEHLKSLDINCPRDVTDCLLIEMEKE
KHSQEPMYTMENISVTLADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIG
PSRAPAVRDRMNMPYMDAVVHEIQRFINLVPSNLPHEATRDTVFRGYVIPKGTVVIPT
LDSLLFDNYEFPDPETFKPEHFLNENGKFKYSDYFKAFSAGKRVCVGEGLARMELFLL
LSAILQHFNLKSLVDPKDIDLSPVTIGFGSIPREFKLCVIPRS

>Cyp2f2        Mm.4515  genbank M77497
MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTK
LSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGN
GIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKME
GKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGE
MYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQ
EKQDPLSHFNMDTL
LMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQ
ARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPK
GTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDNHSFKKSPAFMPFSA
GRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHIR

>Cyp2f2 NT_039413.1 + strand
124085 MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTK 124255
124349 LSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGN 124510
127367 GIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKME 127516
131704 GKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGE 131865
132231 MYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQ 132407
132807 EKQDPLSHFNMDTL 132848 partial exon 6 seq gap here
132950    DPLSHLNMDTLVMTTDNLLFGGTETVGTRLGHAFFILMKYPKVQ 133081 alterative exon 6
133816 ARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPK 134004
135121 GTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDNHSFKKSPAFMPFSA 135261
135862 GRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHIR* 136044

>_1
TTEKQDPLSHFNMDTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTH*AT*IWIP
W**PQTTCSSVAQKPWAPDWVTPSLFL*NTPKCKVHGQQCPLYITSSLLLPSTPTLPRPE
>_3 this equals the rat sequence CYP2F4 not the mouse cDNAs for 2f2
HREARPTEPLQYGYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPLSHLNMDTL
VMTTDNLLFGGTETVGTRLGHAFFILMKYPKVQGTRAAMSPLHYLLPSPTLHPHPTPSRG

>33. Cyp2g1 NM_013809 no UNIGENE entry
MMLGGAFSIFMALCLSCLLILIAWKRTSKGGKLPPGPTPIPFLGNFLQVRTDATFQSFQK
LQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEMPTLEKNFQGY
GLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVK
GAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFVEMSKPWAQ
LYDMYWKVMQYFPGRHNYLYNLIEDLKDFIASRVKINEASFDPSNPRDFIDCFLIKMHQ
DKSDPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVE
AKIHEEINQVIGTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVTRDTHFRGYLLPK
GTDVYPLFGSVLKDPKYFRYPDAFYPQHFLDEQGRFKKNDAFVVFSS
GKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPVYELCFMAR

>Cyp2g1 NT_039410.1 + strand missing exons 7,8
766684 MMLGGAFSIFMALCLSCLLILIAWKRTSKGGKLPPGPTPIPFLGNFLQVRTDATFQSFQK 766863
767440 LQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEMPTLEKNFQGY 767601
769230 GLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVK 769379
772282 GAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFVEMSKPWAQ 772443
772777 LYDMYWKVMQYFPGRHNYLYNLIEDLKDFIASRVKINEASFDPSNPRDFIDCFLIKMHQ 772953
775094 DKSDPHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVE 775234


778485 GKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPVYELCFMAR 778664

>Cyp2j5 NT_039263.1|Mm4_39303_30 Mm.12838 genbank U62294
7661531 MIMFLSSLVTTFWEALHLKTLVLAVVTFLFLINILRSRHPKNYPPGPWRLPFVGNFFQIDTKQTHLVLQQ 7661322
7660795 FVKKYGNVFSLELGQSPVVVVSGLPLIKEMFTHLDQNFVNRFMTPVRERITGKN 7660634
7657152 GLVVSNGQTWKEQRRLALMALRNFGLGKKSLEERIQEETHHLVEAIREEGG 7657000
7656271 QPFNPHLKLINAVSNIICSVTFGERFDYEDCQFQELLQLLDETMHLMGSSAGQ 7656113
7638969 LYNGFPCIMKYLPGPHQKIFRNWGKLKLFVSHIVKKHEKDWNPDEPRDFIDAFLIEMQK 7638793
7633453 DPDRTTSFNEENLISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQ 7633316
7631857 ENVQAEIDRVIGHKRQVSLSDRESMPYTNAVIHEVQRMGNIVPLNSSREVTVDTKFNGFHLPK 7631669
7628370 GTMILTNLTALHRDPKEWATPEVFNPEHFLENGQFKKRESFLPFSM 7628233
7627168 GKRACLGEQLAKSELFIFFSALMQKFTFKPPINEKLSLKFRMGLILSPASYRICAIPRV* 7626989

>Cyp2j5-de2b exon 2 NT_039263.1|Mm4_39303_30 exon 2
7613530 FVKKYGNLFSLELDSISVEVVSGLL 7613456
7613456 LIKEMFTHLDHNFVNRPVSAIQKHV 7613382

>Cyp2j5-de9b  NT_039263.1|Mm4_39303_30
7603742 GK*ACPGEHLAISELFIIFTDLM*NFTFKAPINQKLSLS 763626
7603626 FRNGLTLSPVSYHICAVPQQ* 7603564

>Cyp2j6 NT_039263.1|Mm4_39303_30 Mm.6477  genbank U62295
7550972 MLAATGSLLATIWAALHPRTLLVAAVTFLLLADYFKNRRPKNYPPGPWGLPFVGNIFQLDFGQPHLSIQP 7550763
7543379 VKKYGNIFSLNLGDITSVVITGLPLIKEALTQMEQNIMNRPLSVMQERISNKNG 7543218
7533667 GLIFSSGQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGE 7533512
7533125 KPFNPHFSINNAVSNIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQ 7532967
7529329 LYNIFPWIMKYIPGSHQKVFRNWEKLKLFVSCMIDDHRKDWNPDEPRDFIDAFLKEMTK 7529153
7527044 YPEKTTSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQ 7526907
7523548 EKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPK 7523360
7521362 GTMVLTNLTALHRDPKEWATPDVFNPEHFLENGQFKKRESFLPFSM 7521225
7515727 GKRACLGEQLARSELFIFFTSLMQKFTFNPPINEKLSPKFRNGLTLSPVSHRICAVPRQ* 7515548

>cyp2j6-de6b exon 6 fragment NT_039263.1|Mm4_39303_30
7513690 TGFNKENLTCDTLDLLSGGIDTTSNGVHWVLLYRSVNKE 7513574

>Cyp2j7 NT_039263.1|Mm4_39303_30 AF218856 Darryl Zeldin exons 7-9 
XM_143894.1 complete sequence chromosome 4
7223105 MLSTVGSLVARIWSAIHLWTLLLTLLVFRLLADYLKNRRPKNYPPGPWRLPFVGNLFQFDLDVSQLHLRIQL 7222890
7216582 FVKKYGNLISIDFGNISSVVITGLPLIKEAFTDMEQNLLKRPIIPSRKHVFKDN 7216421
7215155 GIIFSSGQKWKEQRRFALMILKSFGLGKKSLEQRIQEEAYHLVKAMEEEK 7215006
7214123 GQPFDPHFRINSAVSNIICSINFGERFEYGDNKFQELLKITNETLSAETSMMLV 7213962
7204025 LYNALPSIMKYLPGPHQTVFRNWERLKMIVYHMMESHRKDWNPDEPRDFIDAFLTEMTK 7203849
7201873 YPDKTTTSFNEENLICSCLDLFIAGTETSSTALRWALLYMTLNPEVQ 7201733
7189438 ERVHSEIDGVIGQWRQPSTGDRDSMPYTNAVIHEVLRMGNIVPLNVPREVTADSTLAGFHLPK 7189250
7186735 GKMILTNLTALHRDPKEWATPDIFNPEHFLENGQFKKRESFLPFSM 7186598
7182636 GKRACPGEQLARTELFIFFTALMQKFTFKAPVNEKLSLKFRMSVPISPVSYCICAVPRQ* 7182457

>Cyp2j7-de9b from old Cyp2jzzp NT_039263.1|Mm4_39303_30
7177505 GKGACLGKQLAMSQLFIFFTSLMQKSTFKPPINENLSLKFTMSP 7177374
7177375 LSPVSHHIYAVPRQ 7177334

>Cyp2j7-de9c from old Cyp2jzzp NT_039263.1|Mm4_39303_30
7157638 GNRACPGEQLAMIELFIFFTALMQKCTFKSTVNEKLGLKIRLDLPLSPVSHHICAVPRQ 7157462 

>Cyp2j7-de9d from old Cyp2jzzp NT_039263.1|Mm4_39303_30
7138888 GKRTCHGKQLARSELFIFFTALMHIFTLNPPISKKLSLKFSMGLAFSPVSH*ICVVPTQ 7138712

>Cyp2j8 NT_039263.1|Mm4_39303_30 frameshift in exon 4
AF218857 AI429871 vv77f02.y1 69-184 (EST),
AA760476 vv77f02.r1 69-227 (EST), AZ393698 283-329 (GSS), AI606765 vv77f02.x1 330-476 (EST)
AZ057726 422-463 (GSS), XM_131520.1 (from nr) AL772157.1 htgs AC102925.1
7504907 MFATIGCLVSNICSEIHLWTLLLAALTLLLLVDYIKNRHPKNYPPGPWRLPFVGNLFQFDLDVSHLHLGIQP 7504692
7501520 FVKKYGNLISLDFGTIPSVIISGEPLIKEALTCMGQNFLKRPILAARQHIFKNNG 7501356
7498724 IISSSGQTWKEQRRFTLMILKNFGLGKKSLEQRIQDEAHHLVEAIAEEKGR 7498572
7497209 PFDPHFMIN 7497183
7497182 NAVSNIICSITIGERFEYEDNQFQELLKLADETLCLEASKVLM 7497054
7476710 LYNVFPSIFKYLPGPHQKLFSNWEKLKLFFSHVMDSHRKDWNPSAPRDFIDAFLTEMAK 7476534
7473078 YSDKTTTSFNEENLICTTLDLFFAGTETTSTALRWALLYITVNPEVQ 7472938
7468193 EKVHSEIDRVIGQGRHPTIDDRDSMPYTNAVIHEVLRMGNIIPLNVPREVEADITLAGFHLPK 7468005
7444879 GTMVLTNLTALHRDPKEWATPDVFNPEHFLENGQFKKRESFLPFSV 7444742
7442293 GKRGCPGEQLARSELFTFFTALMQKFTFKPPINEKLSLNFKMGVALSPVSYCICAVPR* 7442117

>Cyp2j8-de2b exon 2 NT_039263.1|Mm4_39303_30
7429084 LEKYGNNFSLILGD*TLVVITELLLTKEACIHMEQNILNHPATFIQECNSKK 7428929

>Cyp2j8-de9b exon 9 NT_039263.1|Mm4_39303_30
7417728 ERLIRSKIFSFTLSLKMKSSIYMEVFSFKP 7417639

>Cyp2j8-de9c NT_039263.1|Mm4_39303_30
7414356 EQLARSEMFIFFIALMEKFTFKASVNEKLSLKFRMGFNLPQVSHNICAVPRY* 7414198

>Cyp2j9 NT_039263.1|Mm4_39303_30 AK018422 08-FEB-2001 lung also AF336850 from D. Zeldin
7588866 MLAAAGSLVAAIWAALHLRILLLSAVTFLFLADFLKNRRPKNYPPGPMRLPFVGCLFHLDPKQPHLSLQQ 7588657
7583512 FVKKYGNVLSLDFANIPSVVITGMPLIKEIFTQMEHNFMNRPVTLLRKHLFNKN 7583351
7581648 GLIFSSDQTWKEQRRFALMTLRNFGLGKRSLEERIQEEAHYLVEAIRDEGG 7581496
7581088 QPFDPHFNISNAVSNIICSITFGERFDYHDSQFQEMLRLLDEAMCLESSMMCQ 7580930
7577084 LYNIFPRILQYLPGSHQTLFRNWRKLQLFVSDIVNNHRRDWDPDEPRDFIDAFLTEMTK 7576908
7575254 YPDKTTTSFNEENLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQ 7575114
7571561 EKMQAEIDRVIGQARQPNLADRDSMPYTNAVIHEVQRMGNIIPFNVPREVAVDTQLAGFNLPK 71373
7569594 GIMVLSNLTALHRDPSEWTTPDTFNPEHFLENGQFKKRESFLPFSM 7569457
7566424 GKRACLGEQLARSELFIFITTLFQKFTFKPPVNEKLSLQFRMAATVSPVSHRLCAIPR 7566251

>Cyp2j11 NT_039263.1|Mm4_39303_30 XM_131521, Mm.26915 AC091461.3
7346088 MLAIATCLVANICSAIHLWTLLLTLLTLLLLADYLKNRRPKNYPPGPRRLPFVGNLFQFDLDVSRLHLGIQP 7345873
7342762 FVKKYGNVISVNFGYISSVIISGLPLIKEAITGMEQNFLKRPSLAARQHVFKNN 7342601
7337523 GIVFSSGQTWKEQRKFALTILKNFGLGKKSLEQCIQEEAYHLVKAIGEEK 7337374
7336770 GQPFDPHFRINNAVGNIICSIIFGERFEYDDNQFQELLKLADEIICSEASMMSV 7336609
7316907 LYNVFPSIFKYLPGPQQKLFSNWEKLKLFVSRMMDSHREDWNPSAPRDFIDAFLTEMTK 7316731
7313961 YPDKTTTSFNEENLICTALDLFFAGTETTSNTLRWALLYITVNPEVQ 7313821
7304970 EKVHSEIDRVIGHGRHPTLDDQDSMPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFYLPK 7304782
7295270 GTMVLINLTDLHRDPKEWDTPNVFNPEHFLENGQFKKKESFLPFSMG 7295130
7292515 GKRACPGEQLASCELFIFFTALMQKFTFKSPINEKPSLKFRMGLTLAPVSYRICAVPR 7292342

>Cyp2j12 XM_143892 (genbank entry missing part of exon 4) NT_039263.1|Mm4_39303_30
7128098 MLATEDTFETAIWALLHFKTLVLAAVTFMLLAHYLKTQRPKNYPPGPWRLPFVGNLFQLDLEQPHVVIQQ 7127889
7120211 FVKKYGNLTSLDFGNIPSVIITGLPLIKEVFTNMEQNFLNRPITPIRKRVFNNN 7120050
7109718 GLIISNGQTWKEQRRFALMTLKNFGLGKKSLEQRIQKEADCLVEAIGEEK 7109569
7108826 GKPFDPHFKINSAVSNIICTFAFGERFEYEDSHFHELLRLLDEATCLEASMMCQ 7108665
7102921 LYNVFPSIIQYVPGSHQTVLRNWEKLKLFIYQMMESHRKDWNPDEPRDFIDAFLTEMSK 7102745
7100235 YGDKTTTSFNEENLINSTLDLFFAGSETTTNTLRWALLYITTNPEVQ 7100095
7093734 EKVHSEIDRVIGHGRQPSTDDRDSMPYTNAVIHEVLRMGNILPMNVPREVTADSTLAGFHLPK 7093546
7089277 GTMVLTNLTALHRDPKEWATPNTFNPEHFLENGQFKKRESFLPFSL 7089140
7086963 GKRACPGEQLARSELFIFFTALMQKFTFKPPINEKLSLKFRNGLTLSPVSHCICAVPRH* 7086784

>Cyp2j13 no ESTs to end with stop codons NT_039263.1|Mm4_39303_30
7064764 MLEAADSLAAAFWAALHLRTLLLAAVTFLFLADYLKSRRPKNYPPRPPRLPFVGNSFQMDLTQSHLAVQK 7064555
7059060 FVKKYGNVISLDFGIKSAVIISSLPLIKEAFSHLDENFINRRIFPLQRQIFNGN 7058899
7056233 GLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEHRIQEEASHLVEAIGEEE 7056084
7055701 GQPFDPHFKIYSAVSNIICSITFGERFEYHDSQFQELLQLLDKAMYLGTTSLMVH 7055537
7049428 LYNIFPWITKHLPGQHQTLLATWRKLKSYIADIIDNHRKDWNPDEPRDFIDAFLNEMAK 7049252
7046478 YPGKTTTSFNEENLICSTLDLFLAGTETTSSTLRWALLYMALYPEVQ 7046338
7044314 ENVQAEIDRVIGQSKHPSLADRDSMPYTNAVVHEILRMGNSVPLNIPREVAVDTTLAGFHLPK 44126
7044049 RSVVMTNLTALHMDPKEWATPDIFNPEHFLENGQFKKRESFLPFSMG 7043909
7032982 GKRACLGEQLARSELFIFFTALVQKFTFKPPANENLSLKFRLGITISPVSYRIGAVPRQ* 7032803

