This is a survey of the opossum genome P450s

 

David Nelson June 10, 2005

 

There are 5 CYP4ABX family members shown here plus a CYP4A pseudogene

A CYP51 gene and a CYP51 processed pseudogene are also assembled.

 

66 genes have been found now.  This is nearly complete but I am still in

progress on the rest. I am still missing CYP46 cannot find it

Since CYP46 is in fish and other mammals it is probably in opossum too.

many genes are missing N-terminals or have small defects.

 

>73% to 1A1 65% to 1A2 Built_from_P56591_and_others

489177 - 493862 bp (489.2 Kb) on chromosome fragment scaffold_14927

This transcript is located in sequence: contig_43733

MTSILSLLGFSKSFTVTELLVVSAVFCLVFWIIDSYHQRVPKGFKSPPGPWAWPLIGNVL

TLGKNPHLVLTQMREKYGDVMQIQIGSTPVLVLSGLETIRHALVKQGDDFKGRPDLYSFS

LILDGESLSFGPDSGEVWAARRKLTQNALKAFSISSSPSSSFCYLEEHVIKEAEYLIQKF

QEQKGHFDPVRYIVVSVANVICAICFGQRYDHDDQELLNIVRLSNKFGEVAASGNPVDFI

PILRYLPNSKITAFRDLNEKIVAFTQKLVKEHYRKFEKGCIRDITDSLIEHCQEKKLDEN

ANIMLSEKKVVNVVIDLFGAGFDTVTTAISWGLMYLVAKPEVQKKIHEELDTVIGRERLP

QLSDKTQLPYMEAFILETFRHSSFLPFTIPHSTTRDITLNGFYIPKGRCVFVNQWQINHD

PKIWGDPSVFRPERFLSVDGTINKALSEKVIMFGLGKRKCIGETIARWEVFLFLSILLHR

MEFSVPSGVKVDLTPVYGLTMKHIPCEHFQTKLRS

 

>70% to 1A2, 65% to 1A1 Built_from_Q64391_and_others

451687 - 462429 bp (451.7 Kb) on chromosome fragment scaffold_14927

This transcript is located in sequence: contig_91822

MVSSLLASISISELLLASVIFCLVFWVTRSSHQRVPKGLKSPPGPWAWPLFGNVWTLGKN

PHLTLAQLSEKYGDVMKIHIGSTPVIVLSGLETIRQALVKQGEDFKGRPDLYSSTFVADG

YSLAFNPDSGEVWAVRRKLAQNALNTFSVSSSPSSSSCYLEEHVNKEVKHLIQKFQELME

GVGCFDPYRHIVASVANVISAMCFSQRYEDHKNPEFTTLINASHEFVESATSGNPVDFFP

ILRYIPNPQLQRFKEFNQRFLKFLQNTIREHHKAFDENNIQDITGALYKHSQDKAFGNTS

SSVPEMLIINLINDIFGAGFDTVTTAISWSLMYLVTNPKVQKKIQQELDTVIGRDRWPLL

SDRPQLPFMEAFILEIFRHTSFVPFTIPHSTTRATTLNNFYIPKGTCVFVNQWQTNHDPK

LWEDPSVFRPERFLSADGTVNKALSEKVILFGLGKRRCIGETIARWEVFLFLAILLHQIE

FSVPSGVKVDMTPTYGLTMKHPRCEHFQARPRFSR

 

>75% to 1B1 complete Built_from_Q64429_and_others

690855 - 694571 bp (690.9 Kb) on chromosome fragment scaffold_14803

This transcript is located in sequence: contig_70942

MATSRSSEETWLPGLLSTQQTTLLLLFSVLAVVHLGQWLLRRVRRTPWASCRPPGPFQWP

LIGNAVEVGSIPHLSFTRLARRYGDVFQIRLGNCPVVVLNGERAIRQALLQQGAAFASRP

PFASFQVVSNGRSLAFNKYSELWKVQRRVAHGTVRAFSTGQVRSRQVLEQHVLSETRELV

ELLVQGSAGGAFLNPGPLTVVAVANVMSAVCFGCRYSHSDEEFRELLSHNERFGRTVGAG

SLVDVLPWLQRFPNPVRTAFRDFQKLNQDFYSFVLDKFLKHKSSLQPGAPPRDMMDAFIH

TVGKEEENPGEVKPGLRLDTEYVPATVTDIFGASQDTLSTALQWLLILFIRYPKVQAQVQ

EELDRVVGRDRLPSLNDQPHLPYVMAFLYEAMRFSSFVPVTIPHATTIDTSVMGYHIPKD

TVVFINQWSVNHDPEKWQNPEDFNPARFLDKKGFIDKDLASGVMIFSMGKRRCIGEELSK

IQLFLFIAILAHQCNFLANPDEDPEMNFSYGLTIKPQSFTINVTLRESMELLDSTVQRLQ

EE

 

>72% to 1A8P not a pseudogene Built_from_Q9PTY7_and_others

405900 - 420186 bp (405.9 Kb) on chromosome fragment scaffold_15058

This transcript is located in sequence: contig_41044

MFVIETISKEVTISFLVLMIVFIFIRALGNRNKKHMSPPGPRPFPIIGNLLQLGDHPYLTFMEMKKKYG

DVFLIKLGMVPVVVVNGTEMVKKGLLKDGENFAGRPHMYTFSFFAEGKSLSFSVNYGESW

KLHKKIAMNALRNFSKAEAKSSTCSCVLEEHVTEEASELVKIFSKLSLKQGSFDPKSSIT

CAVANVVCALCFGKRYGHFDKEFLRIIKTNEEFLKASSAANPADFIPCFRYLPLRIIHAP

REFYCQLNHFIEQHVQDHITTFDKNHLRDITDALVSICRDKSATIKTATLSDNEIISTVS

DIFGAGFETVSGFLHWSFLYLIYYPEIQAKIHEEIDGIIGFKPPRFKDRKNLPYTEAFIN

EIFRHTTFVPFTIPHCTTKDTTLNGYFIPQKTCVFFNMYQVNHDETLWENPDSFQPERFL

NEKGEMNKNLVEKVLIFGMGIRKCLGEDVARNEVFIFIVSILQQLKLKKCPEVQLDLTPV

YGLVMKPKPYQLIVEPRFHVNSST*

 

>CYP2ABFGST cluster gene order same as human but subfamilies are single copy

except 2B

 

>65% to Cyp2t4 mouse scaffold_14886 426887-434448, 69kb from 2F1

434448 MWLLFLLCLLLLALVLQGRGLKGSQGRLPPGPMPLPLLGNLLQLGPSGLDKRLME (0) 434284

sequence Gap aa 56-138

433349 SIEERIREEAAALVQELAVTK (1) 433287

433027 EVPFNPLRHIRNAVANVICSVVFGERYTYEDPDFRTLLDLLNDNFQILSSQWGQ (0) 432864

432453 MYNIFPSLLDWIPGPHHRIFSNFKKLQAFISEEIQKHKERRQPEEPRNFIDFFLDQMEK (0) 432277

432179 EKQDPRTHFYLETLVMTTHNLFFGGTETTSTTIHYGLLILLKYPNIA (1) 432042

428778 EKMQEEIDSMVGRARPPCLEDRDRLPYTNAV 428686

428685 IHEIQRFISVVPMGLPHILTQDTHFRGHFLTK 428590

428265 GTNIIPLLISAHQDPTQFKDPENFNPNNFLDDEGAFQNNEAFMPFAL (1) 428125

427069 GKRICLGAGLARMEIFLFLTTILQHFTLCAVKRPEEIDLSPKSTGLGNVSPPYELRLKPR* 426887

 

>71% to 2F1 Built_from_Q91Y29_and_others_9 pep:novel scaffold:BROAD0.5:scaffold_14886:503290:534552:-1 (modified)

MMELGGGLGLALGLAVAAYLLLNWWRHRFSGLPPGPAPWPFLGNILGVDVVDLLKSLKE (0)

FHLGSRPCVVIAGYQALKESLIDRAEEFGGRGEFPAVQMWSHGDGIAFSNGEKWKVLRRF

SIQILRNFGMGKKSLEERILEEEAFLLEELKKTEGAPFDPTFVLSRSVSNIICSVVFGSR

FDYEDERLLKLVHLINENFKIMSSPWGEIYNIFPGLLQWIPGPHRSLFQNYGSMKTLIDR

IIHEHQINLDSTSPSDFIDCFLIKMAEEAKSPDSYFHMETLVKTTFILIFGGTETVGTTL

RHSFLLLMKYPQIQARVQAEIDSVVGRGRRPTLDDRSSMPYTDAVIHEVQRFADIIPMNL

PHRLTRDTLFRGFLLPKGTDIITLLNTVHYDPSQFKTPNEFNPAHFLDSKEEFKKSPAFM

PFSAGRRLCLGEPLARMELFLYLTGILQNFTLQPLCSPEEIDLTPLSSGLGNVPRPFQLR

MVPR

 

>80% to 2A6 complete Built_from_Q91Y29_and_others_10 pep:novel scaffold:BROAD0.5:scaffold_14886:523331:534582:-1

MLVSGLLLGALFFCLSALVVLSVWRQRKVRGSLPPGPTPLPFIGNYLQLNTKQMYDSIMK

LSLKYGPVYT

IGEKFGPVFTVHLGPRPIVVLSGYEAVKEALVDQAEEFSGRGEQATFDWLFKGFGVAFSN

GERARQLRRFSITTLRDFGMGKRGIEERIQEEAGFLVEALRGTKGAPIDPTFFLSRTVSN

VISSIVFGDRFEYEDKQFLMLRMMLGSFQFTATSMGQLYEMFSGVMKHLPGPQQQAFKEL

QGLEDFITEKVRENQATLDPNHPRNFIDSFLIKMQEEKKNPNTEFFMRNLTMTTLNLFFA

GTETVSTTLRYGFLLLMKHPEVEAKIHEEIDRVIGRNRSPKFEDKAKMPYTEAVIHEIQR

FGDMIPMGLARRVTKDTKFRGYLIPKGTEVYPMLGSVLRDQSFFACPQDFNPQHFLDEKG

QFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTTILQNFRFQSPLPKEAIDISPKMVGFA