>Cyp2j13-de8b  NT_039263.1|Mm4_39303_30 (de = detritus exon)  ABOUT 7000BP DOWNSTREAM OF 2J13
7025751 GSVVLTNLTALQVDPKD*ATPDVVIPEHFLKNGEF*KGESFLPFSIG 7025611

>Cyp2j14-ps NT_039263.1|Mm4_39303_30 exon 3,4,9
7377737 XXXXXSNGQTWKEQKRFALMILKNFELGKKSLEQHIQEEANHLLEAMGEEK 7377600
7376950 GQPFDPHY 7376927
7376925 VSNIICFITFGDHFEYDDNKFQELLKLTDETLCSEASMMLV 7376803
7353938 GKRSCPGEQMAISELFIFFT 7353879
7353880 LFTQKFTFSPPVNEKLKFKNGLTLSPVSHHICAVPRQ* 7353767

>Cyp2j15-ps exon 3,4,5,9 NT_039263.1|Mm4_39303_30
7271792 GFI*SSSQIWKD*RFILMTLKHFGLGKILVHLMQGESCCHLVGA 7271661
7271288 GQHSDLHFIINNAVCNIIFSVTFDCFLETHDCRFQEMLKLMDEFICLETTMLHQ 7271127
7245486 LYNVFPHLMKYILVSLQTVFRN 7245421 
7245421 RGKLKLLASCMIDKHVRDWNPD*PRDFIDVFFKEMMK 7245311
7232303 GKRACHGEQLARSELFIF*TALIQKFVFKVPVNEKLSLKFRLGFPLPPVNHHIYAVPRD* 7232124

>CYP2R1 XM_146091.1 Mus musculus 16 MAY 2002
1   MLELPGARACAGALAGALLLLLFVLVVRQLLRQRRPAGFPPGPPRLPFVGNICSLALSAD 180
181 LPHVYMRKQSRVYGE 
    IFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTKMGGLL 540
541 NSRYGRGWIDHRRLAVNSFHYFGSGQKSFESKILEETWSLIDAIETYKGGPFDLKQLITN 720
721 AVSNITNLILFGERFTYEDTDFQHMIELFSENVELAASAPVFLYNAFPWIGILPFGKHQR 900
901 LFRNADVVYDFLSRLIEKAAVNRKPHLPHHFVDAYLDEMDQGQNDPLSTFSKENLIFSVG 1080
1081ELIIAGTETTTNVLRWAILFMALYPNIQGQVHKEIDLIVGHNRRPSWEYKCKMPYTEAVL 1260
1261HEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERF 1440
1441LDSNGYFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHLHFPHELVPNLKPRL 1620
1621GMTLQPQPYLICAERR 1668

>Cyp2s1   mouse AC073725.2, AC087155.1 ESTS AA562979, AA543966, AA967201, AA472776
MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGNLLQLRPGALYSGLLR 
LSKKYGPVFTVYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGTLATLDKTFDGH
GVFFANGERWKQLRKFTLLALRDLGMGKREGEELIQAEVQSLVEAFQKTE 
GRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTLLGISSPWGQ 
AYEMFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQ 
EKQDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQ 
QRVREELIQELGPGRAPSLSDRVRLPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPK 
GTEVFPLIGSILHDPAVFQNPGEFHPGRFLDEDGRLRKHEAFLPYSL 
GKRVCLGEGLARAELWLFFTSILQAFSLETPCPPGDLSLKPAISGLFNIPPDFQLRVWPTGDQSR*

>Cyp2s1 NT_039407.1 - strand 
1933418 MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGNLLQLRPGALYSGLLR 1933239
1931966 LSKKYGPVFTVYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGTLATLDKTFDGHG 1931799
1928473 GVFFANGERWKQLRKFTLLALRDLGMGKREGEELIQAEVQSLVEAFQKTE 1928324
1925993 GRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTLLGISSPWGQ 1925832
1925752 AYEMFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQ 1925573
1924579 EKQDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQ 1924439
1922453 QRVREELIQELGPGRAPSLSDRVRLPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPK 1922265
1920451 GTEVFPLIGSILHDPAVFQNPGEFHPGRFLDEDGRLRKHEAFLPYSL 1920311
1920154 GKRVCLGEGLARAELWLFFTSILQAFSLETPCPPGDLSLKPAISGLFNIPPDFQLRVWPTGDQSR* 1919957

>Cyp2s1-ie4b  NT_039407.1 + strand 2s exon 4 partial duplication
1927805 QAASGTLIGISSP*GQ 1927852

>Cyp2t4 AC073713.2 71% to CYP2T2P
MVTCLALLLLLLILMLLLWWGGVVRRQAQMQKDLPPGPAPLPLLGNLLQLQSGDLDRVLME 
LSSHWGPVFTVWLGPLPAVVLCGYEALRDALVLQADAFSGRGAMAVFDRFTCGN 
GIVFSNGPRWHSLRNFALGVLRELGVGRSTIEDRILEEAACVLDEFQATM 
GAPFDPQQLLDSAVSNVICTVVFGKRYDYGDPEFRRLLNLFSDNFCIMSSRWAE
IYNMFPSFMDWIPGPHNRIFKNFQELRLFISEQIQWHWQSRQTGEPRDFIDCFLDQMDK 
EQQDLESHFQDETLVMTTHDLFFGGTETTSTTLRYGLLIMLKYPEVA 
AKVQEELDATVGRTWAPRIEDRARLPYTNAVLHEIQRFISVLPLGLPRALTRDVNLKNHFLHK 
GTFVIPLLVSAHRDPTQFKDPDHFNPTNFLDDHGEFQNNDAFMPFAL 
GKRMCLGAGLARSEIFLFLTAILQKFSLLPVGSPANINLNPQCTGLGNVPPAFQLRLVAR* 

>Cyp2t4 NT_039413.1 + strand
157707 MVTCLALLLLLLILMLLLWWGGVVRRQAQMQKDLPPGPAPLPLLGNLLQLQSGDLDRVLME 157889 
158219 LSSHWGPVFTVWLGPLPAVVLCGYEALRDALVLQADAFSGRGAMAVFDRFTCGN 158380
158742 GIVFSNGPRWHSLRNFALGVLRELGVGRSTIEDRILEEAACVLDEFQATM 158891
159103 GAPFDPQQLLDSAVSNVICTVVFGKRYDYGDPEFRRLLNLFSDNFCIMSSRWAE 159264
159884 IYNMFPSFMDWIPGPHNRIFKNFQELRLFISEQIQWHWQSRQTGEPRDFIDCFLDQMDK 160060
160137 EQQDLESHFQDETLVMTTHDLFFGGTETTSTTLRYGLLIMLKYPEVA 160277
160379 AKVQEELDATVGRTWAPRIEDRARLPYTNAVLHEIQRFISVLPLGLPRALTRDVNLKNHFLHK 160567
160818 GTFVIPLLVSAHRDPTQFKDPDHFNPTNFLDDHGEFQNNDAFMPFAL 160958
161048 GKRMCLGAGLARSEIFLFLTAILQKFSLLPVGSPANINLNPQCTGLGNVPPAFQLRLVAR* 161230

>2U1 mouse AK018458 Mus musculus 16 days embryo lung cDNA about 78% 
MSSLG DQRPAAGEQPGARLHVRA        TGGALLLCLLAVLLGWVWLRRQRACGI
      PPGPKPRPLVGNFGHLLVPRFLRPQFWLGS     GSQTDTVGQHVYLARMARVYGNI
      FSFFIGHRLVVVLSDFHSVREALVQQAEVFSDRPRMPLISIMT
      KEKGIVFAHY
      GPIWKQQRRFSHSTLRHFGLGKLSLEPRIIEEFAYVKEAMQKHGEAPFSPF
      PIISNAVSNIICSLCFGQRFDYTNKEFKKVLDFMSRGLEICLHSQLFLINICPWFYYLPF
      GPFKELRQIERDISCFLKNIIREHQESLDASNPQDFIDMYLLHMEEEQGASRRSSFDED
      YLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQ
     KKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKT
      VLQGFTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQGQLLKRETFIPFGIG

>CYP2W1 MOUSE XM_144624 WHOLE mRNA
PARTS from GSS AZ515172 AZ329864 AZ983190 BH076787
MALLLLGVWGILLLLGLWGLLQGCTRSPSLAPRWPPGPRPLPFL
GNLHLLGVTQQDRALMELSERYGPMFTIHLGSQKTVVLSGYEVVREALVGTGHELADR
PPIPIFQHIQRGGGIFFSSGARWRAGRQFTVRTLQSLGVQQPSMVGKVLQELACLKGQ
LDSYGGQPLPLALLGWAPCNITFTLLFGQRFDYQDPVFVSLLSLIDQVMVLLGSPGIQ
LFNTFPRLGAFLRLHRPVLSKIEEVRTILRTLLETRRPPLPTGGPAQSYVEALLQQGQ
EDDPEDMFGEANVLACTLDMVMAGTETTAATLQWAVFLMVKHPHVQGRVQEELDRVLG
PGQLPQPEHQRALPYTSAVLHEVQRYITLLPHVPRCTAADIQLGGYLLPKGTPVIPLL
TSVLLDKTQWETPSQFNPNHFLDAKGRFMKRGAFLPFSAGRRVCVGKSLARTELFLLF
AGLLQRYRLLPPPGLSPADLDLRPAPAFTMRP (end may be frameshifted)
PAQTFSYDSVYSGAKAAYPYVEVGSWPFIWHHGAEGVSAQCSGPTLS

>Cyp2ab1  39% to Cyp2j5 new subfamily in Cyp2 EST BY749683.1 
B6-derived CD11 +ve dendritic cells, rat ortholog XM_221297.1 91%
NW_000107.1|Mm16_WIFeb01_286
MFSLFSGMAFLAGSCLLLKLATLCWRRSHLPPGPFPFPLLGNLWQLNFQLHPNMLFQ
LAQTHGSVFTVWLGSTPIVVLSGFRAVKEALVSNSEQFSGRPLTPFFRDLFGEKG
VICSNGLTWRQQRRFCLTTLRELGLGKQALEVQLQHEAAELAKVFLQEEGRA
FDPQIPIIRSTTRVIGTLVFGHHFLSEEPIFLELIQAINLGLAFASTIWRR
LYDMFPWALRHLSGPHQKIFQYHEAVRGFIRHEIIRHKLRTAEAPKDFINCYLSQITK
AIDDPVSTFSEENLIQVVIDLFLGGTDTTATTLHWALIYLVHHRAIQG
RVQQELDEMLGAAQTICYEDRERLPYTRAVLHEVQRLSSVVAVGAVRQCVTSTWMHGYYVPK
GTIILPNLASVLYDPECWESPHQFNPGHFLDKDGNFVANEAFLPFSA
GHRVCPGEQLARMELFLMFATLLRTFQFQLPEGSQDLGLEYVFGGTLQPQPQKICAVLR

>Cyp2ac1 Possible new subfamily in Cyp2 NW_000130.1|Mm17_WIFeb01_308 
MISSING EXON 2 probably in a seq gap 
Rat ortholog .1 80% identical
MSGFDFSAMLALLGLSLILILHINVFMAKASKHQSPPGRKSWPVIGNLHIXXXXXXXXXXXX 

GIAYAHGKCWKTMRRFSLTTLRNFLMGKRIIEDTIVTECQHLIQCFESHK
GLVLGM*RLLKASIANVIVSVLLGKWFDYQDSQFLRLLTLIGENMKLIGNPSIV 
LLNMFPILGFLLRSKKKVLRNRVELFSFIRMAFLEHCHNRNKSDPRSLIDAFLVRQQG
ENNTSANHFNEENLLALVSNLFTARTKTTASTLHWGIILMMLYPEVQS 556747
KVRGEIIKVVGSAQPRIEHRIQMPYTDTVIHEIE (fs) RVANILPTSLFHETTTDVAFKNYYIPK
GTEIITLLTSVLQDQTQWEASDAFDPAHFLSPKGTFVKKESFVPFSW 561380
GCHMCAGEPLAKMELFLFFTSLMQKFIFQSPxx (fs) VSHLDLDLTPDIGFIMQSQPHKICALVRASAL

Rat genomic ortholog to 2ac1 NW_044163.1|Rn9_1523 Rattus norvegicus chromosome 9
3425457 MSGFDFSAILALLGLILILILNIKDFMAKASKRQCPPGPKPWPVIGNLHILNLKRPYQTMLE 3425272 
3423187 LSKKYGPIYSIQMGPRKVVVLSGYETVKDALVNYGNQFGERSQVPIFERLFDGK 3423026
3415443 GIAFAHGETWKTMRRFSLSTLRDFGMGKRTIEDTIVVECQHLIQSFESHK 3415294
3412018 GKPFEIKRVLNASVANVIVSMLLGKRFDYEDPQFLRLLTLIGENIKLIGNPSIV 3411857
3410639 LFNIFPILGFLLRSHKKVLRNRDELFSFIRRTFLEHCHNLDKNDPRSFIDAFLVKQQ 3410469
3410029 ENNKSADYFNEENLLALVSNLFTAGTETTAATLRWGIILMMRYPEVQS 3409886
3408812 KVHDEIHKVVGSAQPRIEHRTQMPYTDAVIHEIQRVANILPTSLPHETSTDVVFKNYYIPK 3408627
3406238 GTEVITLLTSVLRDQTQWETPDAFNPAHFLSSKGRFVKKEAFMPFSV 3406098
3402907 GRRMCAGEPLAKMELFLFFTSLMQKFTFQPPPGVSYLDLDLTPDIGFTIQPLPHKICALLRTSAL* 3402710

>CB558367.1 AGENCOURT_13046648 NICHD_XGC_Kid1 Xenopus laevis cDNA clone
CB559919.1 AGENCOURT_13054624 NICHD_XGC_Kid1 Xenopus laevis cDNA clone
BJ030802.1 NIBB Mochii normalized Xenopus neurula library cDNA clone XL005d11 5'.
61% identical to rat 2ac1 from PPGP to end
MFLGDPVTVLLTVVLCLILANLLYGRKRNNFKNF
PPGPKPLPVIGNINIINLKRPYLTYLELWKKYGPVFSIQIGGQKMVVLCGYETVKDALVNYAEEFSERPK
IPIFRDISKEYGVLFSHGENWKVMRRFTLSTLRDFGMGRSSIEDRINEECDFLVEK
FKSYKGKPFENTMIINAAVANIIVSIILGHRFDYQDPIFLRLMSLINENIRLSGSPTVML
YNVFPSVMRWLPGSHKTIAKNAAENQR 
FIRKTFTKHRDKLDVNDQRTLVDAFLVKQQEKNVNVQYFHDENLTMIVSNLFAAGMETT
SSTIRWGLLLMMKYPEIQKNVQNEIEKVIGQSQPQTEHRKSMPYTDAVLHEIQRFGNIVP
MNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTHFEKPHEFYPQHFLDSEGNFVKNE
AFLPFSAGKRSCAGENLAKTELFLFFTSLLQNFTFQASSGRRT*

>gi|14004796|gb|BG710846.1|BG710846 pgl1n.pk005.f7 Normalized Liver Library Gallus gallus cDNA clone
           pgl1n.pk005.f7 5' similar to gb|AAF72563.1|AF151524_1
           (AF151524) cytochrome P450 2K5 [Oncorhynchus mykiss]G.
          Length = 633

 Score =  229 bits (585), Expect = 7e-59
 Identities = 110/205 (53%), Positives = 153/205 (74%)
 Frame = +1

Query: 122 RLLKASIANVIVSVLLGKWFDYQDSQFLRLLTLIGENMKLIGNPSIVLLNMFPILGFLLR 181
           +++ A++AN+IVS+LLGK FDY+DS+F+RL  L  E+M+L G P + + N+FP LGFLLR
Sbjct: 19  KIINAAVANIIVSILLGKRFDYKDSRFIRLQHLTNESMRLAGKPLVTMYNIFPYLGFLLR 198

Query: 182 SKKKVLRNRVELFSFIRMAFLEHCHNRNKSDPRSLIDAFLVRQQGENNTSANHFNEENLL 241
           + K +L+NR E  ++++  FLE+    +K+D RS IDAFLV+QQ E + +  +F+  NLL
Sbjct: 199 ANKTLLKNRDEFHAYVKATFLENLKTLDKNDQRSFIDAFLVKQQEEKSITNGYFHNGNLL 378