TIPRSYTISFLPRG

 

>82% to CYP2G2P Built_from_Q8SQ66_and_others_6 pep:novel scaffold:BROAD0.5:scaffold_14886:612386:623485:-1

MEFGGAITLFLALCVPCLVILIAWKRMHKGGKLPPGPTPLPFLGNLLQVRTDATFQSFLE

LSKKYGPVFTVYMGPRRVVVLCGHEAVKEALVDQAEEFSGRGELASIDRNFQGHGVALAN

GDRWRILRRFSLTVLRNFGMGKRSIEERIQEEAGFLMEEFRKTKGTPIDPTFFLSRTVSN

VISSVVFGSRFDYEDKQFLYLLHLINESFIEMSTPWAQVLYDMYSGIMQYLPGRHNKIYN

LIEELKDFIASRVKINEASLDPNNPRDFIDCFLVKMHQEKNNPKTEFNLKNLVLTTLNLF

FAGTETVSSTLRYGFLLLMKYPEVGAKVQKEIDHVIGQNRIPKAEDRMQMPYTDAVIHEI

QRLTDIVPMGVPHTVTQDTFRGYILPKGTDIFPLIGSALRDPKYFNPEAFEPQHFLDEEG

RFKKNEAFVPFASGKRVCLGEAMARMELFLYFTTILQNFSLQPLVPPSEIDITPQISGFG

NIPPTYKLCIVAR

 

 

>61% to 2B6 Built_from_Q8SQ66_and_others_8 pep:novel scaffold:BROAD0.5:scaffold_14886:627043:652084:-1

MNAGDLLLLLAVFLGFLLLLAKRPQKVNLPPGPTPLPLLGNLLQLGRHGLIKSFLEC

RDKYGDVFTVYLGTRRYFVICGPESVKKALVDNAEVFSGRGTLAISEMVFQRY

GFFVTYDGWKTLRRV

SIATLRDFGMGKRSIEEQIKAEAQCLVEELQKSQGALIDPTFIFHSVTANVICSIVFGER

FSYQDTQFREILNMFVEVFTILSSLWMQFFEQFPSVLKLLPGPHYRVLKIAQHIKDFISS

KIEQHQESLDPNSPRDFIDSFLLRIEKEKETPDSKYHVKNLVLTVLSLFFAGTETTSTTL

RYGFLLLLKYPQVAEKVQEEIDQVVGRDRAPEIKDRAKMPYTDAVIHEIQRFSDLLPMGI

PHMVTEDTSFQGYFLPKGTDVFILLSASLKDPCYFEKPHIFDPNHFLDAQGALKKNEAFI

PFSMGKRACLGEGIARTELFLFFTTILQNFSLVSSKPLEDLDIRPQCSGLGTLPQIYKLG

FLPR

 

 

>73% to 2B6 last half of gene, seq. Gap upstream

Built_from_Q8SQ66_and_others_9 pep:novel scaffold:BROAD0.5:scaffold_14886:661530:672893:-1

Missing exon 1 and exons 3,4 in two sequence gaps

REKYGDVFTIFLGSRPVVVLCGPDTVKEALVEKAEEFSGRGPIAMVDSVFQGLG

Sequence gap

LFELFSGFLKFFPGPHRRSQSNLEFINAYIADNVEKHRQSLDPNAPRDFIDIYLLRMEK

EKGISGTEFHHKNLILTVLSLFFAGTETTSTTLRYGCLILLKYPGVAEKVQDEIDQVIGK

DRTPEIKDRAKMPYTEAVIYEIQRFSDLLPLGVPHCVTQDTSFRGYLIPKGTEVYPLLST

VLHDPKYFKKPYDFDPNHFLDAQGSLKKNEAFIPFSSGKRICLGEGIARMELFLFLTTIL

QNFSLRSSMVPADIDLTPRESGVGNVPPTFQIQFLP

 

>62% to 2S1 Built_from_P24454_and_others_1 pep:novel scaffold:BROAD0.5:scaffold_14886:762460:771873:1

two frameshifts and a short seq gap in exon 1

MALATGVASPLLVLV

LVLVLLLALLVLRQGRPRSSRLPPGP

AALPLLGNVGQLWPGGXXXXXXX

(0) LSAKYGPVFTVYLGSRPVVVLSGYRAVKEALVDQAEAFSGRGKIAGLEKTFHEH

GLFFANGEQWRLRKFTTLSLRLGMGKKEGEEHIQEEARCLLEALRSTQGSPLDPSLLLSQ

AVSNITCLLLFGKRFDYEDKKFQAMVLATAGILTEISSPWGQVCEMFMGPVCYLSDILKY

LSAPHGRLTRHLSTLAAFVSDQIQQHQETLDPEAPVRDFIDDFLLKMRQEEKAQGVGPDH

TDFLLTTVNLLFAGTVTVSATLRFAFLLLLKYPEFQDRIHEELNQELGRERAPSLGDRGR

LPYTDAFLHEVQRFLALIPMGVPRTVTKPTIFQGYELPQGIEVFPLLGSVLHDPEFFERP

KEFYPRHFLNADGRFIKNEAFLPFSSGKRICLGEGLARTELFLFFTTILQNFSLESPSPL

GALSLHPAISGFANIPPTFQLRFRPR

 

>58% to 2C9 Built_from_Q29508_and_others_4 pep:novel scaffold:BROAD0.5:scaffold_13575:1131749:1157623:-1

21kb from CYP2E seq

MEPWALTTFFLVVCVSFLVFLSLWRKDYKGRNLPPGPFPLPIIGNLLQLGHNLSMSLCKL

SEKYGPVYTVYFGPQPVVVLHGYKALKEALTDQGDIFGERGHLPIIDDIYRGQGIVFSHG

EKWKQIRRFSLMTLRNFGMGKRSIEERVQEEAQFLLEELRKTNSQPFDPTFILGCAPCNV

ISSILFHQRFNYDDEEFLSMLRILNENVTLLNTPMAQLYNNFPWFLHYFPGPHKNFFSNV

KKLREFILKNAKKYQQTLDPNNLKNYIDCFLHKMQQDQKNPDSVFDLENLATAGMDLFDA

GTETTSTTLRYGLLLILKYPEVQNKIHEEIDQVIGRHRIPSIKDKLEMPYTEAVLHEILR

FVDLVPFSLPHEVTHDTQLQQHFIPKGTTVYPLLSSVLYDAKEFPNPKEFDPRHFLNKDG

SFKKSDYFVPFSIGKRACLGEGLAKMELFIFLATILQNFTLKSVIDSKEIDIKPGSTGLL

NVPPKYQLCLLPR

 

>62% to 2C19 Built_from_Q9UEH3_and_others_1 pep:novel scaffold:BROAD0.5:scaffold_13115:5872:11336:-1

exon 1 in a seq gap, exons 6-9 off the end of the scaffold

LAKKYGSIYTLYFGTQRVVVLHGYNIVKEALIDKGDIFMERGNVPIFEDTVK

VVFSRGERWKQIRRFSLMTLRNFGMGKRTIEERVQEEAQCLVEELRKTK

GQPNDPTFILGCAPCNVICSILFRERFNYKDEKFLYLMGILNENVQLFAKPWIQ

LYNFLPAFRVHLPGKHKQLFKNVEELKCFILERVKEHQEILDPNNPQDYIDCYLSKMQQ

 

90kb seq gap between these two genes may have another 2C gene

 

>62% to 2C19 complete Built_from_Q8QZW4_and_others_1 pep:novel scaffold:BROAD0.5:scaffold_13115:146250:169643:-1

MEPWGLTTTVLLTCVLFLIFLSLWNHGTKKGKLPPGPTPLPIFGNLLQFDFKNMAATMSK

LAKKYGSIYTLYFGMERVVVLHGYNIVKEALIDKGDIFMERGNVPIFEDAIKGQGVIFSR

GERWKQLRRFSLMTLRNFGMGKRSIEERVQEEAQCLVEELRKTKGQPNDPTFILGCAPCN

VICSILFRDRFKYKDEKFLYLMSLLNENFQLFTKPWIQFYNFLPAFRVHLPGKHNQFFKN

IGELKRFILERVKEHQEILDPNNPQDYIDCYLSKMQQEKNNPQSEFDVENLIMTGVDLFS

AGTETTSSTLRYGLLLILKHPEVQAKIHEEINRVIGHNRIPSIKDRQDMPYMDAVVHEVQ

RFIDLVPLNVPHAVNQDIQLQQYTIPKGTNVFPLLSPVLCDSKEFSNPDKFDLQHFLDKN

GSFKKSDYFMPFSAGKRACLGEGLARMELFLFLTTILQNFTLKPVGDPNEISVKNNHVGF

TNVPPYYQLCFLP

 

>oppossum EST DR038220 96% to scaffold_13115:146250:169643

PSIKDRQDMPYMDAVVREVQRFIDLIPLNLPHAVNQDIQLQQYTIPKGTNIFPLLSPVLR

DSKEFSNPDKFDPQHFLDKNGSFKKSDYFMPFSAGKRACLGEGLARMELFLFLTTILQNF

TLKPVGDPNEISVKNNHVGFTNVPPYYQLCFLP

 

>scaffold_13599 has three full 2C genes and two pseudogenes

This scaffold may be close to scaffold_13115 as part of the 2C cluster

 

 

>scaffold_13599 pseudogene parts between 5200000 and 5275000

related to CYP2C sequences

first pseudogene

GPVPFPTIGNTLQLDRRNIPESLCRVNK

VVILHGFKAVKEALIDGRNKFAARGSLPVFKFISGGLGMFLLDTDQKEGKE

 

Second pseudogene

LLLCISCLLILVWKRGFGKGKLPPGPVPLPIVGNLLQLDLKNIPES

LAKEYGPVFTLQLGLDRVVVLHGYKAIKEALIDHGDNFSSRGAMPIFQVINN

Missing exons

EKQQPQSEFTIDNLIWTVSDLFSAGTETMSTTLRYGLLILLKHPEI

VSEKIHEEIEHVIGRNRSPCMEDRNKMPYTNAVVQEIQRYVDLLPTGVPHAVSQDTQFRQYLIPK

GTTIIPLFTSILNDEEFPNSQQFDPGHFLDESGNFMKSDYFMPFST

GKRI*LGEGLARIELFLFFTTIL*NFTLKPLIDPKDIDTNPTANGFGKVPPPYKLCFQP

 

>67% to 2C19 scaffold_13599 between 5275000 and 5305000 not annotated in browser

MDPSVVNAFGLLFCISCLLLILAWKKDFRRGKLPPGPVPFPIIGNILQLDLKNIPESLCK

LAKEYGPVFTLQLGFTRTVVLHGYKAVKEALIDHGDQFAARGHMPVFEFISQGL

GIVSSNGERWKQLRRFSLMTLRNFGMGKKSIEENVQEEAKLLVEAIKQTK

XXPCDPTFILGCAPCNVICSLIFQKHFEYKDPKFLYLMKLLDDDLKLLSSPWIQ

VYNYFSPLIHYLPGLHHKLFKITDLQKKFILEEVKEHQQTLDPNNIRDFIDCFLMKMEQ

EKQKPLSEFTIGNLVNTAIDLFAAGTETTSTTLKYGFLMLLKHPEIT

VTEKIHEEIDRVIGYNRSPCMEDRNKVPYTNAVVHEIQRYIDHIPTSLPHAVTEDVQFRQYLIPK

GTTIIPLLTSVLYDDEEFPNPHQFDPGHFLDASGNFKKSDYFMPFST

GKRICLGEGLARMELFLFFTTVLQNFTLKSLIDPKDIDTTPVDSGFGKIPPSYKLCFLP

 

>Built_from_Q9JJ02_and_others_10 pep:novel scaffold:BROAD0.5:scaffold_13599:5307180:5340000 region :1

removed last three exons from another gene

added these back from correct location

MGPSVVTALGLLFCISCLLLILSWRKGFGKGKLPPGPVPLPIIGNMLQLNLKNIPESLCM

LAKEYGPVFTLQLGVQRIVVLHGYKAVKEALIEHGEQFAARGPMPIFELVSNGFGIGVSN

GERWKQLRRFSLMTLRNFGMGKRSIEERVQGEAKFLVEELKKTKGLPCDPTFILGCAPCN

VICSLIFQKHFEYNDQKFLYLMKLLHEQVRIGSSAWIQFYNCFPSLVQHLPGPHRKLLKL

FHFLHTFILEEIKEHQGTLDPSNPRDLIDCFLMKMEQEKQQPLSEFNIDNLVNTVADLFG

AGTETTSTTLRYGLLMLLKHPEIT

EKIHEEIDRVIGHNRSPCMEDRNKMPYTNAVVHEIQRYIDLIPTSLPHLVTEDTQFRQYIIPK

GTTIIPFLSSVLYDEKEFPNPNQFDPGHFLDENGNFKKSDYFMPFST

GKRICLGEGLARMELFLFFTTILQNFTLKSLIDPKDIDTTPIDSGFGKIPPSYKLCFLP

 

>70% to 2C18/2C19 Built_from_Q9JJ02_and_others_8 pep:novel

scaffold:BROAD0.5:scaffold_13599:5275928:5400120:1

in 5370000-5400000 region

removed first exon since it is from another gene and replaced it

MVTAFGLVCCTLCLLLISALRKRCGKGKLPPGPGPLPIIGNILQLDTKNIPKSLCM

LAKVYGPVFTLYLGSKSVVVLHGYKAMKEALIDHGEEFAGRGSFPIIDAINKGLGLAFSN

GERWKQIRRFSLMTLKNLGMGKRSIEERVQEEAKCLVEALKKTNGMPCDPTFILGCAPCN

VICSIIFQKRFEYHDQKFLHLMKLLDEKVKILSSPWIQIYNLLPLLAQYLPGSHHKLFKI

SQMMHNFFLEKVKEHQDALDPNNPQDLIDSFLIKMEQEKEKPQSEFTMENLVCTVSDIFG

AGTQTTSTTLRYGLLLLLKHPEITGKIHEEIDRVIGHNRSPCLKDRNSMPYTDAVIHEMQ

RYIDLVPANLTHSVIQDVKFRQYIIPKGTTIIPLLTSVLYDNEEFPNPDQFDPGHFLDES

GNFKKSDYFMPFSAGKRICIGEGLARMELFLFFTTILQNFTLKSLIDPKDIDTTPIASGF

GNIPPSFKLCFLPS

 

>Built_from_Q9JJ02_and_others_7 pep:novel scaffold:BROAD0.5:scaffold_13599:5275928:5470669:1

removed first 4 exons and last exon from another gene

and replaced them

this gene in the region 5400000-5440000 scaffold_13599

LILVLCISCLFLISSRKKSHGKGQLPPGPFPLPIVGNLLQLDTKHIDKSLGS

LTKVYGPVYTLHFGSERVVVLHGYEAVKEALIDHGEEFAARGSLPIIDAVSKGF

GLVFSKGERWKELRRFSLMTLRNLGMGKRSIEERVQEEAKYLVEEFKKS

XXPCDPKFILECVPCNVICSVIFQKRFEYSDRKLQTLMELLDENIKILTSPWIQ

VYNFIPSLVHYLPGPHRTFLNN

CKIMHNFIEEKVKEHQETLDSNNPQDFIDYFLIQMGQKKQNQQSEFTMENLILTVSDLFI

AGSETTSTTLRYGLLLLLKYPEITDKIHEEIDRVIGRDRSPCMKDRNSMPYTDAVIHEIQ

RHLDLIPFNLPHAVKQDTRFREYVIPKDTTIFTSLSSVLYDEKEFPNADQFDPGHFLDES

GNFKKSDYFMPFSI

XKRACVGEGLARMELFLFFTNILQNFTLKPLIDPKDIDTTPISNGFGCVPPSYKLHFLPV

 

>68% to 2C19 this gene in the region 5440000-5470000

scaffold_13599

MDPSVVTALGLIFCVSCLLLISAWRKGFGKGKLPPGPTPLPIIGNLLQLDTKNINKSFCE

LAKTYGSVFTLYLGSERAVVLHGQKAVKEALIGNGDAFAGRGSFPISETINKGL

GLLFSNGERWKQIRRFSLMTLRNFGMGKRSIEERVQEEAKRLVEALKNT

GLPCDPTFIFGCAPCNVICSVVFQKHFEYQDKKFLTLMEYLNENLQILSSPWIQ

VYNLFPSLIHHLPGIHHKVIKNFRALNDFVLERVKEHQETVDPNDPRDFIDCFLMKMEQ

EKQNPKSEFIIENLVSTTIDLFGAGTETTSTTLRYGFLLLLKHPQIV

DKIREEMDQVIGQNRSPCMKDRSSMPYTDAVIHEIQRYIDLVPTSLPHAVTQDVKFRQYLIPK

GTTIIPLLTSVLYDNEEFPNPEQFDPGHFLDESGNFKKSDYFVPFSI

GKRACVGESLAQMELFLFFTTILQNFTLKPLVDPKDIDVTPISNGFNHVPPCYELCFLPS

 

>CYP2C 57% to 2C18 Built_from_Q6PER7_and_others missing 216 aa

257423 - 310084 bp (257.4 Kb) on chromosome fragment scaffold_13485

This transcript is located in sequence: contig_23460

LYNMYPSLIKHLPGSHRTINKNVLEVRNFIMDEVKKHQETLDPNNPRDYIDGFLIKIQQE

 KLNPQSAFNYQELMATGSNLFSAGTETTSSTLRYGLLLLMKHPKIQDKVHEEIDRVLGSS

 RKPSMQDRVKMPYVDAVVHEIQRYIHLLPFSLPRLAAQDIHFQKYVIPKGTSVFPLLYSV

 LYDRKAFPNPYEFDPENFLDKSGNFQKNDHFVPFSLGKRLCLGESLARMEVFLFLTTILQ

 NFTLKPMVEPKELVTTPLRNGIVNIPSIYKLSLIP

 

>CYP2D

Database location  : contig_35735   16579 to 16764 (-)

Genomic location   : scaffold_11452 49597 to 49782 (-)

scaffold_11452:47242:51381:-1

GENSCAN00000009132 pep:Genscan scaffold:BROAD0.5:scaffold_11452:52083:52720:-1

this fragment 63% to 2D6

missing exon 1 in a sequence gap

SRRSSGKVFSVQLLWKPAVVLSRPDAVREALVHRSEDTAGRPPSLVYSHLGFGPKCPRQ

VVLAQYGEAWKEQRRFSLTTLRNLGLGKQSLERWVTAEADFLCSAFAAR

Sequence gap missing exons 4-5

This frag 80% to 2D6

AKGNPESSFNDENLRMVVVDLFTAGMVTTATTLTWALLLMILYPDVQ

KVQEEVDVVIGRSRRPTMKDQAHMPFTNAVIHEVQRFGDIVPLGIPHMTTRDTEIQGFFIPK

GTVLITNLSSVLKDEATWEQPYRFYPEHFLDAEGRFVKPEAFMPFSA

GRRACLGEPLARMELFLFFTCLLQRFSFSVPVGQPRPSTHGFFAFPVAPLPYQLCAVVR

 