Query: 242 ALVSNLFTARTKTTASTLHWGIILMMLYPEVQSKVRGEIIKVVGSAQPRIEHRIQMPYTD 301
           +LVSNLFTA  +T ++TL+W  +LM+ YPE+Q KV+ EI +V+GS  PRIEHR QMPYTD
Sbjct: 379 SLVSNLFTAGVETISTTLNWSFLLMLKYPEIQRKVQEEIEQVIGSNPPRIEHRTQMPYTD 558

Query: 302 TVIHEIERVANILPTSLFHETTTDV 326
            VIHE++R ANILP  L HET   V
Sbjct: 559 AVIHEVQRFANILPLDLPHETAXXV 633

>gi|25330186|gb|BU120706.1|BU120706 603146053F1 CSEQCHL17 Gallus gallus cDNA clone ChEST145i14 5'.
          Length = 890
VVRNLFTAGMDTTATTLRWGLLLMMKYPEIQKKVQEEIDRVIGSNPPRTEHRTKMPYTDA 180
VIHEIQRFANILPLNLPHETTMDVTIKGYFIPKGTYIIPLLNSVLQDKTQWEKPCSFHPE 360
HFLNSEGEVVKKDAFIPFSAGRRICAGETLAKMELFLFFTSLLQRFTFQPPPGISSSDLDLS 545

>44. Cyp3a11       Mm.21193 genbank X60452
MDLVSALSLETWVLLAISLVLLYR
YGTRKHELFKKQGIPGPKPLPFLGTVLNYYK
GLWKFDMECYKKYGKTWG
LFDGQTPLLAVTDPETIKNVLVKECFSVFTNRR
DFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKE
MFPVIEQYGDILVKYLRQKAKKGKPVTMKD
VLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFS
VVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQK
HRVDFLQLMMNSHNNSKDKVSHK
ALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNK
APPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPER
FSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQ
IPLKLSRQGLLQPEKPIVLKVVPRDAVITGA

>ref|NT_039324.1  3a11 exons 1 to 4 - strand 
7784 MDLVSALSLETWVLLAISLVLLYR 7713
5738 YGTRKHELFKKQGIPGPKPLPFLGTVLNYYK 5646
3482 GLWKFDMECYKKYGKTWG 3429
1538 LFDGQTPLLAVTDPETIKNVLVKECFSVFTNRR 1440

>ref|NT_039323.1  3a11 exons 5 to 13 - strand frameshifts in exons 8, 10
45135 DFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKE 45022
44942 MFPVIEQYGDILVKYLRQKAKKGKPVTMKD 44853
44581 VLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFS 44438
41908 LVLFPFLTPVYEMLNICMFPKDSIEFFK 41825
41823 KFVDRMKESRLDSKQK 41776
40883 HRVDFLQLMMNSHNNSKDKVSHK 40815
38395 ALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEI 38255
38255 DEALPNK 38233
36423 APPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPER 36196
34767 FSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQ 34606
31045 IPLKLSRQGLLQPEKPIVLKVVPRDAVITGA 30953

>Cyp3a11-de12b old name Cyp3a-se11[12]
137165 RFSMENKGSIDPY 137127
137122 YLPFGNGPRNCISMRFAVMSMKFALTKLLQNCYFHSCKKTQV 136997

>Cyp3a13       Mm.4094  genbank X63023
MDLIPNFSMETWMLLATSLVLLYL
YGTHSHGIFKKLGIPGPKPLPFLGTILAYQK
GFWECDIQCHKKYGKMWG
LYDGRQPVLAITDPDIIKTVLVKECYSTFTNRR
RFGPVGILKKAISISENEEWKRIRALLSPTFTSGRLKE
MFPIINQFTDVLVRNMRQGLGEGKPTSMKD
IFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLS
VTLFPFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEK
QRVDFLQLMINSQNYKTKESHK
ALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNK
APATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPER
FSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETE
IPLKLSKQGLLQPENPLLLKVVSRDETVSDE

>NT_039315.1 Cyp3a13 diff in exon 8 start
662107 MDLIPNFSMETWMLLATSLVLLYL 662036
659635 YGTHSHGIFKKLGIPGPKPLPFLGTILAYQK 659543
658114 GFWECDIQCHKKYGKMWG 658061
656216 LYDGRQPVLAITDPDIIKTVLVKECYSTFTNRR 656118
652496 RFGPVGILKKAISISENEEWKRIRALLSPTFTSGRLKE 652383
652171 MFPIINQFTDVLVRNMRQGLGEGKPTSMKD 652082
650607 IFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLS 650464
648109 LALFPFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEK 647978
646215 QRVDFLQLMINSQNYKTKESHK 646150
641142 ALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNK 640981
639756 APATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPER 639529
636076 FSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETE 635915
635096 IPLKLSKQGLLQPENPLLLKVVSRDETVSDE 635004

>46. Cyp3a16       Mm.30303 genbank D26137 no ESTs
MNLFSALSLDTLVLLAIILVLLYR
YGTYTHGLFKKQGIPGPKPLPFLGTVLNYYK
GLWKFDMECYEKYGKTWG
LFDGQIPLFVITDPETIKNVLVKECFSVFTNRQ
DFFPVGIMSKSISLAKDEEWKRYRALLSPTFTSGNLKE
MFPVIEQYGDILVKYLRQEAEKGKPVAVKD
VLGAYSMDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLS
VALFPFLTPIYEMLNICMFPKDSIEFFKKFVDRMTENRLDSKQK
HRVDFIYLMMEAYNKSKDKDSHK
ALSEIEITAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNK
APPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPER
FSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQ
IPLKLSRELLLQPVKPIVLKVVPRDAVITGA

>NT_039318 Cyp3a16 - strand
1606555 MNLFSALSLDTLVLLAIILVLLYR 1606484
1604480 YRYGTCTHGLFKKQGIPGPKPLPFLGTVLNYYK 1604382
1602000 GLWKFDMECYEKYGKTWG 1601947
1600082 LFDGQIPLFVITDPETIKNVLVKECFSVFTNRQ 1599984
1593090 DFFPVGIMSKSISLAKDEEWKRYRALLSPTFTSGNLKE 1592977
1592897 MFPVIEQYGDILVKYLRQEAEKGKPVAVKD 1592808
1592536 VLGAYSMDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLS 1592393
1589802 VALFPFLTPIYEMLNICMFPKDSIEFFKKFVDRMTENRLDSKQK 1589671
1588782 HRVDFIYLMMEAYNKSKDKDSHK 1588714
1587226 ALSEIEITAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNK 1587065
1579094 APPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPER 1578867
1577430 FSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQ 1577269
1573447 IPLKLSRELLLQPVKPIVLKVVPRDAVITGA 1573355

>NT_039318 Cyp3a16-de12b - strand exon 12
1616751 GPRN*IGMRFALLNMKLTLTKVLQNFNFQPCKEIQ 1616647

>Cyp3a25  AF204959
MELIPNLSIETWVLLVTSLVLFYI
YGTYSHGLFKKLGIPGPKPLPLLGTIFNYYD
GMWKFDEDCYKKYGKIWG
FYEGPQPILAIMDPEIIKIVLVKECYSVFTNRR
FFGPVGFMKKAITISEDEEWKRLRTLLSPTFTSGKLKE
MFPIMRQYGDILVRNLRREEEKGEPISMKD
IFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKVFDPFLLS
IILFPFLTPIYEMLNFSIFPRDSMNFFKKFVKRMKKERLASNQK 
NRVDFLQLMMNTQNSKGQESQK
ALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNK
APVTYDALMDMEYLDMVVNESLRLYPIAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPER
FSKENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQ
IPLKISREPIFQPEKPIILKVVSRDKPRTGS

>Cyp3a25 ref|NT_039324.1 - strand 2aa diffs in exon 7 2aa diffs exon 8
150349 MELIPNLSIETWVLLVTSLVLFYI 150278
missing exon 2
142322 GMWKFDEDCYKKYGKIWG 142269
139406 FYEGPQPILAIMDPEIIKIVLVKECYSVFTNRR 139308
135799 FFGPVGFMKKAITISEDEEWKRLRTLLSPTFTSGKLKE 135686
134182 MFPIMRQYGDILVRNLRREEEKGEPISMKD 134093
133856 IFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPSLLS 133713
130509 VVLFPFLTPIYEMLNFSIFPRDSMNFFKKFVKRMKKERLASNQK 130378
128909 NRVDFLQLMMNTQNSKGQESQK 128844
125685 ALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNK 125524
missing exon 11
120750 FSKENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQ 120589
116904 IPLKISREPIFQPEKPIILKVVSRDKPRTGS 116812

>Cyp3a25-de8b9b12b NT_039324.1 3a exon 8,9,12 + strand
 95234 PVFFSFLIPI*EMLNISVFQKGSIAFFKKFVDRMNESRPDSKQK 95365
104188 XXVGFLQPMINAHNNPKDKES 104244
107625 XXXXXXGSIDYVYLSFGNGPRIYIGVRFTLMNMKVLTLTKVLHNFSFHPCKETX 107765

>Cyp3a25-de11c NT_039324.1 - strand exon 11
168333 XPVTLGTLVEIEYPDMVVT*ILILYPIGNRPESVCKEGFEVFIPKGTRVTVPTFALH*DPQYWPELEKXXXXX 168133

>48. Cyp3a41     mouse NM_017396 AB033414
MNLFSALSLDTWVLLAIILVLLYR
YGTRTHGLFKKQGIPGPTPLPFLGTVLNYYK
GLWKFDMECYEKYGKTWG
LFDGQMPLFVITDPEMIKNVLVKECFSVFTNRR
EFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKE
MFPVIEQYGDILVKYLMQEAEKGKPVTMKD
VLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFS
VVLFPFLTPVYEMLNICMFPKDSIEFFKKFVNRMKESRLDSKQK
HRVDFLQLMMNAHNNSKDKDSHK
ALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNK
APPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPER
FSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQ
IPLKLSRQGLLQPEKPIVLKVVPRDVVITGA

>NT_039318 Cyp3a41 - strand
1721554 MNLFSALSLDTWVLLAIILVLLYR 1721483
1719522 YGTRTHGLFKKQGIPGPKPLPFLGTVLNYYK 1719430
1717019 GLWKFDMECYEKYGKTWG 1716966
1715109 LFDGQMPLFVITDPEMIKNVLVKECFSVFTNRR 1715011
1710659 EFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKE 1710546
1710466 MFPVIEQYGDILVKYLMQEAEKGKPVTMKD 1710377
1710105 VLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFS 1709962
1707377 VVLFPFLTPVYEMLNICMFPKDSIEFFKKFVNRMKESRLDSKQK 1707246
1706355 HRVDFLQLMMNAHNNSKDKDSHK 1706287
1703783 ALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNK 1703622
1701478 APPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPER 1701251
1699826 RFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQ 1699662
1696132 IPLKLSRQGLLQPEKPIVLKVVPRDVVITGA 1696040

>Cyp3a41-de1b2b NT_039318 exon 1,2 - strand y in Fig. 3b
possible alternative exons for 3a41
1729618 MNLFSALSLDTLVLLAIILVLLYR 1729547
1727537 YGTCTHGLFKKQGIPGPKPLPFLGTVLNYYK 1727445

>Cyp3a41-de12c NT_039318 exon 12 - strand x in fig. 3b
1739825 SNGPRN*IGMRFALLNMKLTLTKVLQNFNFQPCKEIQ 1739715

>ref|NT_039320.1 new 3a frag exon 13 - strand matches 3a41
u in fig. 3b
5443 IPLKLSRQGLLQPEKPIVLKVVPRDVVITGA 5351

>ref|NT_039321.1 new 3a frag exon 13 - strand matches 3a41
t in fig. 3b
743 IPLKLSRQGLLQPEKPIVLKVVPRDVVITGA 651

>ref|NT_039322.1 new 3a frag exon 10,11 - strand matches 3a41
s in fig. 3b
3953 ALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNK 3792
1615 APPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPER 1388

>49. Cyp3a44     mouse AB039380 Tsutomu Sakuma 10-JAN-2001
MNLFSALSLDTLVLLAIILVLLYRYGTRTHGLFKKQGIPGPKPLPFLGTVLNYYTGIWKFDMECYEKYGKTWGLFD
GQTPLLVITDPETIKNVLVKDCLSVFTNRREFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGRLKEMFPVIEQY
GDILVKYLRQEAEKGMPVAMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEEAKKFLRVDFFDPLLFSVVLFPL
LTPVYEMLNICMFPNDSIEFFKKFVDRMQESRLDSNQKHRVDFLQLMMNSHNNSKDKDSHKAFSNMEITVQSIIFI
SAGYETTSSTLSFTLYCLATHPDIQKKLQAEIDKALPNKATPTCDTVMEMEYLDMVLNETLRLYPIVTRLERVCKK
DVELNGVYIPKGSMVMIPSYALHHDPQHWPDPEEFQPERFSKENKGSIDPYVYLPFGIGPRNCIGMRFALMNMKLA
VTKVLQNFSFQPCQETQIPLKLSRQGILQPEKPIVLKVVPRDAVITGA

>Cyp3a44-de9b10b11b = Cyp3a-se1[9:10:11] NT_039319.1 new 3a frag from 267-289 exon 9 - strand 77% to 3A58-ps
1291 HQVDFLHLMINAHDKTKDKETHK 1223
ALSNMEITTQSIMFIFASYKPTSSTLSFALCSLVTHHAS*KKLQENDKTLTNK
7296 VELESLDMVLNETLRLYPTADRLVKVYKKDVELNDAFILKWSLEIVSCYSLCHDPQNWPEHKEFCPEE 7093

>Cyp3a44-de9b10b11b = Cyp3a-se1[9:10:11] NT_039319.1 also AC111090.3
174117 HQVDFLHLMINAHDKTKDKETHK 174185
178967 ALSNMEITTQSIMFIFASYKPTSSTLSFALCSLVTHHAS*KKLQENDKTLTNK 179125
182898 VELESLDMVLNETLRLYPTADRLVKVYKKDVELNDAFILKWSLEIVSCYSLCHDPQNWPEHKEFCPE 183098

>Cyp3a44-de9b10b11b NT_068571.1|MmUn_68611_30 3a exon 11
7296 VELESLDMVLNETLRLYPTADRLVKVYKKDVELNDAFILKWSLEIVSCYSLCHDPQNWPEHKEFCPEE 7093

>ref|NT_039319.1 new 3a frag from 267-289 exon 9 - strand
w in fig. 3b 100% to Cyp3a44-de9b10b11b
1291 HQVDFLHLMINAHDKTKDKETHK 1223

note 3a44 is on this contig at 161146-143718 minus strand (exons 11-13 in a gap)

>CYP3A44-de12c NW_010735.1|MmUn_WIFeb01_19429 Length = 1878 3 diffs with CYP3a44 including one stop. Only one diff to 3a62-ps
674 RFSKEN*GSIDPYVYMPFGIGPRNCIGMRFALMNMKLALTKVLQNFSFQPCQETQ

>Cyp3a57 AC115895.3, XM_144630 XP_144630 Genbank assembly incorrect
MELIPNLSIQTWVLLVTSLVFFYI
YGTYSHGLFKKLGIPGPKPLPLFGNIINYLD
GMWKFDDDCYKKYGKIWG
FYEGPQPILAIMDPEIIKIVLVKECYSVFTNRR
PFGPVGFLKKSITISEDEEWKRLRTLLSPTFTSSKLKE
MFPIMRQYGDILVRNLRREEEKEEPINMK
DIFGAYSMDVITGTSCGVNIDSLNNPQDPFVQKIKKILKFKFFDPFLLS 
VVLFPFLTPIYEMLNLSIFPRQSMNFFKKFVKKMKKDRLDYNQK
NRVDFLQLMMNTQNSKGQESLK
ALSDLEMAAQTLIFIFGGYDGTSTSISFIMYELATHPDVQKKLQDEIDRALPNK
APVTYDALMDMEYLDMVVNESLRLYPVVSRIDRFSKKDVEIHGVFIPKGTIVMIPIYPLHRDPEYWPEPEDFCPER
FSKENKGNIDPYIYMPFGNGPRNCIGMRFALISVKLAVTGVLQNFTVQPCEETQ
IPVKISRQPIFRPEKPIILKFVSRDKPRTGP

>Cyp3a57 AC115895.4 13 exons, exon 9 is backwards
37518 MELIPNLSIQTWVLLVTSLVFFYI 37589
41499 YGTYSHGLFKKLGIPGPKPLPLFGNIINYLD 41591
54228 GMWKFDDDCYKKYGKIWG 54281
57786 FYEGPQPILAIMDPEIIKIVLVKECYSVFTNRR 57884
61197 PFGPVGFLKKSITISEDEEWKRLRTLLSPTFTSSKLKE 61310
62805 MFPIMRQYGDILVRNLRREEEKEEPINMKD 62894
63129 IFGAYSMDVITGTSCGVNIDSLNNPQDPFVQKIKKILKFKFFDPFLLS 63272
64691 VVLFPFLTPIYEMLNLSIFPRQSMNFFKKFVKKMKKDRLDYNQK 64822
66717 NRVDFLQLMMNTQNSKGQESLK 66652
69297 ALSDLEMAAQTLIFIFGGYDGTSTSISFIMYELATHPDVQKKLQDEIDRALPNK 69458
73294 APVTYDALMDMEYLDMVVNESLRLYPVVSRIDRFSKKDVEIHGVFIPKGTIVMIPIYPLH 73473
73474 RDPEYWPEPEDFCPER 73521
79016 FSKENKGNIDPYIYMPFGNGPRNCIGMRFALISVKLAVTGVLQNFTVQPCEETQ 79177
82474 IPVKISRQPIFRPEKPIILKFVSRDKPRTGP 82566

>NT_039318 Cyp3a57 + strand
1479189 MELIPNLSIQTWVLLVTSLVFFYI 1479260
1483217 YGTYSHGLFKKLGIPGPKPLPLFGNIINYLD 1483309
1496999 GMWKFDDDCYKKYGKIWG 1497052
1500559 FYEGPQPILAIMDPEIIKIVLVKECYSVFTNRR 1500657
1503970 PFGPVGFLKKSITISEDEEWKRLRTLLSPTFTSSKLKE 1504083
1505578 MFPIMRQYGDILVRNLRREEEKEEPINMKD 1505667
1505902 IFGAYSMDVITGTSCGVNIDSLNNPQDPFVQKIKKILKFKFFDPFLLS 1506045
1507464 VVLFPFLTPIYEMLNLSIFPRQSMNFFKKFVKKMKKDRLDYNQK 1507595
1509172 NRVDFLQLMMNTQNSXXXXXXX 1509216
1513849 ALSDLEMAAQTLIFIFGGYDGTSTSISFIMYELATHPDVQKKLQDEIDRALPNK 1514010
1518021 APVTYDALMDMEYLDMVVNESLRLYPVVSRIDRFSKKDVEIHGVFIPKGTIVMIPIYPLHRDPEYWPEPEDFCPER 1518248
1523812 FSKENKGNIDPYIYMPFGNGPRNCIGMRFALISVKLAVTGVLQNFTVQPCEETQ 1523973
1527270 IPVKISRQPIFRPEKPIILKFVSRDKPRTGP 1527362

>Cyp3a58-ps NT_039318 + strand exon 8
1629527 PVFFSFLNPI*EMLKISVFPKDSIAFFKKKLWTEQRKTSWILSKR 1629661

>Cyp3a58-ps NT_039318 + strand exon 10
1651425 ALSNIEITTQSIMFIFASYEPTSSTLSFVLYLLVTHHDIWKKLQENDRALPNK 1651583

>Cyp3a58-ps NT_039318 + strand exon 11
1660734 VEMEYLDMVLNETLRLYPTADRFVKVYKKDVELNDAFILKWS 1660859

>Cyp3a58-ps NT_039318 + strand exon 12
1669382 FSMENKGSIDPYX 1669417
1669422 YMPFGNGPRNCISMRFAVMSMKFALTKVLQNCYLHPCKETQ 1669544

>Cyp3a59 cyp3agg 93% to Cyp3a25 NW_000248.1|Mm5_WIFeb01_96 gene interrupted by gaps AC113316.2
LLLYRYGTYSHGLFKKLGIPGPKPLPLFGTIFNYFD
GMWKFDEDCYKKYGKIWG 
FYVGPKPILAIMDPEIIKIVLVKECYSVFTNR 
RLLGPVGFLKKSITISEDEEWKRLRTLLSPTFTSGKLKE
MFPIMRQYGDILVRNLRREEEKGEPINMKE
IFGAYSMDVITGTSFGVNIDSLNNPQNPFVQKTKKILKFKIFDPFLLS
VVLFPFLTPIYEMLNLSIFPRDSMNFFKKFVKRMKKERLASKQK
NRVDFLQLMMNTQNSKGQESQK
ALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNK
APVTYDALMDMEYLDMVVNESLRLYPTAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLH
RNPEYWPEPQEFCPG
RFSKENEGNIDPYIYMPFGNGPRNCLDMRFALISMKLAVIGVLQNFTVQPCEETQ
IPLKISREPVFQPEKPIILKVVSRDKPRT

>Cyp3a59 ref|NT_039324.1 + strand Cyp3agg
205766 MELIPNLSIETWVLLVTSLVFFYI 205837
212148 YGTYSHGLFKKLGIPGPKPLPLFGTIFNYFD 212240
213760 GMWKFDEDCYKKYGKIWG 213813
217031 FYVGPKPILAIMDPEIIKIVLVKECYSVFTNR 217126
220741 RLLGPVGFLKKSITISEDEEWKRLRTLLSPTFTSGKLKEV 220860
missing exon 5,6,7
225418 NRVDFLQLMMNTQNSKGQESQK 225483
missing exon 9,10
234783 FSKENEGNIDPYIYMPFGNGPRNCLDMRFALISMKLAVIGVLQNFTVQPCEETQ 234944
238519 IPLKISREPVFQPEKPIILKVVSRDKPRT 238605

>Cyp3a59-de11b NT_039324.1 - strand exon 11
191646 VSFLLVTLVEIEYLDILVT*ILRLNPIGNRLESVSKK 191536
191539 EMFEVFIPKGTRVTVLTFALH*DEQYWPEXXXXXXXX 191453

>Cyp3a60-ps NT_039324.1 + strand Cyp3a ps about 60% to 3A25
exon 2
331420 PVRLPVIGLLLSLYN 331464
exon 5
338061 KKVITISEEDERKRL*TLLSPTFIS 338135
exon 6
338410 MFPIIGQYGETLVK  338451
338451 KKRKGEPINMKE 338486
exon 7
338734 SMDVVTGTLFGVNVDSLTNSSDPCAESQGDLNKFEFS*PTSLG 338862
Exon 8
341951 VAMLPFLTTIYKILSISIFP 342010
342409 KYMKQSRLDTNQK 342447

>Cyp3a61-ps NT_039315.1 Cyp3ayyp Exons 10,11,12,13 also on NW_000239.1
1115767 ALSDLEIVAQSISFIFAGYETTSNTLSYIMYTLATHPDVQKKLQQEIDAILPNK 1115606
1113252 APATYNDLEKIEYLDMVINETLRLYPIGARISRLSKKDAEINGVFIPQNTEVAVPVF 1113082
1109396 FSQENKDRINPYVYMPFGNGPRNCLGMRFALINMKLAVVKILQNFSVQPCEDTE (0) 1109235
1108058 IPLKLSKKLILSPEKPIVLKVTARDGAINEG* 7963

>Cyp3a61-de11b NT_039315.1 Cyp3azzp exon 11 also on NW_000239.1
1136553 APATYNGLVKIRYLDMVINETLRLYPVGVRISRLSKKDAEINGVLTPQNTKVDVALFVLH*DPEYWPXXXXXXXXX 1136353

The following seqs are part of one pseudogene 3a63-ps

>NT_045749.1|MmUn_45789_30 3a exon 2 same as 3a63-ps
396 YGTLTQGLFKKQGIPGPKALTFLGTVLNYYK 304

>NT_071156.1|MmUn_71196_30 exons 5,6,7 same as 3a63-ps
868 EFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGRLKE 755
675 MFPIIEQYGDILVKYLRQEAEKGKPVAMKD 586
316 VLGAYIMDVITSTSFGVNVNSLNNPEDSFVEKARKILRVDFFDPLLFS 162

>Cyp3a44-se3[10] NW_037585.1|MmUn_WIFeb01_5425 3 diffs to 3a44
same as CYP3A63-ps
649 AFSNMEITAQSIIFISAGYETTSSTLSFTLYCLATHPDIQKKLQEEIEKALPNK 

>Cyp3attp 80% to 3a11 NW_008810.1|MmUn_WIFeb01_17679 one frameshift and small deletion same as CYP3a63-ps exon 11
VPPTYDSVMEMEYLDVVLNETLRFYPIVTRLERVCKKDVELNGVYTPKGSTVMIPS
YALHHHWPESEEFQPER

>CYP3A44-se1[12] NW_005077.1|MmUn_WIFeb01_14285 Length = 2124 2 diffs with CYP3a44
1231 RFSKENKGSIDPYVYMPFGIGPRNCIGMRFALMNMKLALTKVLQNFSFQPCQETQ 1067

>Cyp3a63-ps AC114427.2 note 3a62 = a rat seq this number is not right
YGTLTQGLFKKQGIPGPKALTFLGTVLNYYK
GFWKFDMECYEKYGKTWG
LFDGQMPLFVITDP*MIKNVLVKECFSVFTNRR 
868 EFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGRLKE 755
675 MFPIIEQYGDILVKYLRQEAEKGKPVAMKD 586
316 VLGAYIMDVITSTSFGVNVNSLNNPEDSFVEKARKILRVDFFDPLLFS 162
HRVDFLQLMMNAHNNSKDKDSHK 
AFSNMEITAQSIIFISAGYETTSSTLSFTLYCLATHPDIQKKLQEEIEKALPNK
VPPTYDSVMEMEYLDVVLNETLRFYPIVTRLERVCKKDVELNGVYTPKGSTVMIPSYALHH(fs)HWPESEEFQPER
FSKENKGSIDPYVYMPFGIGPRNCIGMRFALMNMKLALTKVLQNFSFQPCQETQ
IPLKLSRQGILQPEKPIVLKVVPRDAVITGA

unnamed Cyp3a fragments between 3a41 and 3a11 

>Cyp3a-se3[1] NT_039319.1 new 3a frag from 1-24 exon 1 + strand
v in fig. 3b
14293 MEPV (frameshift) FSSLTGYEWILLAIILVLLYR 14358

>Cyp3a-se4[5:6] NT_071157.1|MmUn_71197_30 3a exons 5,6
549 EFGSVAIMSKAISISKDEECKRYRALLSPTFTSGRLKE 436
356 MFPIIEQYGDILVKYLRQEAEKGKPVAMKD 267

>Cyp3a-se5[12] NT_071987.1|MmUn_72027_30 3a exon 12
12194 FIKESKGNIHPYIYLPFGNGPRN*IGMRFALLNMKLTLTKVLQNFTFQPCKETQ 12033

>Cyp3a-se6[12] NT_055698.1|MmUn_55738_30 3a exon 12
1226 FSMENKGSIDPYX 1191
1186 YLPFGNGPRNCISMRFAVMSMKFALTKLLQNCYFHSCKKTQ 1064

>Cyp3a-se7[8:9:10] NT_067897.1|MmUn_67937_30 3a exon 8
NT_059425.1|MmUn_59465_30 3a exon 10
5042 FATFFFVPVFFSFLNPI*ETLKISVFPKDSIAFFKK 4935
4933 IVERTKENCLDSKQK 4889
HQVDFLHLMINAHDNTKDNESHK
979 SMCNMEITTQSIMFIFASYKPTSSTLSFGLYSLLTHHDS*KNLRENDRALPNK 821

>Cyp3a-se8[2] NT_070793.1|MmUn_70833_30 1 diff to 3a11 exon 3
671 GFWKFDMECYKKYGKTWG 618

>Cyp3a-se9[8] NT_050947.1|MmUn_50987_30 2 diffs to 3a41 exon 9
174 HRVDFLQLMMNAHNNSKDKNSHQ 106

>Cyp3a-se10[12] NT_050917.1|MmUn_50957_30 3a exon 12
521 FSMENKGSIDPYXXXXXX 486
483 NGPRNCISMRFAVMSMKFALTKVLQNFYFHPCKKTQ 377

>Cyp3a-se11[12] NT_074310.1|MmUn_74350_30 3a exon 12 2 diffs to 3a16, 3a41 3a44
1107 YGTLTQGLFKKQGIPGPKPLPFLGTVLNYYK 1199

>Cyp3a-se12[10] NT_056284.1|MmUn_56324_30 3a exon 10
799 MEITTQSIMFIFASYKPISSTLSFGLYSLLT*HDS*KNLQENDEALPNK 653

>66. Cyp4x1 AJ297131 runs from 112000 to 138000 on the minus strand
MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQK
FLQEDNMETLDEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRT
GRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVML
DKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQIN 
STYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYT 
EKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQ 
GKEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITW
EQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAG 
MTVVLSIWGLHHNPAVWNDPK 
VFDPLRFTKENSDQRHPCAFLPFSSGP 
RNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTVLRPKHGIYLHLKKL

>NT_039264.1 Cyp4x1 - strand
15279654 MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQK 15279478
15273259 FLQEDNMETLDEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRT 15273119
15270146 GRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVML 15270018
15267661 DKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQIN 15267536
15267458 STYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYT 15267303
15265303 XXEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITW 15265115
15258615 EQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAG 15258481
15257357 MTVVLSIWGLHHNPAVWNDPK 15257295
15255788 VFDPLRFTKENSDQRHPCAFLPFSSGP 15255708
15254535 RNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTVLRPKHGIYLHLKKLXX 15254371

>NT_039685.1 Cyp4x1 a duplicate of part of NT_039264.1
138244 LHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQK 138107

128777 GRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVML 128649

126286 DKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQIN 126161

123925 XXEDERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITW 123737
116595 EQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAG 116461

112511 RNCIGQQFAMLELKVAIALILLHFQVAPDLTRPPAFSSHTVLRPKHGIYLHLKKL 112347

>53. Cyp4a28p AJ297131, lower case = 4a10, same contig as 4x1
4.112000001-113000000 from Ensembl mouse version 3 chr 4 add 112 million to numbers
943832 MSISALSPTRFLECVSGFLQVVSLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGH 943647 
939707 QFKEDEELRWVLRYVEKFPSAFLHWIWGN 939621 frameshift
939621 *VFIKIYDPDYMKVILGRA 939565                                   
939009 SDPKAGLYRFLTPWL 938965                                          
938111 GHGLFILNGHKWFQHRRMLTSAFHYDILKPYVGTMADSVQVIL 937983               
930960 DKWEQIACQDITLEIFHPISLMMLETIMKCAFSYQGSVQLDRS 930832               
930514 RSSQAYLQAVSDLNNLVTSRMTNVFLHNDIIYNLTSHSRRTNSACQIAHEHT 930359      
929925 DRVVKLRKAQLQDNKSMEKLRGKRCLDFLDILLLSRVSS 929809        
       DDGSSLSDKALRAEVDSLMFGDHDTPASGISWVFYALATHPNHQQRCTEEVQSLLGDGSPITW 929542 
       EHLHQMPYTTLCVKEAQRLYPTVPSVGRKLNTPVTFPDGRSLPKG 929424
(missing exon 10)
927997 VFDPSRFAMNSVQHSHAFLPFSGGS 927923                               
926387 RNCIGKQLAMNALKVAVALTLLRFELLPDPT*VPIPTHQLILKSTNGIHL 926238        

exact duplicate of exons 6-12
925899 RSSQAYLQAVSDLNNLVTSRMTNVFLHNDIIYNLTSHSRRTNSACQIAHEHT
       DRVVKLRKAQLQDNKSMEKLRGKRCLDFLDILLLSRVSS 925195
       MDDGSSLSDKALRAEVDSLMFGDHDTPASGISWVFYALATHPNHQQRCTEEVQSLLGDGSPITW 924927 
       EHLHQMPYTTLCVKEAQRLYPTVPSVGRKLNTPVTFPDGRSLPKG 924809
923831 IESTVSCFIFSSAWKAFDKPE
923372 VFDPSRFAMNSVQHSHAFLPFSGGS 923298                               
922002 RNCIGKQLAMNALKVAVALTLLRFELLPDPT*VPIPTHQLILKSTNGIHLHLRKL 921838   