>67% to 2E1 Built_from_Q29508_and_others_6 pep:novel scaffold:BROAD0.5:scaffold_13575:1164439:1178780:-1

21kb from CYP2C seq

MAFLGATLALLVWFVFLLFVSVWKQIQSSWKLPPGPFPLPIIGNLFTLDIRNFPKSFAKL

AKEYGPVFTVYVGSRRIVVLHGYKVVKEALLDLKNEFAGRADIPAFEAHQNSGIIFNDSE

TWRDTRRFGLTVLRDYGMGKQSNEERIQRESHFLVEALRNTNSQPFDPTFVLGGGPLNVI

HDILFHSRLDYSDKMCQRLLHLYNEDFYLLSSPWIQVYNNIGSYLRYLPGSHRKLLKNIS

EAKQYVFEKVKEHQEVVDLNHPYDLTDTLLIQMEKDQKKKKLGFNLENVTVTVADLLFAG

TETTSTTLRYGLLLLLKHPKVEEKLHEEIDRVIGPHRLPSMKDKINMPYMEAVVHEIQRV

INLVPSNLPHVMHEDIHFRGYLLPKGTTVYPTLDSVMLDSEEFPNPEQFDPGHFLNENGK

FRYSDYFKAFSAGKRVCVGEGLARMEIFLFLTIILQHFNLKPLISPEKIDTSPLTVGFGT

IPPIYKLCVLPRS

 

>61% to 2J2 Built_from_P12791_and_others_8 pep:novel

scaffold:BROAD0.5:scaffold_16806:796848:899843:1

be aware this seq is a hybrid of two genes, yellow region identical

LLLSAILLILASYLQRKRRQANYPPGPSPLPLLGNFFQIDFKKPQVAFQEVRSERGGPER

TETFNPEHFLENGQFTKREAFLPFSAVKLKILNIDRNYFHNLGISLSNGQIWKDQRRFTL

MTLRNFGLGKKTLEFRIQEEATYLTEAIKEEKGQPFDPHFQINNAVSNIICSVTFGYRFE

YHDSQFRELLKILDEVMVLHGRWECQLFEMFPWIMRFLPGPHHKLFREWKKLQSFVTQII

KQHKEDQNSEEAQDYIDAYLKELSKGDVSSSFSEGNLASCTLDIFFAGTETTSTTLRWAL

LYMALYPEIQGKIQAEIDRVIGQSRQPTMADKENMPYTNAAIHEVQRMGNIIPINVPRVA

TVDTTVAGYHVPKGTVLMTNLTALHRDPKEWATPETFNPEHFLENGQFKKRESFLPFSAG

KRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFRTGVTISPVPYKICALPRET

 

>64% to 2J2 Built_from_P12791_and_others_10 pep:novel scaffold:BROAD0.5:scaffold_16806:860579:998071:1

be aware this seq is a hybrid of two genes, yellow region identical

MLLSLWEGASLLTLLLVSTVLLILAFYVQRGRQHPNFPPGPPLLPIFGNIFQMDPKKPQD

TFQEFAKKYGNIFCLKLFGAPMICVTGLPLIKEVLLKQGQVFIDRPQTPWSSYAFKHHGI

SLSNGQIWKDQRRFTLMTLRNFGLGKKTLEFRIQEEATYLTEAIKEEKGQPFDPHFQINN

AVSNIICSVTFGYRFEYHDSQFRELLKILDEVMVLHGRWECQLFEMFPWIMRFLPGPHHK

LFREWKKLQSFVTQIIKQHKEDQNSEEAQDYIDAYLKELSKGNMSSSFNEDNLVACTLDL

FFAGTETTSTTLRWALLYMALYPEIQGKIQAEIDRVIGQSRQPTMADRENMPYTHAAIHE

VQRMGDIVPLNVPRIATVDTTLAGYHVPKGTMLLTNLTALHRDPKEWATPDTFNPEHFLE

DGQFKKREAFLPFSAGKRVCLGEQLAQPELFIFFTCLLQRFTFQAPPDTQLSLDFQFGLT

ISPVPYQICALSRET

 

>63% to 2J2 Built_from_Q9YGF1_and_others_9 pep:novel, complete

scaffold:BROAD0.5:scaffold_1903:224902:254645:-1

MQFPSLWEGASLKSLLLFSAVFLMLASYLQRRRRHPNYPPGPFQLPFLGNFFHMDHKNPH

MAFYQLAKKYGNIFSLELVGCPVIVVTGLSLIKEVLVNQGQVFVDRPHTPLRSYVFKKLG

LIMSNGQEWKDQRRFTLMTLRNFGLGKRTLELRIQEEAMYLTEAIREEKGQPFDPHFQIN

NAVSNIICSVTFGNRFEYHDSQFRELLKILDEAMMLQTKWECQFFEMFPRIMKFLPGAHK

KLFREWKKLESFVLDIIRQHKENPNSEEAQDFIEAYLTELSKGNISPSFSEDNLVSCTLD

LFLAGTETTSTTLRWALLYMALCPEIQGKIQAEIDRVVGQSRLPTMADRENMPYTNAAVH

EIQRMGNIVPFNVPRMSTVDTTVAGYHVPKGTLLVTNLTALHRDPKEWATPDAFNPEHFL

EDGQFKKRESFLPFSA

GKRVCLGEQLARTELFIFFTCLLQRFTFQAPPDTQLTLDFRIGLTISPAPYKICAIPR

 

>65% to 2J2 Built_from_Q9YGF1_and_others_8 pep:novel missing last exon scaffold:BROAD0.5:scaffold_1903:224902:329336:-1

note: this assembly originally used the last exon of the above gene.

Look between 254645 and 279000 on – strand for C-term

TLLLFSAILLILASYVQRRRRRQQLKYPPGPLRLPIFGNVFQIDTTKAHVSVQEFVRKFG

NIFSMELFGVPMMTVTGLPLIKEVLINQGQVFVDRPQFPLQTYTFKSVGLLMSNGQEWKD

QRRFTLMTLRNFGLGKKTLELRIQEEATYLIEAIREEKGQPFDPHFQINNAVSNIICSVT

FGNRFEYHDSQFRELLKSLDQVSVLQASWECQFFNIIPWIMKFLPGAHKKLFREFKKLES

FVVHVIKQHKEDQNSEEARDFIDAYLKELSKGNNSSSFNEDNLVSCTLDLFFAGTETTST

TLRWALLYMALYPEIQGKIQSEIDRVIGQSRQPTMADRENMPYTNAAIHEVQRMGNIVPF

NVPRVAVVDTIVAGYYVPKGTLLVTNLNALHRDPKEWATPDTFNPEHFLENGQFKKKESF

LPFSM

GKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFRAGLTISPAPYKICALPRETQPKVGL*

 

>64% to 2J2 Built_from_Q9YGF1_and_others_5 pep:novel scaffold:BROAD0.5:scaffold_1903:224902:380321:-1

modified: only first two exons are new

look between 330000 and 378000 on – strand for last 7 exons

VLPSLQTLLLFSAILLILASYVQRRRRRQQSKYPPGPLRLPIFGNVFEIDIKKPHISIQE

CVRKYGNIFSMDLLSAPMIVVTGLPLIKEVLVNQGQVFVDRPRSPLQSYIFKIN

GLFMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEAIYLTEAIREEKGE

PLNPHFQINNAVSNIICSVTFGNRFEYHDSQFRELLKSLNQVSVLQASWECQ (0)

FFDIFPRIMKLLPGAHKKHFR

NSRKLESFVVHVIKKHKEDQNSEEAQDFIDAYLKELSKXX

GNITSSFNENNLVACTLDLFFAGTETTSTTLRWALLYMAFYPEIQ

XKIQAEIDRVIGHSRWPTMADRENMPYTYAAIHEVQRMGNIVPLNAPRVATVDTTLAGYHVPK

GTMLLTNLTALHRDPKEWATPDTFNPEHFLEDGQFKKKEAFLPFSA (1)

GKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFQAGMTLSPVFYQICALPRETEPKLIL*

 

>83% to 2R1 Built_from_Q9QXF7_and_others_1 pep:novel

scaffold:BROAD0.5:scaffold_12644:255201:265755:1

LRSRRQARFPPGPAGLPFIGNIFSLAASAELPHVYMEQQSRVHGQIFSLDLGGLFTVVLN

GYDMVKECLIHQSEIFADRPALPLFKKLTKMGGLLNSTYGRGWLDHRRLAVNSFRCFGSG

QKSFESKIAEEAKCFIDAVDTYQGKPFDLKQLITNAVSNITNVIIFGERFSYEDTEFQHM

IEIFSENVELAASASVFLYNSFPWIGIFPFGKHQQLFKNAAVVYDFLSKIIEKVSANRKP

QSPQHFVDAYLDEMDKGRNDPGSTYSKENLIFSVGELIIAGTETTTNVLRWAILFMGLYP

NIQAQVHKEIDLIVGPNRTPSLEDKPQMPYTEAVLHEVLRFCNVVPLGIFHATSQDTVVR

GYSIPRGTTVITNLYSVHFDKKYWKDPEVFYPERFLDSQGQFVKKEALVPFSLGRRHCLG

EQLARMEMFLFFTSLLQRFHLHFPPDLVPNLKPKLGMTLQPLQYLICAEKR

 