>NT_039264.1 100% match to Cyp4a28p - strand missing 9aa in exon 10
15302183 MSISALSPTRFLECVSGFLQVVSLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGH 15301998
15298056 QFKEDEELRWVLRYVEKFPSAFLHWIWGN 15297970
15297970 *VFIKIYDPDYMKVILGRA 15297914
15297358 SDPKAGLYRFLTPWL 15297314
15296460 GHGLFILNGHKWFQHRRMLTSAFHYDILKPYVGTMADSVQVIL 15296332
15288995 DKWEQIACQDITLEIFHPISLMMLETIMKCAFSYQGSVQLDRS 15288867
15288531 RSSQAYLQAVSDLNNLVTSRMTNVFLHNDIIYNLTSHSRRTNSACQIAHEHT 15288394
15287961 DRVVKLRKAQLQDNKSMEKLRGKRCLDFLDILLLSR 15287854
15287768 MDDGSSLSDKALRAEVDSLMFGDHDTPASGISWVFYALATHPNHQQRCTEEVQSLLGDGSPITW 15287577
15287475 EHLHQMPYTTLCVKEAQRLYPTVPSVGRKLNTPVTFPDGRSLPK 15287344
15286209 GITVLLHFYALHH 15286171
15286022 VFDPSRFAMNSVQHSHAFLPFSGGS 15285948
15284412 RNCIGKQLAMNALKVAVALTLLRFELLPDPT*VPIPTHQLILKSTNGIHLHLRKL 15284248

>NT_039685.1 Cyp4a28p a duplicate of part of NT_039264.1
160803 MSISALSPTRFLECVSGFLQVVSLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGH 160618 
156679 WQFKEDEELRWVLRYVEKFPSAFLHWIWGN 156590
156590 *VFIKIYDPDYMKVILGRA 156534

155080 GHGLFILNGHKWFQHRRMLTSAFHYDILKPYVGTMADSVQVIL 154952
147615 DKWEQIACQDITLEIFHPISLMMLETIMKCAFSYQGSVQLDRS 147487
147169 RSSQAYLQAVSDLNNLVTSRMTNVFLHNDIIYNLTSHSRRTNSACQIAHEHT 147014
146581 DRVVKLRKAQLQDNKSMEKLRGKRCLDFLDILLLSR 146474
146388 MDDGSSLSDKALRAEVDSLMFGDHDTPASGISWVFYALATHPNHQQRCTEEVQSLLGDGSPITW 146197
146095 EHLHQMPYTTLCVKEAQRLYPTVPSVGRKLNTPVTFPDGRSLPKG 145961
144642 VFDPSRFAMNSVQHSHAFLPFSGGS 144568
143032 RNCIGKQLAMNALKVAVALTLLRFELLPDPT*VPIPTHQLILKSTNGIHLHLRKL 142868

>Cyp4axxp pseudogene fragments C-term LOC230636 from mouse genome
  1 MNTLKVAVALTLLQFERLPDPTRVPIPTLQLVLI 102
978 SKNAIHLHLRKLQ* 1019

>Cyp4a29-de12b NT_039264.1 Cyp4axxp + strand 78% to 4a29
15321475 KNCIVKQIAMNTLKVAVALTLLQFERLPDPTRVPIPTLQLVLI 15321603
15322479 SKNAIHLHLRKLQ* 15322520

>NT_039685.1 Cyp4axxp a duplicate of part of NT_039264.1
180104 KNCIVKQIAMNTLKVAVALTLLQFERLPDPTRVPIPTLQLVLIS 180235

>Cyp4azz pseudogene fragments mid to C-term LOC230637 from mouse genome
   1 MLNTIIKCAFCYQGSVPLDRS 63
 427 RNFQSYLQAVSYLNSIKSFCMLNLFQQNSYKLSSDGHRANCACQTVRKY 573
1007 TD*VIKMRKAQQSKGSMEKLRGKR 1078
1349 FVGSSLLRNCIEKQLAMNVLKMDAALTLLGFD 1444

>NT_039685.1 Cyp4azzp 
222947 QWEKII**DTTLEIFHHVSLMMLNTIIKCAFCYQGSVPLD 223066

>Cyp4a29-de5b6b7b9b  NT_039264.1 Cyp4azzp + strand
15364293 QWEKII**DTTLEIFHHVSLMMLNTIIKCAFCYQGSVPLDRS 15364418
15364782 RNFQSYLQAVSYLNSIKSFCMLNLFQQNSYKLSSDGHRANCACQTVRKY 15364928
15365362 TD*VIKMRKAQQSKGSMEKLRGKR 15365433
15365704 FVGSSLLRNCIEKQLAMNVLKMDAALTLLGFD 15365799

>Cyp4a29 4.113000001-114000000 chr 4 from mouse Ensembl version 3 add 113 million to numbers
91% to 4A28p
47095 MSISALSPIRFLECVSGFLQVIFLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGH 47280 
53123 QFKVDEELRWILRYLEKFPGAFLHWIWGSHVFIKVCDPDYMKVILGRA 53266          
53824 SDPKASLYRFLTPWL 53868                                           
54675 GHGLFFLNGDEWFQHRRLLTPAFHYDILKPYVGIMADSVQVML 54803
55849 EKWEQIACQDITLEIFHPISLMMLDTIMKYAFSYQGSVQLDRS 55977                 
56295 RSSQAYLQAVSDLNNLVTSRMKNVFLHNDIIYNLTSHSRRTNSACQIAHEHT 56450        
56880 DRVVKLRKAQLQDNKSMKKLRGKRCLDFLDILLLSRVSS 56996
57075 DDGSSLSDKALRAEVDSLMFGGHDTPASGISWVFYALATHPDHQQRCREEVQSLLGDGSPITW 57263 
57362 DHLHQMPYTTMCIKEALRLYPPIPSVGRKLSTPVTFPDGRSLPKG 57378
58567 IESTVSCFIFFSAWKAFDKPE
59045 VFDPSRFAMNSVQHSHAFLPFSGGS 59119                                 
60585 RNCIGKHLAMNVLKVAVALTLLRFELLPDPSRVPIPTQQLVLKSKNGIYLHLRKL 60749     

>NT_039264.1 Cyp4a29 + strand
15387761 MSISALSPIRFLECVSGFLQVIFLIGLLLLLFKAAQHYLRRQWLLRALYQFPSPPSHWLFGH 15387946
15392606 QFKVDEELRWILRYLEKFPGAFLHWIWGSHVFIKVCDPDYMKVILGRA 15392749
15393307 SDPKASLYRFLTPWL 15393351
15394158 GHGLFFLNGDEWFQHRRLLTPAFHYDILKPYVGIMADSVQVML 15394286
15395332 EKWEQIACQDITLEIFHPISLMMLDTIMKYAFSYQGSVQLDRS 15395460
15395778 RSSQAYLQAVSDLNNLVTSRMKNVFLHNDIIYNLTSHSRRTNSACQIAHEHT 15395933
15396362 DRVVKLRKAQLQDNKSMKKLRGKRCLDFLDILLLSR 15396469
15396554 MDDGSSLSDKALRAEVDSLMFGGHDTPASGISWVFYALATHPDHQQRCREEVQSLLGDGSPITW 15396745
15396844 DHLHQMPYTTMCIKEALRLYPPIPSVGRKLSTPVTFPDGRSLPKG 15396978
15398321 ITVLLHFYALHHNPKVWPNPE 15398383
15398524 VFDPSRFAMNSVQHSHAFLPFSGGS 15398598
15400064 RNCIGKHLAMNVLKVAVALTLLRFELLPDPSRVPIPTQQLVLKSKNGIYLHLRKLQ* 15400234

>51. Cyp4a12a no UNIGENE entry genbank X71479, Y10222 EST AA882070 vx36a01.r1
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHK
ILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRS
DPKANGSYRFLAPWIG
RGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVML
DKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRK
YKSYIQAVEDLNDLVFSRVRNIFH(Q)NDIIYRVSSNGCKANSACKLAHDHT
DQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFAR
MENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITW
NDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKG
IHVMLSFYGLHHNPTVWPNPE
VFDPSRFAPGSSRHSHSFLPFSGGA
RNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ*

>Cyp4a12b david bell 4a12 NM_172306 = Cyp4a12b
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWL
LSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDY
MKLILGRSDPKAHGSYRFLAPWIGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIM
ADSVRVMLDKWEQIVGQDSTLEIFQHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQA
VEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHTDQVIKSRRSQLQDEE
ELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYA
LATNPEHQQRCRKEIQSLLGDGASITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELS
SPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSG
GARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ

>CYP4a12a Jorge Capdevilla 4aVJ2 
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWL
LSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDY
MKLILGRSDPKANGSYRFLAPWIGRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIM
ADSVRVMLDKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQA
VEDLNDLVFSRVRNIFHLNDIIYRVSSNGCKANSACKLAHDHTDQVIKSRRIQLQDEE
ELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYA
LATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELS
SPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSG
GARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKELQ

>Cyp4a12a-de5b new exon 5 + strand
15432755 NKWE*NISDSLEIFQCASLITLATIIMCAFSYQDNVHLNRSVTYIKWVRKL 15432907

>NT_039264.1 Cyp4a12a + strand
15444805 MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHK 15444993
15446379 ILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRS 15446519
15447132 DPKANGSYRFLAPWI 15447176
15447587 GRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVML 15447715
15471867 DKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDR 15471992
15472306 KYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHT 15472458
15472890 DQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFAR 15472997
15473092 MENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITW 15473283
15473384 NDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKG 15473518
15474392 IHVMLSFYGLHHNPTVWPNPE 15474454
15474603 VFDPSRFAPGSSRHSHSFLPFSGGA 15474677
15477509 RNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ* 15477679

>Cyp4a30-ps NT_039264.1 Cyp4aaab + strand missing exons 1-4
15489465 DKWEQLVGQDCPLEIYQDISLMTMETIMKCAFSYQGSVQLE 15489587
15489953 NSKSYIKAVEDLTHLIYLRVRNGFHQNNTIYSLSSNGRSFYHACQIAHKHT 15490105
15497986 ERVICMRKAQLQNEAELEKVRKKKHLDFLDILLFAQ 15498093
15498179 TEDGKSLSDEDVRAEVDTFRFEGHDTTASGISWIFYALATHPEHQQRCREEVKSILGNGTSVTW 15498370
15498472 NYLDQMPYTTMCIKEALRLYPPIPGVSREFSSPVTFPDRRSLPK 15498603
15500524 GFLVTLSFYGLHHNPRLWPNAE 15500589
15500709 VFDPSRFAPGAPWHTHAFLPFSAGTR 15500786
15508625 RNCIGKQFTMNELKVAVALTLLRFELLPDPTSVPILVLRIVLKSKNGIYLHIKKL 15508789

>Cyp4a12b-de2b5b new exon 2,5 + strand
15541025 LLVYDPD*VTLILGRA 15541072
15544976 NKWE*NISDSLEIFQCASLITLATIIMCAFSYQDNVHLNRSVTYIKWVRKL 15545128

Note region between exon 5s in 4a12 sequences is 94% identical at nuc. level

>NT_039264.1 Cyp4a12b + strand 97% identical to 4a12a 11 diffs
15557360 MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHK 15557548
15558934 ILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRS 15559074
15559687 DPKAHGSYRFLAPWI 15559731
15560146 GRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVML 15560274
15578119 DKWEQIVGQDSTLEIFQHITLMTLDTIMKCAFSHEGSVQLDR 15578244
15578559 KYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHT 15578711
15579143 DQVIKSRRSQLQDEEELEKLKKKRRLDFLDILLFAR 15579250
15579345 MENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGASITW 15579536
15579637 NDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPK 15579768
15580644 GIHVMLSFYGLHHNPTVWPNPE 15580709
15580857 VFDPSRFAPGSSRHSHSFLPFSGGA 15580931
15583732 RNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKL 15583896

>Cyp4a30b Cyp4aaa LOC230640 from mouse genome 68% to 4a10 new sequence
1 MSIFELSHITNVFGIFGLLQVVSLLGLLLLLLKSAQYYLHRQWLIKSLQQFPPAPPPQWLFGN 189
1729 XFPKDQDLQQILLCVEKFPSTYVRWLWGNHARVVIYDPDYMKVILGRS 1869
2385 DPKVVRSYSFFAPWI 2429 
4002 GYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVGIMVDSVHVML 4130
5130 DKWEQLVDQDCPLEIYQDISLMTMETMMKCAFSYQGSVQLE 5252
5617 NSKSYIKAVEDLTHLIYLRVRNGFHQNNTIYSLSS 5721 
5723 NGRSFYHACQIAHKHT 5770
6175 ERVIRMRKAQLQNEAELEKFRKKKRLDFLDILLFAQ 6288
6374 TEDGKSLSDEDVRAEMDTFMFEGHNTTASGISWIFYALATHPEHQQRCREEVKSILGNGTSVT 6562
6666 NHLDQMPYTTMCIKEALRLYPPIPGASRELSSPVTFPDGCSLPK 6797
8724 GFLVTLSFYGLHHNPRLRPNAE 8789
8903 VFDPSRFAPGAPRQTHAFLPFSAGTR 8986
18305 NCIGKQFTMNELKVAVALTLLRFELLPDPTRVPILVSKIVLKSKNGIYLHTKKL 18472

>Cyp4a30b NT_039264.1 Cyp4aaaa + strand 94% identical to 4aaab
15598281 MSIFELSHITNVFGIFGLLQVVSLLGLLLLLLKSAQYYLHRQWLIKSLQQFPPAPPPQWLFGN 15598469
15599999 IFPKDQDLQQILLCVEKFPSTYVRWLWGNHARVVIYDPDYMKVILGRS 15600143
15600659 DPKVVRSYSFFAPWI 15600703
15602276 GYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVGIMVDSVHVML 15602404
15603404 DKWEQLVDQDCPLEIYQDISLMTMETMMKCAFSYQGSVQLE 15603526
15603891 NSKSYIKAVEDLTHLIYLRVRNGFHQNNTIYSLSSNGRSFYHACQIAHKHT 15604043
15604454 ERVIRMRKAQLQNEAELEKFRKKKRLDFLDILLFAQ 15604561
15604647 TEDGKSLSDEDVRAEMDTFMFEGHNTTASGISWIFYALATHPEHQQRCREEVKSILGNGTSVTL 15604838
15604939 NHLDQMPYTTMCIKEALRLYPPIPGASRELSSPVTFPDGCSLPK 15605070
15606990 GFLVTLSFYGLHHNPRLRPNAE 15607055
15607175 VFDPSRFAPGAPRQTHAFLPFSAGT 15607249
15616569 RNCIGKQFTMNELKVAVALTLLRFELLPDPTRVPILVSKIVLKSKNGIYLHTKKLK* 15616739

>Cyp4ayy pseudogene fragments C-term LOC230636 from mouse genome
same as cyp4aaaa Cyp4a30b
26095 RNCIGKQFTMNELKVAVALTLL 26160
26162 RFELLPDPTR 26191
26193 VPILVSKIVLKSKNGIYLHTKKLK* 26267

>52. Cyp4a14       Mm.7459  genbank Y11638 NM_007822
MGFFLFSPTRYLDGISGFFQWAFLLSLFLVLFKAVQFYLRRQWL
LKTLQHFPCMPSHWLWGHHLKDKELQQILIWVEKFPSACLQCLSGSNIRVLLYDPDYV
KVVLGRSDPKASGIYQFFAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMA
DSVNIMLDKWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQLDENSKLYTKAV
EDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHACQIAHEHT
DGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFAR
MEDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFYAL
ATHPEHQQRCREEVQSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSS
PVTFPDGRSIPK
GITATISIYGLHHNPRFWPNPK
VFDPSRFAPDSSHHSHAYLPFSGG
SRNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPIARLVLKSKNGIHLCLKKLR

>NT_039264.1 Cyp4a14 - strand
15641790 MGFFLFSPTRYLDGISGFFQWAFLLSLFLVLFKAVQFYLRRQWLLKTLQHFPCMPSHWLWGH 15641605
15640707 LFPKDKELQQILIWVEKFPSACLQCLSGSNIRVLLYDPDYVKVVLGRS 15640564
15639891 DPKASGIYQFFAPWI 15639847
15639380 GYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVNIML 15639252
15638411 DKWEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQLD 15638289
15637911 NSKLYTKAVEDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHACQIAHEHT 15637759
15637345 DGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFAR 15637238
15637154 MEDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSILGDGTSVT 15636966
15636875 DHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGRSIPK 15636744
15635704 GITATISIYGLHHNPRFWPNK 15635639
15635542 VFDPSRFAPDSSHHSHAYLPFSGGS 15635468
15632990 RNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPIARLVLKSKNGIHLCLKKLR* 15632820