>74% to 2U1 missing N-term Built_from_Q7Z449_and_others

1937657 - 1968473 bp (1.9 Mb) on chromosome fragment scaffold_14967

This transcript is located in sequence: contig_70233

RRRGVPPGPRPWPLVGNLGFMLLPAVFK

19 aa Gap here

SSQVVLEYLSRLYGPIFSFYLGPYLVVVLSDF

 HSVREALVQQGEVFSDRPRLPLISVFTKEKGIVFAHYGPIWRQQRKFSHSTLRHFGLGKL

 SLEPKIIEEFKYVKEEIQKHGGNPFSPFPIISNAVSNIICSLCFGQRFEYNNSDFKKMLH

 LMSRGLEISVSYQMMLINICSWFYYLPFGLFKEIRQIEKDLTVFLKGIIREHRETLDVEN

 PQDFIDMYLLHMEEEMKSNSNTSFDEDYLFYIIGDLFIAGTDTTTNTLLWCLLYMSLNPE

 VQEKVQKEIEKVIGPDRAPSLTDKVHMPYTEATIMEVQRMSAVVPFGIPRMTSEKTTLQG

 YTIPKGTMIIANLWAIHRDPAIWENPKNFSPERFLDEEGQLIKREHFIPFGIGKRVCMGE

 QLAKMELFLMFVSLMQNFIFTFPKDAKKPIMPGKFGLTLSPHPFNVIVSKR

 

>55% to CYP2W1 Built_from_Q6VVW9_and_others_1

scaffold:BROAD0.5:scaffold_5766:862320:898262:-1

ALLGLLLSWALFCLLTRSKERAGKWPPGPAPLPFIGNLHLLDLRRQDKSLMKISEKYGPV

FTIHFGLQKMVVLTGYQAVKEALVDSAEEFADRPPIPIFQRIQEGQGIFFSSGNLWKTTR

KFTMSSMHKLGMGKKLIAKKILEEFSFLEELIDSFKGEPFKLKLFNMAPTNVIFFLLFGE

RFDYQDPTFVTFIRLIDEVMVLLGSPFLHLFNFYPFLGWFLKPHKTVLVKIEEVRVILRK

YMVASRQNISRGYVTSYIDALIQKQNLLPHGEFSASIFHIFPWMKTGAEKPFCNGREWTQ

TKPFVSFLLAKVQDELDRVLEKSRLPEYEDQKALPYTNAVVHEIQRFIALLPHVPHSTSV

DTHFRGYFIPKGTPVIPLLTSVLLDKTQWETPNKFNPSHFLDADGNFVKKAAFLPFSIGH

RVCIGENLAKMEMFLFFASLLQRFTFHPPPGIQEADLDITPQLTFTMRPQPQAVCAVSR

 

>62% to CYP2AB1P Built_from_Q6P0T4_and_others_1 pep:novel scaffold:BROAD0.5:scaffold_15223:222913:242918:-1

MFSLATGLAILATSFLLLRMLAFFLARTQFPPGPCPLPILGNLLQLRFQLHPEKLSQLTR

KYGSIFTVWLGSTPVVVLNGFQAVKDALVTHSEDFADRPVTPLFEDLFGDKGIISTSGHA

WQQQRRFGLITLRALGMGKKVLEQRLQEEAQYLVEIFHRQNGTSFDPHVPIVRAAANVIC

ALVFGHRFPHGDPFFQELMKAIDFGLAFVNTIWRRLYDAFPWLLRQLPGPHRKIFRYQEI

VKSLICQEIERHKQRVPEDLEDFISCYLAQITKRKDDPASTFDEENLIQVIIDLFLGGTE

TTATTLRWALLYMIHHRDVQGKVQQELDTVLGPSRVISFKDRKLLPYTNAVLHEVQRFCS

VISVGAVRKCGTATTVQGFPIQKGTIVLPNLASVLCDPEHWETPWQFNPGHFLDGEGNFV

IHEAFLPFSAGHRVCLGELLAKVELFLVFAHLLREFRLRAPAGASTNERDYILWGTKQPR

PYDICASPRL

 

>64% to 2AC1P Built_from_Q6PA33_and_others_1 pep:novel

scaffold:BROAD0.5:scaffold_12611:1500312:1533637:-1

LDLLSILSGLSLILILILNMKLTLTKNFKKQSPPGPKPLPVIGNLHILNLKRPYQTMLEL

SKKYGPIFSLRMGPKTVVVLSGYETVKDALVNYSEQFGERARIPIFERIFEGKGIVFSHG

ENWKITRRFSLTTLRNFGMGKRVIEERILEECHHLIQVFESHQGKPFEISTIMSASVANI

IVSILFGKRFDYKDPQFLRLLHLIGENIRLAGGPSITIFNMFPVLGFLLQDLKRVLRNRD

ELFSFIRTTFLKHLRKLDKNDQRSFIDAFLIKQQEEKDKSDDYFNNDNLVALVSNLFAAG

TETTSSTLRWGILLMMKYPEIQKKVHNEITEVIGSAQPRIEHRTQMPYTDAVIHEIQRFS

NILPMNLSRETTTDVIFKNYYIPKGTEVITLLTSVLQDQTQWEKPCTFHPQHFTKEGKFI

KRDAFLLLFSSLFLTCVLAGQRMCAGESLAKMELFLFFTSLLQKFTFCPSPGVSNSDLDL

TPDIGFTTRPQPYKICALP

 

>55% to 3A4 Built_from_Q6LEQ2_and_others cyan insertion

2878085 - 2933432 bp (2.9 Mb) on chromosome fragment scaffold_12616

This transcript is located in sequence: contig_103558

GLSTETWTLLVAFVTLLILYGIWPYGIFKKLGIPGPRPLPFFGTFLEYRKGILEFDKQCF

 QKYGKMWGFYDGRLPILAILDPDIIKIVLVKEFYTLFTNRRNFGLNGILDSGITVAEGEK

 WKRIRSIISPTFTTGKLKEMFPIIKHHIDVLVNNIEKKVAQDESVNMKEHLWSLQVLDVI

 TTSFGVDIDSIHTKPNDPLLVHIKKLLSFSFMSPLLILICIPYQSLVLEPISVLRQKVMI

 YFKKKEGEKKGIDTKKDRVDFLQLMIDSQVMNGSRSEKRNNSPKALTEMEIVAQAVTFIF

 AGYETTSTTLNFITYNLATHPEIQKKLLEEIDSTLPNKAVPTYDTIFQMEYLDMVVNETL

 RLFPLGGRIERICQKTAEINGITIPKGTVMLIPVYVLHHDPEYWPEPEEFRPERFDQEGR

 KSIDPYVFLPFGAGPRNCVGMRFALLTLKTALVTLLQNFTMEPCKETPIPLELETKGFMQ

 PKKPIILKLVPRPRP

 

>64% to 3A4 Built_from_Q98T91_and_others grey = error region

941307 - 1075313 bp (941.3 Kb) on chromosome fragment scaffold_19210

This transcript is located in sequence: contig_73184 MNIIPSLSAGTWTLIVLFLTLLYLYGTRTHKLFKNLGIPGPKPLPFFGTVFSYRKGLVNF

 DYDCFKKYGKTWGFYDGRQPVLATMDPETIKTVMVKECYSVFTNRRSFGPVGSLESAITV

 AKDDQWKRIRTVLSPTFTSGKLKEMFPIINQYGDVLVKNMKKEAEKNKPVTMKDILGAYS

 MDVITSTSFGIHVDSLNNPNDPFVREIKKLIRFNFLDPLILSVAIFPFLIPLFNKLDLTV

 FPKEATDFLAKSIIKIKEERTKSTEKASRPLQCLEEEYVYNVNDLSDEEILAQSIIFIFA

 GYETTSSVLSFLFYHLATNPKIQEKLQKEIDAFLPNKEAVTYDALVQMEYLDMVINENLR

 LYPIAGRIERVAKKTVELNGLTIPKGTVVMAPPYVLHRDPEYWPEPEEFRPERFSKENKE

 SINPYVYLPFGAGPRNCIGMRFALMSMKVAVSRLLQEFSFRPCKETQIPLKLSNQPLLTP

 TVPIVLQAELRN

 

>66% to 3A4 Built_from_P51538_and_others

23961 - 170013 bp (24.0 Kb) on chromosome fragment scaffold_11888

This transcript is located in sequence: contig_58548

MNIIPNLSAGTWTLIILFLTILYLYGTRTHKLFKNIGIPGPTPFPFIGTILYYRKGIVGF

 DYGCYKKYGKTWGFFDGTKPVLAIMDPETIKTVLVKECYSVFTNRRMLGLSGILEKAISI

 AEDEEWKRIRTVLSPAFTSGKLKEMFPIINQYGDVLVKNMKKEAEKSKPVTMKEIFGAYS

 MDIIISTSFGIHVDSLNNPNDPFVREIRKLIRFSFLDPLILSITIFPFLIPLFKKLDITV

 FSKDATDFLGKSILRIKEERKKSTEKHRVDFLQLMMDSQTSKNSESHSQKDLSDEEILAQ

 SIIFIFAGYESTSSVLCFLFYQLATNPGIQEKLQKEIDAFLPNKEAVTYDALVQMEYLDM

 VINENLRLYPITGRIERIAKKPVELNGLMIPKGTVVMAPPYVLHRDPEYWPEPEEFRPER

 FSKENKESINPYVYLPFGVGPRNCLGMRFALMSMKVAVSRLLQEFSFRPCKETQIPLKLS

 YRPLLAPSVPIVLQAVLRNKKGN

 

There are 5 CYP4ABX family members shown here plus a CYP4A pseudogene

 

>Gene 4.1

Query location     : CYP3Aamp        430 to   456 (+)

Database location  : contig_55667  10964 to 11044 (+)