>50. Cyp4a10 Mm.10742 genbank AB018421
MSVSALSPTRFADSLSGFLQVASVLGLLLLLVKAVQFYLHRQWLLKAFQQFPSPPFHWFFGHE
QFKGDHELQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGRS
DPKANGAYRLLAPWI
GYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLML
DKWERLADQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVD
GNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYKLSSNGRLAKQACQLAHDHT
DGVIKLRKDQLQDEGELEKIKKKRRLDFLDILLFAR
MENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDGSSIT
WDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPK
GVQVTLSIYGLHHNPKVWPNPE
VFDPSRFAPDSPRHSHSFLPFSGGA
RNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMPLARLVLKSKNGIYLHLKKLH

>Cyp4a10 NT_039264.1 Cyp4a10a + strand
15663999 MSVSALSPTRFADSLSGFLQVASVLGLLLLLVKAVQFYLHRQWLLKAFQQFPSPPFHWFFGHE 15664187
15665307 QFKGDQELQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGRS 15665450
15665928 DPKANGAYRLLAPWI 15665972
15666744 GYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLML 15666872
15669925 DKWERLADQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVD 15670047
15670403 NYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYKLSSNGRLAKQACQLAHDHT 15670555
15670978 DGVIKLRKDQLQDEGELEKIKKKRRLDFLDILLFAR 15671085
15671175 MENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDGSSITW 15671366
15671463 DHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPK 15671594
15674911 GVQVTLSIYGLHHNPKVWPNPE 15674976
15675119 VFDPSRFAPDSPRHSHSFLPFSGGA 15675193
15678206 RNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMPLARLVLKSKNGIYLHLKKLH* 15678376

>Cyp4b1-de2b4b NT_039264.1 Cyp4b1b - strand 
15690726 DLDKVGTWTEQFPYAHPLWLGQFVVFLNIYEPDYSKAVYSQA 15690601
15689190 GKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVML 15689062

>Cyp4a31 Cyp4abb NW_000211.1|Mm4_WIFeb01_60
MSVSALSLTRFAGSLSGFLQVASVFCLLLLLVKAVQVYLHRKWLLKALQQFPSPPFHWFFGHE 
QFKGDQELQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGR
SDPKANGAYRLLAPWI
GYGLLLLNGQSWFQHRKMLTPAFHYDILKTYVKNMADSIRLML
DKWERLAGQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVDG
NYKTYLQAIGDLNNLVHSRVRNMFHQNDTIYKLSSNGRLSNQACQLAHDHT
DGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFAR 
MENEDSMSDKDLRAEVDTFMIEGHDTTASGVSWIFYA
LATHPEHQQRCREEVQSLLGDGSSITW 
DHLDQIPYTTMCIKEALRLYPPVPSIGRELSTSVTFPDGCSLPK
GVQVTLSIYGLHHNPKVWPNPE 
VFDPSRFAPDSPRHSHSFLPFSGGAR
NCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMSLARFVLKSKNGIYLHLKKVH

>Cyp4a31 NT_039264.1 Cyp4abb + strand
15709394 MSVSALSLTRFAGSLSGFLQVASVFCLLLLLVKAVQVYLHRKWLLKALQQFPSPPFHWFFGHE 15709582
15710687 QFKGDQELQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGRS 15710830
15711347 DPKANGAYRLLAPWI 15711391
15712156 GYGLLLLNGQSWFQHRKMLTPAFHYDILKTYVKNMADSIRLML 15712284
15715386 DKWERLAGQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVDx 15715508 (g)
15715864 NYKTYLQAIGDLNNLVHSRVRNMFHQNDTIYKLSSNGRLSNQACQLAHDHT 15716016
15716439 DGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFAR 15716546
15716635 MENEDSMSDKDLRAEVDTFMIEGHDTTASGVSWIFYALATHPEHQQRCREEVQSLLGDGSSITX 15716823
15716923 DHLDQIPYTTMCIKEALRLYPPVPSIGRELSTSVTFPDGCSLPK 15717054
15720376 GVQVTLSIYGLHHNPKVWPNPE 15720441
15720567 VFDPSRFAPDSPRHSHSFLPFSGGA 15720641
15723611 RNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMSLARFVLKSKNGIYLHLKKVH* 15723781

>Cyp4b1-de10c11c12c NT_039264.1 Cyp4b1c partial - strand
15728822 GSLISLHIYALHRNSAVWPDPE 15728757
15728661 VFDPLRFSPENMTGRHPFAFMPFSAGP 15728581
15728149 RNCIGQQFAMNKMKVV 15728102
15728100 TALCLLCFEISQDPLKIPIKVPQLILGSKNGIHLYLKPLGPGSGK 15727966

>Cyp4a32 NT_039264.1 Cyp4a10b + strand
15746652 MSVSALSPTRFADSLSGFLQVASVLGLLLLLVKAVQFYLHRKWLLKALQQFPSPPFHWFFGHE 15746840
15747937 QFKGEQELKEVVSCIEHFPSAFPCWFWGSNAYLTVYDPDYMKVILGRS 15748080
15748604 DPKANGIYRLLAPWI 15748648
15752321 GYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLML 15752449
15755304 DKWERLAGQDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVDX 15755426
15756131 NYKTYLQAIGDLNNLFHSRVRNIFHQNDTIYRLSSNGRLAKQACQLAHDHT 15756283
15756698 DGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFAR 15756805
15756894 MENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSLLGDGSSITW 15757085
15757182 DHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPK 15757313
15760289 GVQVTLSIYGLHHNPKVWPNPE 15760354
15760497 VFDPSRFAPDSPRHSHSFLPFSGGA 15760571
15767109 RNCIGKQFAMSELKVIVALTLLHFELLPDPTRVPEPLARIVLKSKNGIYLHLKKLH* 15767279

>54. Cyp4b1        Mm.1840  genbank D50834
MALSFLSPSLSRLGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALE
IQKTGGLDKVVTWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRG
DPKAAYVYDFFLQWI
GKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVML
DKWEKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLSH
SDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACQIAHDHT
DHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGAR
DESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQW
DDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPA
GSLISLHIYALHRNSAVWPDPE
VFDPLRFSPENMTGRHPFAFMPFSAGP
RNCIGQQFAMNEMKVVTALCLLRFEFSPDPSKIPIKVPQLILRSKNGIHLYLKPLGPGSGK

>Cyp4b1 NT_039264.1 Cyp4b1a - strand
15793364 MALSFLSPSLSRLGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALE 15793185
15787670 IQKTGGLDKVVTWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRG 15787524
15787339 DPKAAYVYDFFLQWIGK 15787289
15786110 GKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVML 15785982
15782099 DKWEKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLSH 15781943
15781704 SDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACQIAHDHT 15781552
15781416 DHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGAR 15781309
15774536 DESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQW 15774345
15772616 DDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPA 15772485
15771566 GSLISLHIYALHRNSAVWPDPE 15771501
15771405 VFDPLRFSPENMTGRHPFAFMPFSAGP 15771325
15770907 RNCIGQQFAMNEMKVVTALCLLRFEFSPDPSKIPIKVPQLILRSKNGIHLYLKPLGPGSGK 15770725

>63. Cyp4f39 AC073754 minus strand 62% to 4F14
209253 MLPLTDYLLQLLGLEKTAFRVYV 209185
209184 VSALLLLVLFFFFRLLVRAFKLFSDFRITCRKLSCFPEPPGRHWLLGHMSM 209038
206912 YLPNEKGLQNEKKVLDTMHHIILAWVGPFLPLLVLVHPDYIKPVLGAS 206769
196642 AAIAPKDEFFYSFLKPWL 196589
195978 GDGLLISKGNKWSRHRRLLTPAFHFDILKPYMKIFNQCTNIMH 195850
195671 AKWRRHLAEGSVTSFDMFEHISLMTLDSLQKCVFSYNSDCQE 195546
194555 SMSDYISSIIELSALVVRRQYRLHHYLDFMYYLTADGRRFRQACDTVHNFTTEVI 194391
194390 QERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAK 194289
191004 DEEGKELSDEDIRAEADTFMFE 190939
190826 HDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDW 190698
188154 DDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGRVIPK 188023
186633 GIICLVSIYGTHHNPIVWPDSK 186568
185968 VYNPYRFDPDTPQQRSPLAFVPFSAGP 185888
185475 RNCIGQSFAMAEMRVVVALTLLRFRLSVDRTHKVRRKPELILRTENGLWLNVEPLPSRA* 185296

>Cyp4f39 NT_039649.1|Mm17_39689_30 + strand
AC073754 minus strand 62% to 4F14
9029585 MLPLTDYLLQLLGLEKTAFRVYVVSALLLLVLFFFFRLLVRAFKLFSDFRITCRKLSCFPEPPGRHWLLGHMSM 9029806
9031927 YLPNEKGLQNEKKVLDTMHHIILAWVGPFLPLLVLVHPDYIKPVLGAS 9032070
9042196 AAIAPKDEFFYSFLKPWL 9042249
9042907 DGLLISKGNKWSRHRRLLTPAFHFDILKPYMKIFNQCTNIMH 9043032
9043212 AKWRRHLAEGSVTSFDMFEHISLMTLDSLQKCVFSYNSDCQE 9043337
9044252 SMSDYISSIIELSALVVRRQYRLHHYLDFMYYLTADGRRFRQACDTVHNFTTEVI 9044416
9044417 QERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAK 9044518
9047816 DEEGKELSDEDIRAEADTFMFE 9047881
9047993 GHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDW 9048124
9050669 DDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGRVIPK 9050800
9052190 GIICLVSIYGTHHNPIVWPDSK 9052255
9052855 VYNPYRFDPDTPQQRSPLAFVPFSAGP 9052935
9053348 RNCIGQSFAMAEMRVVVALTLLRFRLSVDRTHKVRRKPELILRTENGLWLNVEPLPSRA* 9053527

>Cyp4f17 NT_039649.1|Mm17_39689_30 + strand
AC073754 (5 exon 9s) no UNIGENE entry ESTs AA387122 vc22e06.r1
9067942 MLQLGLSWLGLGPGAAFPWQLLQLVGASLFLARILTWICAFYDNYCRLRCFPEPPSRHWFWGHMSM 9068139
9078921 VKNNEEGLQLLTERSHQFHDVHLCWIGPFYPILRLIHPKFIGPILQAS 9079064
9081387 AAVAPKEMIFYGFLKPWLG 9081443
9081530 DGLLVSAGEKWSRHRHLLTPAFHFDILKPYMKNFNKSVNIMH 9081655
9083143 AKWQRLTTKGTACLDMLEHISLMTLDSLQNCVFSFDSNCQE 9083265
9085028 SPSEYIAAIQELSSLIVKRHHQPFLYLDFLYYCTADGRRFRKACDLVH 9085171
9085172 NFTDAVIRERRRTLSSQNLDEFLKSKTKSKTLDFIDVLLLAK 9085297
9085604 DEHGKELSDEDIRAEADTFMFG 9085669
9085859 GHDTTASALSWILYNLARHPEYQERCRQEVQELLRGREPQEIEW 9085990
9088714 DDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDVVLPDGRVIPK 9088845
9088918 GTDCVISIFGVHHNPEVWPDPE 9088983
9089148 VYDPFRFDPENPQKRSPLAFIPFSAGPR 9089231
9089587 RNCIGQTFAMREMKVALALTLLRFRVLPGDKEPRRKPELILRAEGGLWLRVEPLSKGTQ* 9089766

>Cyp4f16 NT_039649.1|Mm17_39689_30 + strand
AF233646 AK009445 no UNIGENE entry ESTs AA059667 mj77a08.r1
9097626 MLRLSVSGLDLGSVVTSSWHLLLLGVASWILARILAWTYSFYENCSRLSCFPQPPKKNWFSGHLGM 9097823
9100841 IQSNEEGMQLVTEMGQTFQDVHLFWLGPVIPVLRIVDPAFVAPLLQA 9100981
9103307 ALVAPKDMTFLRFLKPWL 9103360
9103446 GDGLFLSSGDKWSRHRRLLTPAFHFDILKPYVKIFNQSVNIMH 9103574
9104679 AKWKHLSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQE 9104801
9105455 SPSEYISAILELSSLIIKRSLQLFLFVDFLYYHTADGRRFRKACDLVHNFTDAVIR 9105622
9105623 ERRHTLSSQNHDEFLKSKTKSKTLDFIDVLLLAK 9105724
9106943 DEHGKELSDEDIRAEADTFMFGG 9107011
9107206 HDTTASALSWILYNLARHPEYQERCRQEVQELLRDREPEEIEW 9107334
9110828 DDLAQLPFLTMCIKESLRLHSPVIDLLRRCTRDIVLPDGRVIPK 9110959
9111076 GNICVISIFGIHHNPSVWPDPE 9111141
9111306 VYDPFRFDPENPQKRSPLAFIPFSAGP 9111386
9111628 RNCIGQTFAMSEMKVALALTLLRFRILPDDKEPRRKPEIILRAEGGLWLRVEPLSKGAQ* 9111807

>Cyp4f37-de1b NT_039649.1|Mm17_39689_30 + strand exon 1 22-60
9142319 LLPFMAS*PLGRILAWTHFFYEVCACLICFPQAPKQNWF 9142435

>Cyp4f37-de7b8b NT_039649.1|Mm17_39689_30 + strand exon 7, 8
9166323 DERGKELSDEDIWAEAYTFVFGR 9166391
9168358 XXXXXXALSWILYNLVRHPEYPECCLWEVQELLRDLNHEEIEX 9168465

>Cyp4f37 NT_039649.1|Mm17_39689_30 + strand duplicate exon 6, fs in exon 7
AC073754 comp(28012-47256) 93% identical to 4f16
9184915 MLRLSVSGLDLGSVVTLSWHLLLLGAASWILARILAWTYSFCENCSRLRCFPQPPKRNWFLGHLGM 9185112
9188263 IEHNEEGMQLMTEAGQTYRDVHLCWLGPVIPVLRIVDPAFVAPLLLA 9188403
9190739 ALVAPKDTTFHTFVKPWL 9190792
9190880 GDGLFLNSGDKWSRHRRLLTPAFHFDILKPYVKIFNQSVNIMH 9191008
9192178 AKWKHLSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQE 9192300
9194247 SPSEYISAILELSSLVIKRSHQLFLFVDFLYYHTADGRRFRKACDLVHNFTDAVIR 9194414
9194415 ERRHTLSSQNHDEFLKSKTKSKTLDX 9194489
9194494 IDVLLLAK 9194517
9195740 DEHGKELSDEDIRAEADTFMFGG 9195808
9196003 HDTTASALSWILYNLARHPEYQERCRQEVQELLRGREPQEIEW 9196131
9198622 DDLAQLPFLTMCIKESLRLHPPVIDLLRRCTRDIVLPDGRVIPK 9198753
9198870 GNICVISIFGIHHNPSVWPDPE 9198935
9199100 VYDPFRFDPENAHKRPPLAFIPFSAGP 9199180
9199416 RNCIGQTFAMNEMMVALALTLLRFRILPDDKEPRRKPEIILRAEGGLWLRVEPLS 9199580

>Cyp4f37-ie6b duplicate exon 6, incomplete
9192951 SPSEYISAILELSSLVIKRSHQLFLFVDFLYYHPADGR 9193064
9193067 FRKACD 9193084

>Cyp4f38p NT_039649.1|Mm17_39689_30 + strand
AC073754 comp(9555-20475) partial pseudogene 52% to 4f14
9207406 LMLVGAHILIQVYAAYGNYPHIPKWNWLMGHVSM 9207507
9209948 XXXSEEGTKDVTKLVGK 9209989
9209991 YP*GFIL*MIPLVSILKPCHPGIAKSV 9210071
9212692 SAAVVLKGVIFYSFLXXXX 9212736
9212846 XXXXMVSAGDKWSHHCHMLTPAFHFNILKLYVKIFNDSTNIVH 9212962
9213169 XXXXXXXXXXXXXLNISDHVILMTLGNFQKCIFSFDSNCQD 9213252
9214931 AIMELSMLISRRNKEPLLHMDLLGHLTPDGMCCCKACSMMHGLDDAVI 9215074
9215076 QERGHILSRQGLDGFFKDKVKFKPLNFIAVLLLTK 9215180
9217796 LCGVFLKDDMSQLPFLTMCISLWLHPPDLLISYYCI*DVVLPDGWIIPK 9217942

>64. Cyp4f40 NT_039649.1|Mm17_39689_30 + strand
AC073754 range <1-3688 minus strand two N-terminal exons no ESTs
9224232 RMRYLDLSWLGLGPMSASPWLLFFLVGISWFLARFLTQLYTLYAKCQRLCGFPQPPKKNWFWGHLGM 9224432
9226867 SPPTEEGMKQVTELVTTYPQGFMTWLGPIVPLITLCHPDIIRSVLSAS 9227010
9232562 SAAVAPKDDIFYSFLKPWL 9232618
9232703 GDGLLVSAGDKWNRHRRMLTPAFHFNILKPYVKIFNDSTNIMH 9232831
9234531 AKWLRLASGGSTRLNMFENISLMTLDTLQKCVFSFNSNCQE 9234653
9235763 KPSQYIAAILELSTLAVKRNEQLLMHVDLLYRLTPDGMRFYKACRLVHDFTDAVIQERRRTLLKHGGDDIIKAKAKSKTLDFIDVLLLTK 9236032
9238634 DEDGKELSDEDIRAEADTFMFRG 9238702
9238887 HDTTASGLSWILYNLARHPEHQERCRQEVQELLRDRDPKEIEW 9239015
9240199 DDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDGRIIPK 9240330
9240414 GVICIINIFGTHHNPTVWRDPE 9240479
9240607 VYDPFRFDPENIQARSPLSFIPFSAGP 9240687
9241004 RNCIGQTFAMSEMKVALALTLLRFRILPDDKEPRRKPELILRAEGGLWLRVEPLSTQA 9241177

>Cyp4f15 NT_039649.1|Mm17_39689_30 + strand
Mm.26539 AF233645 1EST AI121221 AK018904
MGFF
9250760 RMPQLDLSWLGLRLEASSPWLLLLLIGASWLLARVLTQTYIFYRTYHHLCDFPQPPKWNWFLGHLGM 9250960
9255347 ITPTEHGLKEVTNLVATYPQGFMTWLGPIIPIITLCHPDIIRSVLNA 9255487
9257115 SASVALKEVVFYSFLKPWL 9257171
9257260 GDGLLLSDGDKWSSHRRMLTPAFHFNILKPYVKIFNDSTNIMH 9257388
9259977 AKWQHLASGGSARLDVFENISLMTLDSLQKCVFSFDSNCQE 9260099
9262477 NPSEYISAILELSALVTKRYHQLLLHIDSLYQLTCSGRRFHKACHLVHSFTDAVIQDRRRTLPSKHEDDVLKAKAKSKTLDFIDVLLLSK 9262746
9264634 DEDGKELSDEDIRAEADTFMFEG 9264702
9264910 HDTTASGLSWILYNLARHPEYQERCRQEVQELLRDRESTEIEW 9265038
9266608 DDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGRVIPK 9266739
9266828 GVICIINIFATHHNPTVWPDPE 9266893
9267035 VYDPFRFDPENIKDRSPLAFIPFSAGP 9267115
9267490 RNCIGQTFAMNEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLRVEPLSTQ* 9267663

>Cyp4f14 NT_039649.1|Mm17_39689_30 - strand 80% to 4f15 
Mm.10976 C-term only. AF233644 AK018676 AC073720 91k-108k 
9480783 MSQLSLSWLGLGPEVAFPWKTLLLLGASWILARILIQIYAAYRNYRHLHGFPQPPKRNWLMGHVGM 9480586
9478580 VTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNA 9478440
9475637 SAAVALKDVIFYSILKPWL 9475581
9475492 GDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMH 9475364
9475203 AKWQRLISDGSARLDMFEHVSLMTLDSLQKCVFSFDSNCQE 9475081
9473316 KSSEYIAAILELSALVAKRHQQPLMFMDLLYNLTPDGMRFRKACNVVHEFTDAVIRERHRTLPDQGLDDFLKSKAKSKTLDFIDVLLLSK 9473047
9471961 DEDGKELSDEDIRAEADTFMFEG 9471893
9471699 HDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEEIEW 9471571
9470493 DDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPK 9470362
9470279 GIICLISIFGIHHNPSVWPDPE 9470214
9470056 VYDPFRFDPENIKDSSPLAFIPFSAGP 9469976
9469605 RNCIGQTFAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEGGLWLRVEPLSAGAH* 9469426

>Cyp4f13 NT_039649.1|Mm17_39689_30 - strand. seq gap at exon 7,8
Mm.22045 15 ESTs follow AI323999 BF533850 BC003954 AF233643
9512124 MLQLCLSWLGMGSLTASPWHLLLLGGASWILARILAWIYAFYDNCSRLRCFPQPPKPSWFWGHLAL 9511927
9506326 MKNNEESMQFITHLGHDFHDVHLSWVGPVYPILRLVHPNFIAPLLQA 9506186
9497701 SAAVAPKEMTLYGFLKPWL 9497645
9497556 GDGLLMSAGDKWSHHRRLLTPAFHFDILKSYVKIFNKSVNIMH 9497428
9495574 AKWQCLASKGTSRLDMFEHISLMTLDSLQKCIFSVDSNCQE 9495452
9495033 SDSKYIAAILELSSLVVKRHRQPFLYLDLLYYLTADGRRFRKACDLVHNFTDAVIKERRSTLNTQGVEFLKAKAKTKTLDFI 9494788
        DVLLMAE
        DEHGKGLSNEDIRAEADTFMFGG
        HDTTTSALSWILYNLARHPEYQERCRQEVQELLRDRDSEEIEW
9490318 DDLAQLPFLTMCIKESLRLHPPVLLISRCCTQDVLLPDGRAIPK 9490187
9490098 GNICVISIFGVHHNPSVWPDPE 9490033
9489902 VYNPFRFDPENPQKRSPLAFIPFSAGT 9489822
9489452 RNCIGQTFAMSEIKVALALTLLRFRILPDDKEPRRKPELILRAEGGLWLRVEPLSAGAQ* 9489273

>Cyp4f41-ps pseudogene exons 5,6,9,10,12 189-216 NT_039649.1|Mm17_39689_30  - strand
9523155 NKWQCLTFESSASL 9523114 
9523111 ALFEHMNLTTVDSLQKCVFSFHSNCQE 9523031
9521583 SNSKYIAAILELISFNSTSPSWMWTSCTNYLSVDG*CFHKACNLVDSFTDVVIT 9521422
9521421 TEGPCNLNTQGVDEFLKAKAKAKTLDFIDVLLKTR 9521317
9518053 NDLTQLPFLTMSMKESLRLHPPGSMISLCCIQDILLLDDLVISS 9517922
9517838 GHVC 9517827
9517828 VTSIFRSHHNPSVWPDPE 9517775
9517097 RNCIGLTFGHECNEDDDGADADAARFCVLPGDKGPRRLSALMLRTEGGLWLQVELLT 9516927

>Cyp4f18 Chr 8  NT_039466.1|Mm8_39506_30 - strand
AF233647 AK007863 frag.b no UNIGENE entry EST AA716998 vu61b04.r1
138896 MSQLSMSWMGLGHTAASPWLLLLLAGASCLLAYILTPIYGVFENSLRLRCFPQPPKRNWILGHLGL 138699
131761 IQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVVLA 131621
130374 PALVAPKDTVFYRFLKPWL 130318
130232 GDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMH 130104
127524 AKWQRLASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQE 127402
125384 KPSEYITAILELSTLVARRHQRLLLHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFIDVLLLSK 125115
122460 DEHGKALSDEDIRAEADTFMFG 122395
122191 GHDTTASGLSWILYNLARHPEYQERCRQEVRELLRDREPEEIEW 122060
119223 DDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPK 119092
119002 GVISRISIFGTHHNPAVWPDPE 118937
118372 VYDPFRFDADNVKGRSPLAFIPFSAGP 118292
117969 RNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAGAQ 117793

>65. cyp4v3 AB056457 28 feb 2001 81% to 4v2
MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKW
QQMRSIPSVARAYPLVGHALYMKPNNAEFFQQLIYYTEEFRHLPIIKLWIGPVPLVAL
YKAENVEVILTSSKQIDKSFLYKFLQPWLGLGLLTSTGSKWRTRRKMLTPTFHFTILE
NFLDVMNEQANILVNKLEKHVNQEAFNCFFYITLCALDIICETAMGKNIGAQSNNDSE
YVRTVYRMSDMIYRRMKMPWLWFDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKER
KAEEDWTGAGRGPIPSKNKRKAFLDLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTT
AAAINWSLYLLGTNPEVQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVF
PSVPLFARSLSEDCEVGGYKVTKGTEAIIIPYALHRDPRYFPDPEEFRPERFFPENSQ
GRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILRQFWVESNQKREELGLAGDLILR
PNNGIWIKLKRRHEDDP


>67. Cyp5a1 Mm.4054  genbank L18868 AC073390.1
MEVLGLLKFEVSGTIVTVTLLVALLALLKWYSMSAFSRLEKLGI
RHPKPSPFVGNLMFFRQGFWESQLELRERYGPLCGYYLGRRMHVVISEPDMIKQVLVE
NFSNFSNRMASGLEPKMVADSVLLLRDRRWEEVRGALMSSFSPEKLDEMTPLISQACE
LLVAHLKRYAASRDAFNIQRCYCCYTIDVVASVAFGTQVDSQNSPEDPFVQHCRRAST
FCIPRPLLVLILSFPSIMVPLARILPNKNRDELNGFFNTLIRNVIALRDQQAAEERRR
DFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQRCHPTSTSKPFTVDEIVGQ
AFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAPEYHSLQEGLPY
LDMVISETLRMYPPAFRFTREAAQDCEVLGQRIPAGTVLEIAVGALHHDPEHWPNPET
FDPERFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASPET
QVPLQLESKSALGPKNGVYIKIVSR

>68. Cyp7a1 no UNIGENE entry genbank L23754 EST AA254999
MMSISLIWGIAVVVSCCIWFIIGIRRRKVGEPPLDNGLIPYLGC
ALKFGSNPLEFLRAKQRKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHY
TTSAKAFGHRSIDPSDGNTTENINKTFNKTLQGDALCSLSEAMMQNLQSVMRPPGLPK
SKSAVWVTEGMYAFCYRVMFEAGYLTLFGKDISKTDTQRAFIQNNLDSFKQFDQVFPA
LVAGVPIHLLKTAHKARERLAESLKHKNLYMRDQVSELIRLRMFLNDTLSTFDDMEKA
KTHLVILWASQANTIPATFWSLFQMIRSPEAMKAASEEVNGSLQSAGQELSSGGNAIY
LDQEQLNNLPVLDSIIKEALRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQ
LMHLDPEIYPDPLTFKYDRYLDESGKAKTTFYRNGNKLKYFYMPFGSGATICPGRLFA
VQEIKQFLILMLSYFELELVESHTKCPPLDQSRAGLGILPPLNDIEFKYKLKH

>69. Cyp7b1        Mm.4781  genbank U36993
MQGATTLDAASPGPLALLGLLFAATLLLSALFLLTRRTRRPREP
PLIKGWLPYLGMALKFFKDPLTFLKTLQRQHGDTFTVFLVGKYITFVLNPFQYQYVTK
NPKQLSFQKFSSRLSAKAFSVKKLLTDDDLNEDVHRAYLLLQGKPLDALLETMIQEVK
ELFESQLLKITDWNTERIFAFCGSLVFEITFATLYGKILAGNKKQIISELRDDFFKFD
DMFPYLVSDIPIQLLRNEESMQKKIIKCLTSEKVAQMQGQSKIVQESQDLLKRYYRHD
DSEIGAHHLGFLWASLANTIPAMFWAMYYILRHPEAMEALRDEIDSFLQSTGQKKGPG
ISVHFTREQLDSLVCLESTILEVLRLCSYSSIIREVQEDMNLSLESKSFSLRKGDFVA
LFPPLIHNDPEIFDAPKEFRFDRFIEDGKKKSTFFKGGKRLKTYVMPFGLGTSKCPGR
YFAVNEMKLLLIELLTYFDLEIIDRKPIGLNHSRMFLGIQHPDSAVSFRYKAKSWRS

>70. Cyp8a1        Mm.2339  genbank AB001607
MSWAALLGLLAVLLLLLLLLSRRRARRPGEPPLDLGSIPWLGHA
LEFGRDAASFLTRMKEKHGDIFTVLVGGRYVTVLLDPHSYDTVVWELRTRLDFHPYAI
FLMERIFDLQLPNFNPSEEKARMKPTLMHRDLQALTEAMYTNLRTVLLGDSTEAGSGW
QETGLLEFSYNALLSAGYLTLYGVEASPRTHESQAQDRVHSADVFHTFRQLDLLLPKL
ARGSLSAGDKDHACSVKNRLWKLLSPARLASRADRSSWLESYLRHLEEMGVSEEMQAR
ALVLQLWATQGNMGPTAFWLLLFLLKNPEALAAVRAELKHTVWQAEQPVSQMTTLPQK
ILDSMPVLDSVLNETLRLTAAPFITREVMADLALPMADGREFSLRRGDRLLLFPFLSP
QKDPEIYTEPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNQCLGKSYAIN
SIKQFVVLLLTHFDLELGSEDTEVPEFDLSRYGFGLMQPEEDVPIRYRARL

>71. Cyp8b1        Mm.20889 genbank AF090317
MTLWCTVLGALLTVVGCLCLSLLLRHRRPWEPPLDKGFVPWLGH
SMAFRKNMFEFLKGMRAKHGDVFTVQLGGQYFTFVMDPLSFGPIIKNTEKALDFQSYA
KELVLKVFGYQSVDGDHRMIHLASTKHLMGQGLEELNQAMLDSLSLVMLGPKGSSLGA
SSWCEDGLFHFCYRILFKAGFLSLFGYTKDKQQDLDEADELFRKFRRFDFLFPRFVYS
LLGPREWVEVSQLQRLFHQRLSVEQNLEKDGISCWLGYMLQFLREQGIASSMQDKFNF
MMLWASQGNTGPTCFWVLLFLLKHQDAMKAVREEATRVMGKARLEAKKSFTFTPSALK
HTPVLDSVMEESLRLCATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMD
PDIHPEPTAFKYDRFLNPDGTRKVDFYKSGKKIHHYSMPWGSGVSKCPGRFFALSEMK
TFVLLMIMYFDFKLVDPDIPVPPIDPRRWGFGTSQPSHEVRFLYRLKPVQ

>72. Cyp11a1       Mm.28748 genbank J05511, NM_019779, AF195119
MLAKGLSLRSVLVKGCQPFLSPTWQGPVLSTGKGAGTSTSSPRS
FNEIPSPGDNGWLNLYHFWRESGTQKIHYHQMQSFQKYGPIYREKLGTLESVYIVDPK
DASILFSCEGPNPERFLVPPWVAYHQYYQRPIGVLFKSSDAWKKDRIVLNQEVMAPGA
IKNFVPLLEGVAQDFIKVLHRRIKQQNSGNFSGVISDDLFRFSFESISSVIFGERMGM
LEEIVDPEAQRFINAVYQMFHTSVPMLNLPPDFFRLLRTKTWKDHAAAWDVIFNKADE
YTQNFYWDLRQKRDFSQYPGVLYSLLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWN
LYEMAHNLKVQEMLRAEVLAARRQAQGDMAKMVQLVPLLKASIKETLRLHPISVTLQR
YTVNDLVLRNYKIPAKTLVQVASFAMGRDPGFFPNPNKFDPTRWLEKSQNTTHFRYLG
FGWGVRQCLGRRIAELEMTILLINLLENFRIEVQNLRDVGTKFSLILMPENPILFNFQ
PLKQDLGPAVTRKDNTVN