Genomic location   : scaffold_1650 18357 to 18437 (+)

 

(1) GKGLLSLEGEKWHYHRRLLTPAFHFNILKDYIYIMRNTVSLML (0)

AGGAAAAGGCCTTCTGAG

CTTAGAAGGTGAGAAATGGCATTACCACCGGCGCCTACTGACCCCAGCCTTCCACTTCAA

CATCCTGAAGGACTACATCTACATAATGAGGAACACTGTCAGCCTGATGCTGGT

 

(0) DKWEKLRTKDSSIDVFDFISYMSLDTSLKATFGLQDFNKEES (2)

AGGATAAATGGGAAAAACTCAGAACCAAGGACAGTTCCATAGACGTCTTTGACT

TTATCTCTTACATGTCCTTGGACACTTCCTTGAAAGCTACCTTCGGTCTCCAGGATTTCA

ATAAAGAAGAAAGGT

 

(2) LFSYFQNMNKLLYLVRKRMETFLYYSDFIYKLTSDHYEFQTTCKELKEEP (1)

AGCTTATTCAGCTATTTCCAG

AATATGAACAAACTTCTATATCTTGTGAGGAAGCGCATGGAAACCTTCCTCTATTACAGT

GATTTCATTTA CAAGCTGACTTCTGACCATTATGAATTCCAGACTACCTGCAAAGAATTA

AAGGAGGAGCCAGGT

 

(1) AKIIRHRRALYKNQSEKDKVPKKKYLNFLDILFQAK (0)

AGCTAAGATCATCCGGCATAGGAGGGCACTCTACAAGAACCAGAGTGAAAAAGACAAGGT

GCCAAAGAAGAAGTACCTGAATTTCCTGGACATTCTCTTCCAAGCCAAAGT

 

(0) DEDGGGFTNEELENEVNTFRFAGQDTVAV

GFSWTLYCLAMNPEYQKKCREEIQGILKDGESITW (2)

AGGATGAAGATGGAGGAGGCTTCACAAATGAGGAACTAGAAAACGAG

GTAAACACATTCAGGTTTGCAGGACAAGACACTGTAGCTGTTGGGATTCTCCTGGACCTT

ATACTGCC TGGCCATGAACCCAGAATATCAAAAGAAATGTAGAGAAGAGATCCAAGGTAT

TCTGAAAGATGGAGAATCCATAACCTGGT

 

(2) DHLTQMTYSTMCIKESFRMYSPIPKVARTLNQPITFPDGQTLPS (1)

AGGGACCA

TCTTACCCAGATGACTTACAGCACCATGTGCATCAAAGAATCCTTCCGCATGTATTCACC

TATCCCCAAAGTAGCCAGGACACTCAACCAGCCCATCACTTTCCCAGATGGACAGACTTT

ACCTTCAGGT

 

(1) DTTVTINIWALHYNPAIWENPK (0)

AGACACGACTGTGACCATAAACA

TCTGGGCTCTGCACTACAACCCTGCAATCTGGGAAAACCCAAAGGT

 

10961 (0) VFDPERFTPENTKKRHPYAFLPFSAGLR (2) 11044

 

AGGTCTTTGACCCTGAAAGATTCAC

CCCAGAGAATACTAAGAAGAGACACCCTTATGCTTTCTTACCATTTTCTGCTGGGCTCAG

GT

 

NCIGQQFAMNLIKVSLALTLLRFELLPDLEKPPIPISQIVLRSTSGFHFYLKPLR*

AGGAACTGCATTGGGCAGCAATTTGCCATGAATCTAATAAAGGTGAGCCTGGCC

CTGACACTGCTCCGCTTTGAGCTACTTCCAGATCTTGAGAAGCCTCCAATCCCCATATCC

CAAATAGTTCTCAGGTCTACGAGTGGTTTCCACTTCTATCTAAAGCCACTACGTTAG

 

49% to 4X1, N-term 3 exons in seq gap, 58% identical to gene 4.2

GKGLLSLEGEKWHYHRRLLTPAFHFNILKDYIYIMRNTVSLML (0)

DKWEKLRTKDSSIDVFDFISYMSLDTSLKATFGLQDFNKEES

LFSYFQNMNKLLYLVRKRMETFLYYSDFIYKLTSDHYEFQTTCKELKEEP

(1) AKIIRHRRALYKNQSEKDKVPKKKYLNFLDILFQAK (0)

DEDGGGFTNEELENEVNTFRFAGQDTVAV

GFSWTLYCLAMNPEYQKKCREEIQGILKDGESITW

DHLTQMTYSTMCIKESFRMYSPIPKVARTLNQPITFPDGQTLPS

(1) DTTVTINIWALHYNPAIWENPK (0)

10961 (0) VFDPERFTPENTKKRHPYAFLPFSAGLR (2) 11044

NCIGQQFAMNLIKVSLALTLLRFELLPDLEKPPIPISQIVLRSTSGFHFYLKPLR*

 

Gene4.2

Query location     : CYP4            126 to   168 (+)

Database location  : contig_55667  42355 to 42483 (+)

Genomic location   : scaffold_1650 49748 to 49876 (+)

 

MGADKIPSWLETHWTRPLHLALTFVLALLLLQVVKLYLRRQG

LLRALRLFPGPPPHWLFGNQRE (0)

ATGGGCGCGGATAAGATCCCTTCTTGGCTGGAGACGCACTGGACTCGGCCCTTGCACTTG

GCCTTGACGTTCGTTCTCGCGCTGCTGCTGTTGCAGGTCGTCAAGCTCTACCTCCGGCGC

CAGGGACTGTTGCGAGCCCTGCGCCTCTTCCCCGGACCCCCTCCACACTGGCTCTTTGGG

AACCAGAGAGAGGT

 

(0) FYLEKELQQFNVLPEQYPCALPLWVGAFQVLLNIYDPEYAKILLNRR (1)

AGTTTTACCTGGAAAAAGAACTCCAGCAATTTAATGTGTTG

CCAGAACAATACCCTTGTGCTCTCC

CTCTCTGGGTTGGGGCCTTTCAGGTGCTTTTAAATATCTATGACCCAGAATATGCGAAAA

TTCTTCTGAACCGAAGAGGT

 

(1) DPKIQHGYKFIIPWI (1)

AGATCCCAAAATACAGCATGGGTACAAGTTTATTATCCCCTGGATTGGT

 

(1) GGGLLSLEGKKWYQHRHLLTPAFHLSILKPYIHVMNDSVCRML

AGGAGGAGGACTGCTGAGCCT

GGAAGGAAAGAAGTGGTACCAGCATCGCCATCTGCTGACTCCTGCCTTCCACTTGAGCAT

TCTGAAGCCCTACATCCATGTGATGAATGATTCAGTCTGCAGGATGCTGGT

 

(0)           DTWEKLSTQDNSVEICEPIRLMTLDSIMKCAFSVQTSSQTES (2)

AGGATACATGGGAGAAGCTCAGCACCCAGGACAATTCTGTGG

AGATCTGTGAGCCCATTCGCCTGATGACCTTGGACAGCATCATGAAATGTGCCTTCAGTG

TCCAGACCAGCTCCCAAACAGAAAGGT

 

(2)  FSTNYLSTVTKLSELIFCRLNNYLHHNDLIYRWSSQGQEFQALCQIAHQLP (1)

AGCTTTTCTACCAACT

ACCTCTCAACTGTGACAAAACTCTCAGAACTAATCTTCTGCCGCCTGAACAACTACCTCC

ATCACAATGACTTGATTTACAGGTGGAGTTCTCAGGGGCAAGAATTCCAAGCTCTCTGCC

AAATAGCACATCAGCTCCCAGGT

 

(1) AKIIQERREALKNNSEQDKIRKKKFLDFLDVLLCAK (0)

AGCTAAGATCATC

CAGGAAAGGAGGGAAGCACTCAAGAATAATAGTGAACAGGACAAGATCCGAAAAAAGAAG

TTCTTGGATTTTCTAGATGTTCTTCTTTGTGCCAAAGT

 

(1) SENGEGLSNEELEAEVNTFVFGGHDTTASSLSWIFYCMAMNPEHQHQCREEIRNIIKYGDTITW (2)

AGAGTGAAAATGGAGAAGGCTTATCAAATGAAGAGCTAG

AGGCTGAGGTTAACACATTTGTGTTTGGTGGTCATGACACTACAGCCTCTAGTCTTTCCT

GGATCTTCTACTGTATGGCCATGAACCCAGAGCACCAACACCAATGTCGAGAAGAGATCA

GAAATATCATAAAATATGGGGATACCATTACCTGGT

 

(2) DHLDQMPYSTMCIKEALRLYPPSITIARELSKPITFPDGRFLPT (1)

AGGGACCACCTAGACCAG

ATGCCCTACAGCACCATGTGCATCAAGGAGGCCCTCCGCCTCTACCCACCTAGCATCACT

ATAGCCAGAGAACTTAGCAAACCCATCACCTTTCCAGATGGACGCTTCTTGCCCACAGGT

 

(1) GMTVVLNIWALHHNPTVWENPQ (0)

AGGCATGACAGTT

GTCCTGAATATCTGGGCTCTCCACCACAACCCTACTGTCTGGGAAAACCCACAGGT

 

(0) VFNPERFSQENSMKRHSYAFLPFSAGPR (2)

 

NCIGQQLAMLELKVGLALTLLRFELLPDLEKPPIPMPHLVLRSKNGIHLYLRPLH*

AGGAACTGCATTGGACAACAGCTTGCCATGTTGGAACTGAAGGTGGGACTGG

CCCTGACCCTGCTCCGTTTTGAGCTATTACCAGATCTGGAGAAGCCTCCTATTCCAATGC

CCCACTTGGTTCTCAGGTCTAAGAATGGGATTCATCTATACCTAAGGCCACTGCACTAG

 

54% to 4Z, 4X 55% to 4A11

    MGADKIPSWLETHWTRPLHLALTFVLALLLLQVVKLYLRRQG

    LLRALRLFPGPPPHWLFGNQRE (0)

(0) FYLEKELQQFNVLPEQYPCALPLWVGAFQVLLNIYDPEYAKILLNRR (1)

(1) DPKIQHGYKFIIPWI (1)

(1) GGGLLSLEGKKWYQHRHLLTPAFHLSILKPYIHVMNDSVCRML

(1) DTWEKLSTQDNSVEICEPIRLMTLDSIMKCAFSVQTSSQTES (2)

(2) FSTNYLSTVTKLSELIFCRLNNYLHHNDLIYRWSSQGQEFQALCQIAHQLP (1)

(1) AKIIQERREALKNNSEQDKIRKKKFLDFLDVLLCAK (0)

(1) SENGEGLSNEELEAEVNTFVFGGHDTTASSLSWIFYCMAMNPEHQHQCREEIRNIIKYGDTITW (2)

(2) DHLDQMPYSTMCIKEALRLYPPSITIARELSKPITFPDGRFLPT (1)

(1) GMTVVLNIWALHHNPTVWENPQ (0)

(0) VFNPERFSQENSMKRHSYAFLPFSAGPR (2)

(2) NCIGQQLAMLELKVGLALTLLRFELLPDLEKPPIPMPHLVLRSKNGIHLYLRPLH*

 

GENE 4.3 SCAFFOLD_14847 208370-233419 + STRAND, 62% to 4A11

MGTGLGLAWLPRDFSSFLQTSVLLSLVLLLLKGVQLYRRRQWLLRTFQNFPGPPAHWFNGHFWE (0)

YQKADEITVTLFWAKQFPSAFPRWFSGFTVALQVYDPEYMRILLGRP (1)

DPKADKFYRLLAPWI (1)

GKGLLILNGSTWFQHRRLLTPAFHYDILKPYVALMVDSVLVML (0)

KKWEKLITQDSSLEIFEHVSLMTLDTIMKCAFS*IHRNCQMER (2)

NADDYIQAVKEQAILVFSRVRNDLYHNDFVYWFSPQGYQARRWAHLAHNHT (1)

DQVIKKRKQHLHQEGGLEAILKKRHLDFLDILLCSK (0)

TENGDSLSDKELRAEVDTFMFEGHDTTASGISWLLYSLAMNPEHQQKCREEIRDLLGDEMAIGW (2)

EHLNRMPYTTMCIKESLRLYPPVTSISRDLSKPLTLSDGRYLPA (1)

GTIVTLHIHALHHNPSVWPEPE (0)

VFNPLRFSPENLTSRHTHSFLPFSAGTR (2)

NCIGQQFAMNEMKVAVALTLLHFHLEPDATQPPQLFPRVVLRSKNGIHLKLTRI*

 

MGTGLGLAWLPRDFSSFLQTSVLLSLVLLLLKGVQLYRRRQWLLRTFQNFPGPPAHWFNGHFWE (0)

ATGGGCACTGGCCTGGGATTAGCCTGGCTCCCCAGAGACTTCTCCAGCTT

CCTCCAGACTTCAGTGCTGCTGAGCTTAGTCCTGCTGCTGCTCAAGGGGGTCCAGCTGTA

CCGGCGCAGGCAGTGGCTTCTTAGAACCTTTCAGAACTTCCCAGGCCCTCCTGCCCACTG

GTTCAATGGACACTTCTGGGAGGT

 

YQKADEITVTLFWAKQFPSAFPRWFSGFTVALQVYDPEYMRILLGRPGEKETP

AGTATCAAAAAGCTGATGAAATAACGGTGACACTGTTCTGGG

CCAAGCAATTCCCTTCTGCCTTTCCTCGGTGGTTCTCTGGGTTCACAGTGGCCCTCCAAG

TCTATGACCCTGAATACATGAGGATTCTGCTGGGCAGACCAGGT

 

DPKADKFYRLLAPWI (1)

AGATCCCAAAGCTGATAAATTCTACAGATTATTGGCTCCCTGGATTGGT

 

KKWEKLITQDSSLEIFEHVSLMTLDTIMKCAFS*IHRNCQMER (2)

AGAAAAAATGGGAG

AAGCTCATCACCCAGGACTCGAGTCTAGAGATCTTTGAGCATGTCAGCCTGATGACACTG

GACACCATCATGAAATGTGCCTTTAGCTGAATCCATCGCAACTGCCAGATGGAGAGGT

 

NADDYIQAVKEQAILVFSRVRNDLYHNDFVYWFSPQGYQARRWAHLAHNHT (1)

AGGAATGCTGATGACTATATCCAGGCTGTGAAGGAACAGGCAATCCT

CGTATTCTCTAGAGTTCGAAATGATCTCTACCACAATGACTTCGTCTACTGGTTCAGTCC

TCAGGGCTACCAGGCCCGCCGGTGGGCCCACCTGGCCCATAACCACACAGGT

 

DQVIKKRKQHLHQEGGLEAILKKRHLDFLDILLCSK (0)

AGACCAGGTGATTAAGAAAAGGAAGCAGCACCTCCATCAG

GAAGGAGGCTTGGAGGCTATCTTGAAGAAAAGGCACTTGGATTTCCTGGACATTCTCCTC

TGTTCCAAGGT

 

TENGDSLSDKELRAEVDTFMFEGHDTTASGISWLLYSLAMNPEHQQKCREEIRDLLGDEMAIGW

AGACAGAGAATGGAGACAGCTTGTCGGACAAGGAGCTG

AGGGCTGAGGTGGACACGTTCATGTTTGAGGGTCACGATACTACAGCCAGTGGCATCTCC

TGGCTTTTATATTCTCTGGCTATGAATCCTGAACACCAGCAGAAATGCCGGGAGGAGATC

AGGGACCTCCTGGGAGATGAGATGGCTATCGGTTGGT

 

EHLNRMPYTTMCIKESLRLYPPVTSISRDLSKPLTLSDGRYLPA (1)

AGGGAGCACCTGAACCGGATGCCATATACCA

CCATGTGCATCAAGGAATCCCTCCGACTGTATCCTCCAGTGACAAGCATCTCTAGGGATC

TCAGCAAGCCCCTCACTCTCTCTGATGGCCGCTACTTGCCTGCAGGT

 

GTIVTLHIHALHHNPSVWPEPE (0)

AGGAACTATAGTCACTCTCCACATACATGCTCTT

CACCACAATCCCAGCGTATGGCCAGAACCAGAGGT  

 

VFNPLRFSPENLTSRHTHSFLPFSAGTR (2)

AGGTATTCAATCCTCTCCGGTTCTCCCCAGAGAACTTGACCTCCCGGCATACCCACTCCT

TTCCTTCCCTTTTCTGCTGGCACAAGGT

 

25256 NCIGQQFAMNEMKVAVALTLLHFHLEPDATQPPQLFPRVVLRSKNGIHLKLTRI*

AGGAATTGCATTGGGCAGCAGTTTGCCATGAATGAGATGAAAGTGGCAGTGGCTCTGACCTTGCTCCA

CTTCCACCTGGAACCTGATGCTACTCAGCCTCCACAGCTCTTCCCCAGGGTGGTCCTCAG

GTCCAAGAATGGGATCCACCTGAAGCTTACGAGAATCTGA

 

 

>Gene 4.4 SCAFFOLD_14847 295091-333237 top = 64% to 4B1 human, bottom = 78% to 4B1

295091 MFSWIPESLSRLWLWAAGLVLTLCLFQLTRLLARRQKLLQALDSFPGPPTHWLFGHSME (0) 295267

312333 IRDGELDKVLSWANTYSCAHQLWFGTFLGFLNIYDPEYIKAVLSRG (1) 312491

317333 DPKAWDVYGFFLPWI (1) 317377

320562 GKGLLVLDGPKWFQHRKLLTPAFHSEVLKPYMDLFVESTKTM (0) 320687

missing 4 exons in a sequence gap

329202 EDLGKLNYLTMCIKESFRLYPPVPQVYRQLNKPVTFMDGKSLPA (1) 329333

331159 GSLVSLHIYALHRNPAVWDKPE (0) 331224

332274 VFDPQRFSPENSSTRHPYAFVPFSAGPR (2) 332357

333070 NCIGQQFAMMEMKVVIALCLLHFEFSLEPSKPPIKRLQLVLGSKNGIYLNLKKLI* 333237

 

295091 MFSWIPESLSRLWLWAAGLVLTLCLFQLTRLLARRQKLLQALDSFPGPPTHWLFGHSME (0) 295267

ATGTTTTCCT GGATCCCTGA GAGCCTCTCC AGGTTGTGGC TGTGGGCAGC     55140

TGGCCTGGTC CTCACGCTAT GCCTGTTCCA ATTGACCAGG CTTCTGGCCA GGAGGCAGAA     55200

GCTGCTTCAA GCCCTGGATA GCTTCCCTGG GCCACCCACT CACTGGCTCT TTGGGCATTC     55260

TATGGAGGT

 

312333 IRDGELDKVLSWANTYSCAHQLWFGTFLGFLNIYDPEYIKAVLSRG (1) 312490

AGATCCGAGA TGGAGAATTG GACAAGGTTT

TGTCATGGGC CAACACTTAC TCCTGTGCAC ACCAGCTGTG GTTTGGGACT TTTCTCGGTT    

TCCTGAACAT ATATGACCCT GAATACATCA AGGCTGTGCT CAGTCGTGGA GGT

 