>73. Cyp11b1 80% to mouse 11B2 64% to human 11B1 and 11B2 80% to 11B1 rat 78% to 11B2 rat. GenBank J04451, sequence below is from Ensembl mouse version 3 
15.75000001-76000000 mouse chr 15 add 75 million to get global location
306415 MALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYSRNKWLKMIQILREQG 306356
306355 QENLHLEMHQVFRELGPIFR 306176 (?)
305773 HSVGKTQIVFVTLPEDVEKLYQVESTHPCRMPLESWIVHRELRGLGRGVFLL 305618 (?)
304234 NGPEWYFNRLQLNPNVLSPKAVQKFVPLVDGIARDFVDNLKKKMLESVHGSFSMDFQSSV 304175
304174 FNYTIE 304157 (?)
303918 ASHFVLFGERLGLIGRDLSPDSLKFLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLE 303859
303858 SWDFISEYG 303826 (?)
303446 TKCIKNVYRELAEGRPQSWSVTAELVAERTLSMDAIQANSMELIAGSTDT 303413 (0?)
301935 TSTPLVMTFFELARNPDVQQALRQESLAAEASIAANPQKAMSDLPLLRAALKETLR 301768
301535 LYPVGTFLERILSSDLVLQNYHVPAG 301458
301370 TVLNVNLYSMGRNPAVFPRPERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEM 301314
301313 MLLLHH 301182 (?0)
300923 VLKSFHVETQEK 300888
300887 EDVRMAYRFVLMPSSSPLLTFRPVN 300705

>74. Cyp11b2 genbank S85260 sequence below is from Ensembl mouse version 3
15.75000001-76000000 mouse chr 15 add 75million to get global location
68% to human 11B2 67% to human 11b1 94% to 11B2 rat 81% to 11B1 rat
321034 MALRVTADVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYSRNKWLKMIQILREQG 320975
320974 QENLHLEMHQVFRELGPIFR 320795 (?)
320391 HSVGKTQIVSVMLPEDAEKLHQVESMLPRRMHLEPWVAHRELRGLRRGVFLL 320238 (?)
318803 NGPEWRLNRLRLNRNVLSPKAVQKFVPMVDMVARDFLETLKEKVLQNARGSLTM 318762
318761 DVQQSLFNYTIE 318606 (?)
318477 ASNFALFGERLGLLGHDLSPGSLKFIHALHSMFKSTS 318487
318486 QLLFLPKSLTRWTSTRVWKEHFDAWDVISEYG (?) 318391
318000 NRCIWKVHQELRLGSSQTYSGIVAELISQGSLPLDAIKA 318004
318003 NSMELTAGSVDT 317848 (?)
316981 TAIPLVMTLFELARNPDVQKALRQESLAAEASIAANPQKAMSDLPLLRAALKETLR 316814 (?)
316581 LYPVGGFLERILSSDLVLQNYHVPAG 316504 (0?)
316416 TLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFG 316396
316395 VRQCLGRRLAEVEMMLLLHH 316228 (0?)
315961 ILKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS 315851

>75. Cyp17         Mm.1262  genbank M64863 AC079419.1
MWELVGLLLLILAYFFWPKSKTPNAKFPRSLPFLPLVGSLPFLP
RRGHMHANFFKLQEKYGPIYSLRLGTTTAVIVGHYQLAREVLVKKGKEFSGRPQMVTL
GLLSDQGKGVAFADSSSSWQLHRKLVFSTFSLFRDDQKLEKMICQEANSLCDLILTYD
GESRDLSTLIFKSVINIICTICFNISFENKDPILTTIQTFTEGIVDVLGHSDLVDIFP
WLKIFPNKNLEMIKEHTKIREKTLVEMFEKCKEKFNSESLSSLTDILIQAKMNAENNN
TGEGQDPSVFSDKHILVTVGDIFGAGIETTSSVLNWILAFLVHNPEVKRKIQKEIDQY
VGFSRTPSFNDRTHLLMLEATIREVLRIRPVAPLLIPHKANIDSSIGEFAIPKDTHVI
INLWALHHDKNEWDQPDRFMPERFLDPTGSHLITPTPSYLPFGAGPRSCIGEALARQE
LFIFMALLLQRFDFDVSDDKQLPCLVGDPKVVFLIDPFKVKITVRQAWKDAQVEVST

>76. Cyp19         Mm.5199  genbank D00659
MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESS
SSIPGPGYCLGIGPLISHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSS
MFHVMKHSHYISRFGSKRGLQCIGMHENGIIFNNNPSLWRTIRPFFMKALTGPGLVRM
VEVCVESIKQHLDRLGEVTDTSGYVDVLTLMRHIMLDTSNMLFLGIPLDESAIVKKIQ
GYFNAWQALLIKPNIFFKISWLYRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCM
DFATDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILK
EIHTVVGDRDIKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGT
NIILNIGRMHRLEYFPKPNEFTLENFEKNVPYRYFQPFGFGPRGCAGKYIAMVMMKVV
LVTLLRRFQVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPRNSDKYLQQ

>77. Cyp20a1 AK020848 Mus musculus Cyp20 adult retina cDNA plus ESTs for C-term 
MLDFAIFAVTFLLALVGAVLYLYPASRQASGIPGLTPTEEKDGN
LPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTTDVLKQHFNPNKTSDPFET
MLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYPETQ
HIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHG
TVWSEIGKGFLDGSLDKNTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHT
FIDSLTQGKLNEQQILEDCVVFSLASCIITAR LCTWTIHFLTTTGEVQKK
LCKEIDQVLGEGPITSEKIEQLSYCQQVLFETVRTAKLTPVSARLQDIEGKVGPFVIPKE 
TLVLYALGVVLQDPSTWPLPHRFDPDRFADEPVMKVFSSLGFSGTWECPELXFAYMVTAV 
LVSVLLEKLRLLAVDRQVVEMKYELVTSAREEAWITVSKRH*

>78. Cyp21 Mm.18845 genbank AF049850
MLLPGLLLLLLLLAGTRWLWGQWKLRKLHLPPLAPGFLHFLQPN
LPIYLLGLTQKLGPIYRIRLGMQ DVVVLNSNRTIEEALIQKWVDFAGRPHMLN GKMDL
DLSLGDYSLMWKAHKKLSRSALMLGMRDSMEPLIEQLTQEFCERMRAQAGTPVAIHKE
FSFLTCSIISCLTFGDKDSTLVQTLHDCVQDLLQAWNHWSIQILTIIPLLRFLPNPGL
QKLKQIQESRDHIVKQQLKRHKDSLVAGQWKDMIDYMLQGVEKQRDGKDEERLHEGHV
HMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQKRLQEELDLKLGPGSQLLYRNRMQL
PLLMATIAEVLRLRPVVPLALPHRATRASSISGYDIPKDMVIIPNIQGANLDEMVWEL
PSKFWPDRFLEPGKNPRTPSFGCGARVCLGEPLARLELFVVLARLLQAFTLLPPPDGT
LPSLQPQPYAGINLPIPPFQVRLQPRNLAPQDQGERP

>CYP21a2p AF030001
MLLPGLLLLLLLLAGTRWLWGQWKFRKLHLLPLAPGFLHFLQPNLPIYLLGLTQKLGPIYRIRLGLQ
Gap 30 aa missing
GKMDLDLSLGDYSLMWKAHKKLSRSALMLGMLDSMEPLIEQLTQEFCE
RMRAQAGTPVAIHKEFSFLTCSIISCLTFGDK  
DSTLVQTLHDCVQDLLQAWNHWSIQILTIIPLLR
FFPNPGLQKLKQIQESRDHIIKQQLKQHK  
DSLVAGQWKDMIDYMLQEVEKQRDGKDKEQLHEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPE 
IQK*LQEELDLKLGPGSQLLYRNRMQLPLLMATIAEVLHLRPVVPLALPHRATKAS
SISGYNIPKDMVIIPNIQGANLDEMVWELPSKFWP
DRFLEPGKNPRTPSFGCGARVCLGEPLARLELFVVLARLLQAFTLLPPPDGTLPSLQPQL
YAGINLLIPPFQVRLQPRNLAAQELGEKTLTG*

>79. Cyp24         Mm.6575  genbank D89669 AC084066.1
MSCPIDKRRPLIAFLRRLRDLGQPPRSVTSKAHVKRAPKEVPLC
PLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLG
SFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRS
AFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLV
LYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWD
TIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANS
LMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVP
FTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPF
AHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELP
IAFCPR

>80. Cyp26a1 no UNIGENE entry genbank Y12657 NM_007811 EST AA239785
MGLPALLASALCTFVLPLLLFLAALKLWDLYCVSSRDRSCALPL
PPGTMGFPFFGETLQMVLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILL
GEHRLVSVHWPASVRTILGAGCLSNLHDSSHKQRKKVIMQAFSREALQCYVLVIAEEV
SSCLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPGPAGGGEDEQQLVEAFEEMT
RNLFSLPIDVPFSGLYRGVKARNLIHARIEENIRAKIRRLQATEPDGGCKDALQLLIE
HSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREEIKSKG
LLCKSNQDNKLDMETLEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGW
NVIYSICDTHDVADIFTNKEEFNPDRFIVPHPEDASRFSFIPFGGGLRSCVGKEFAKI
LLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFTYFQGDI

>81. Cyp26b1 mouse AC022779.3 AW047279 GSS AZ741670, AZ369731, BM936625.1
MLFEGLELVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQ (0)
GSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILLGEHQLVSTEWPRSARVLLGPNTVANSIGDIHRNKRK (0)
VFSKIFSHEALESYLPKIQLVIQDTLRAWSSQPEAINVYQEAQRLTFRMAVRVLLGFSI 
PEEDLGHLFEVYQQFVENVFSLPVDLPFSGYRR (?)
GIQARQILQKGLEKAIREKLQCTQGKDYSDALDILIESSKEHGKEMTMQELK 
DGTLELIFAAYATTASASTSLIMQLLK
HPAVLEKLREELRAQGLLHGGGCPCEGTLRLDTLSSLRYLDCVIKEVMRLFTPVSGGYRTVLQTFELD (?)
GFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQARSEDKDGRFHYLP
FGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSATV

>82. Cyp26c1 mouse XM_140712.1 May 17, 2002 also AC110212.4|
1    MISWGLSCLSVLGAAGTTLLCAGLLLGLAQQLWTLRWTLSRDWASTLPLPKGSMGWPFFG 180
181  ETLHWLVQGSRFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRL 338
339  VLARVFSRSSLEQFVPRLQGALRREVRSWCAAQRPVA 447
448  VYQAAKALTFRMAARILLGLQLDEARCTELAHTFEQLVENLFSLPLDVPFSGLRKGIRAR 627
628  DQLYEHLDEAVAEKLQEKQTAEPGDALLLIINSARELGHEPSVQELK 
     ELAVELL 987
988  FAAFFTTASASTSLILLLLQHPAAITKIQQELSAQGLGRACTCTPRASGSPPDCGC 1155
1156 EPDLSLAMLGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDT 1335
1336 HETAAVYRSPPEGFDPERFGVESGDARGSGGRFHYIPFGGGARSCLGQELAQAVLQLLAV 1515
1516 ELVRTARWELATPAFPVMQTVPIVHPVDGLLLFFHPLPTSGAGDGLPF*

>83. Cyp27a1       Mm.26793 8 ESTs follow AI286988 AK004977.1 
MAAWSRTRLRWTLLDPRVVGRGLCPQGARAKATIPAALQAQESTEGPGTGQDRPRLRSP 
AELPGTGTLQFLFQLFLQGYVLHLPDLQVLNKTKYGPMWTTSFGTYTNVNLASAPLLEQV
MRQEGKYPIRDHMDQWKDHRDHKGLTYGIFIAQGEQWYHLRQALKQRLLKPDEAALYTDA
LNEVISDFITRLDQVRAESESGDQVPDMAHLLYHLALEAITYILFEKRIGCLKPSIPEDT
AAFIRSVAIMFQNSVYITFLPKWTRPLLPFWKRYLNGWDNIFSFGKKLID EKVQELKAQL
QETGPDGVRVSGYLHFLLTNELLSTQETIGTFPELLLAGVDT TSNTLTWALYHLSKSPEI
QEALHKEVTGVVPFGKVPQHKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGF
LFPKNTQFVLCHYVVSRDPSVFPEPNSFQPHRWLRKKEADNPGILHPFGSVPFGYGVRSC
LGRRIAELEMQLMLSRLVQKYEIALAPGMGEVKTVSRIVLVPSKKVRLHFLQRQ

>84. Cyp27b1       Mm.6216  genbank AB006034 AC084293.2
LEADSPNTDMTQAVKLASRVFHRIHLPLQLDASLGSRGSESVLR
SLSDIPGPSTLSFLAELFCKGGLSRLHELQVHGAARYGPIWSGSFGTLRTVYVADPTL
VEQLLRQESHCPERCSFSSWAEHRRRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAA
AGYAGTLDNVVRDLVRRLRRQRGRGSGLPGLVLDVAGEFYKFGLESIGAVLLGSRLGC
LEAEVPPDTETFIHAVGSVFVSTLLTMAMPNWLHHLIPGPWARLCRDWDQMFAFAQRH
VELREGEAAMRNQGKPEEDMPSGHHLTHFLFREKVSVQSIVGNVTELLLAGVDTVSNT
LSWTLYELSRHPDVQTALHSEITAGTRGSCAHPHGTALSQLPLLKAVIKEVLRLYPVV
PGNSRVPDRDIRVGNYVIPQDTLVSLCHYATSRDPTQFPDPNSFNPARWLGEGPTPHP
FASLPFGFGKRSCIGRRLAELELQMALSQILTHFEVLPEPGALPIKPMTRTVLVPERS
INLQFVDR

The mouse and probably rat have lost 27C1 due to a chromosome rearrangement between BIN1 and ERCC3
It seems that 27C1 was broken and lost in this event.
In fugu CYP27C1 is on the minus strand of scaffold 106 from 31916-36680 the 
neigboring gene, 2624 bp away, is ercc3 at 39305-43553 minus strand (also found in human 39kb away)
Therefore, this linkage is very old. The next gene in the series ERCC3, CYP27C1 is BIN1 in human.
In mouse chr 1 is syntenic to human chr 2 at ERCC3, but BIN1 is on chr 18, implying a chromosome break.


>85. Cyp39  NM_018887.1 AF237981 39a1 (oxysterol 7alpha-hydroxylase) 72% to human
MGIMELFSPIAIAVLGSCVLFLFSRLKNLLGPPCIQGWIPWIGAGLEFGKAPLEFIEKARIKY
GPVFTIFAMGNRMTFVSEEEGINVLLKSEHVDFESAVQSPVYHTAWIPKNVFSALHERLY
ALMKGKMGTFNTHHFTGPLTEELHEQLEGLGTHGTMDLNDFVRYLLYPATLNTLFKKGLF
LTDKRTIKEFYQQFKTYDEGFEYGSQLPEWLLRNWSKSKRWLLALFEKNIGNIKAHGSA
GHSGTLLQAILEVVETETRQYSPNYGLVVLWAALANAPPIAFWTLGYILSHPDIHRTVL
ESISSVFGTAGKDKIKVSEDDLKKLLIIKWCILESVRLRAPGVITRKVVKPVKILNHTVP
SGDLLMLSPFWLHRNPKYFPEPESFKPERWKEANLDKYIFLDYFMAFGGGKFQCPGRW
FALLEIQLCIILVLYKYECSLLDPLPKQSSRHLVGVPQPAGKCRIEYKQRA*

>86. Cyp46 no UNIGENE entry AF094479 NM_010010 ESTs AA096922, R75217 
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLG
HLPYFWKKDEDCGRVLQDVFLDWAKKYGPVVRVNVFYKTSVIVTSPESVKKFLMSTKY
NKDSKMYRALQTVFGERLFGQGLVSECDYGRWYKQRKVMDLAFSRSSLVSLMETFNEK
AEQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQKPLSQAVKVM
LEGISASRNTLAKFMPGKRKQLREIRESIRLLRQVGKDWVQRRREALKRGEDMPADIL
TQILKAEEGAQDDEVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDE
VVGSKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLL
FSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVV
MAKLLQRIEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC

>87. Cyp51         Mm.24155 NM_020010 AF166266
MEQVTGGNLLSTLLIACAFTLSLVYLFRLAVGHMVQLPAGAKSP
PHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSLTMVGKTFTYLLGSDAAALLFN
SKNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGLNIAHFKQYVPIIEK
EAKEYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFT
HAAWLLPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDILQTLLDSTYKDG
RPLTDEEISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLEQKAVCGEDLPP
LTYDQLKDLNLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQ
RLKDSWAERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQIKTIWSTML
RLYEFDLINGYFPTVNYTTMIHTPENPVIRYKRRSK