317333 DPKAWDVYGFFLPWI (1) 317377

317333 AGATCCCAAAGCCTGGGACGTATATGGTTTCTTCCTACCATGGATTGGT 317377

 

320562 GKGLLVLDGPKWFQHRKLLTPAFHSEVLKPYMDLFVESTKTM (0) 320687

AGGGAAGGGG TTACTGGTCT    

TGGATGGGCC CAAGTGGTTC CAGCACCGGA AACTGCTTAC TCCTGCCTTT CACTCCGAGG

TCTTGAAGCC ATACATGGAT CTGTTTGTTG AGTCTACCAA AACTATGGT

 

329202 EDLGKLNYLTMCIKESFRLYPPVPQVYRQLNKPVTFMDGKSLPA (1) 329333

AGGGAAGACCTG GGGAAGTTGA

ACTACCTTAC CATGTGCATC AAGGAGAGTT TCCGCCTATA TCCCCCGGTG CCCCAAGTAT

ACCGCCAGTT GAACAAGCCA GTTACTTTCA TGGATGGGAA GTCACTACCT GCAGGT

 

331159 GSLVSLHIYALHRNPAVWDKPE (0) 331224

AGGTAGCCTGGTG TCTCTCCACA TCTATGCACT CCATAGAAAC

     CCAGCGGTGT GGGACAAGCC TGAGGT

 

332274 VFDPQRFSPENSSTRHPYAFVPFSAGPR (2) 332357

AGGTGTTTG

ACCCTCAGCG CTTCTCTCCA GAGAACTCCT CTACTCGTCA TCCTTATGCA TTCGTGCCCT

TCTCTGCTGG GCCTAGGT

 

333070 NCIGQQFAMMEMKVVIALCLLHFEFSLEPSKPPIKRLQLVLGSKNGIYLNLKKLI* 333237

AGGA ACTGTATTGG GCAGCAGTTT GCCATGATGG AGATGAAAGT GGTCATAGCC

CTCTGTCTCC TTCACTTTGA GTTCTCCCTA GAGCCCTCCA AGCCACCTAT CAAACGGCTT

CAGCTCGTCC TGGGTTCGAA GAATGGCATC TACCTTAATC TGAAGAAGTT GATCTAG

 

>pseudogene CYP4A-like scaffold__14847

248458 KWEILSAQDLSLEIFEHQ

248510 SLMTLNSLMKCAVG

253861 QRRKWQLQQKELEAISKKRYLD 253926

258959 LGQLPFTTMYIKEALRLHPPVPSIGQDLQETISFLDGCYLTAGT 259090

262584 FHPLWFSPENLTLQHSH 262634

273863 SRKCIGQKFSINEMEVVLALILLLF*LNPDTRKLLLPISKLVLRSQNEIHLCIKRL 274030

 

Gene 4B

Query location     : 4T                  9 to     64 (+)

Database location  : contig_5893     43254 to  43421 (-)

Genomic location   : scaffold_14847 367853 to 368020 (-)

 

 

MVLSWLSIWLPVSFPRLWLWSIALVLALGLLQLTRLLARRQKLLRALDSFPGPPIHWLFGHAKE (0)

ATGGTACTCTCATGGCTCTCTATA

TGGCTCCCTGTGAGCTTCCCCAGGTTGTGGTTGTGGTCCATTGCCCTGGTCCTGGCTCTG

GGCCTTCTCCAGTTGACCCGGCTGTTGGCCAGGAGGCAGAAACTACTTCGAGCACTGGAC

AGCTTCCCTGGGCCACCTATCCATTGGCTCTTCGGGCATGCTAAAGAGGT

 

(0) IKGEGALDKIISWANTYPSAHPLWFGRFIGFLNIYDPDYAKAVYSRG (1)

AGATTAAAGGTGAAGGGGCCCTGGACAAGATAATATCAT

GGGCCAACACTTACCCCTCTGCCCATCCTTTGTGGTTTGGGAGATTTATTGGTTTTCTGA

ACATCTACGACCCTGACTACGCCAAGGCTGTATATAGCCGAGGAGGT

 

 

(1)  DPKAWDIYGFFIPWIG (1)

AGACCCTAAAGCTTGGGATATATACGGTTTCTTCATACCATGGATTGGT

 

(1) GKGLLVLEGPKWFQHRKLLTPAFHNAVLKSYVGLFAESTQDML (0)

AGGGAAAGGGCTGCTGGTCCTGGAGGGACCCAAGTGGTTCCAACAT

AGGAAACTGCTCACACCTGCCTTCCACAATGCGGTCCTGAAGTCCTATGTGGGCCTGTTT

GCAGAGTCTACACAAGACATGCTGGT

 

(0) DKWEKKVRVNKCVEIFNDVGFMALDTLMKCIFGKTSRGQTKS (2)

AGGACAAATGGGAGAAGAAGGTTCGTGTGAATAAGTGTGT

GGAGATCTTTAATGATGTGGGCTTCATGGCTCTGGACACTCTGATGAAATGCATCTTTGG

GAAGACAAGCCGTGGCCAAACCAAGAGGT

 

(2) DTDYYLAIADLTLLMQERVHAFQYHNDFLYWLTPHGRNFLRACKVAHDHT (1)

AGTGACACTGATTATTACCTGGCTATTGCTGACCTCACCCTGCTGATGCAAGAGCG

AGTCCATGCCTTCCAGTATCATAATGATTTCCTCTACTGGCTCACACCCCACGGGCGTAA

CTTTCTGAGGGCCTGCAAGGTTGCCCATGATCACACAGGT

 

(1) DKVIRERKAILKGEMLEKTQKKRHLDFLDILLGVK (0)

AGACAAAGTGATTAG

GGAAAGAAAAGCTATCCTGAAGGGAGAAATGCTGGAGAAGACCCAGAAGAAGAGACATTT

GGATTTCCTGGATATTCTCCTGGGAGTCAAGGT

 

(0) DENKIHMSDMDLRAEVDTFMFEGHDTTTSSISWFLYCMALYPEHQNRCRKEIQEILQGRDTVQW (2)

AGGATGAGAACAAGATCCACATGTCA

GACATGGACCTGCGGGCTGAAGTGGATACATTCATGTTTGAAGGCCATGACACCACCACC

AGCAGTATCTCCTGGTTCCTGTACTGCATGGCCCTCTACCCAGAGCACCAGAACCGCTGC

CGGAAGGAGATCCAGGAAATCCTACAGGGTCGGGACACTGTCCAGTGGT

 

(2) EDLGKMTYLTLCIKESFRLFPAVPQVYRQLSKPVTFADGRSLPE (1)

AGGGAAGACCTGGGGAAAATGACCTACCTCACTCTATGCATCAAAGAGAGCTTCC

GCCTGTTTCCAGCTGTACCCCAGGTATACCGTCAACTAAGCAAGCCTGTTACCTTCGCAG

ATGGGAGGTCACTACCTGAAGGT

 

(1) GSLVSLHIYALHRNRTVWTDPE (0)

AGGAAGCCTGGTTTCTTTGCACATTTA

TGCTCTTCACAGGAATCGCACTGTGTGGACTGACCCTGAGGT

 

(0) VFDPQRFTPENTSTRHPFAFLPFSAGPR (2)

AGGTATTTGACCCCCAGCGT

TTCACTCCTGAGAATACCTCAACACGTCATCCCTTTGCCTTCCTGCCCTTCTCAGCTGGG

CCCAGGT

 

(2) NCIGQQFAMMEMKVVTALCLLHFEFSPDPTQPPIKQTQLILRSKNGIHLNMNKL

KMNTRAPSQGPRENMEQLVGEA*

AGGAACTGCATTGGGCAGCAGTTTGCCATGATGGAGATGAAGGTGGTC

ACAGCCCTCTGCCTGCTCCACTTTGAGTTCTCCCCAGACCCCACTCAGCCACCCATCAAG

CAAACACAACTGATTCTGCGTTCCAAGAATGGCATTCACCTCAACATGAATAAACTAAAG

ATGAACACTAGAGCTCCTTCCCAGGGCCCCAGGGAAAATATGGAGCAATTGGTTGGTGAAGCATAG

 

73% TO 4B1, 4B subfamily already in marsupials

    MVLSWLSIWLPVSFPRLWLWSIALVLALGLLQLTRLLARRQKLLRALDSFPGPPIHWLFGHAKE (0)

(0) IKGEGALDKIISWANTYPSAHPLWFGRFIGFLNIYDPDYAKAVYSRG (1)

(1) DPKAWDIYGFFIPWIG (1)

(1) GKGLLVLEGPKWFQHRKLLTPAFHNAVLKSYVGLFAESTQDML (0)

(0) DKWEKKVRVNKCVEIFNDVGFMALDTLMKCIFGKTSRGQTKS (2)

(2) DTDYYLAIADLTLLMQERVHAFQYHNDFLYWLTPHGRNFLRACKVAHDHT (1)

(1) DKVIRERKAILKGEMLEKTQKKRHLDFLDILLGVK (0)

(0) DENKIHMSDMDLRAEVDTFMFEGHDTTTSSISWFLYCMALYPEHQNRCRKEIQEILQGRDTVQW (2)

(2) EDLGKMTYLTLCIKESFRLFPAVPQVYRQLSKPVTFADGRSLPE (1)

(1) GSLVSLHIYALHRNRTVWTDPE (0)

(0) VFDPQRFTPENTSTRHPFAFLPFSAGPR (2)

(2) NCIGQQFAMMEMKVVTALCLLHFEFSPDPTQPPIKQTQLILRSKNGIHLNMNKL

    KMNTRAPSQGPRENMEQLVGEA*

 

>53% to 4Z1 Built_from_Q8WWU9_and_others have it already

32055 - 80620 bp (32.1 Kb) on chromosome fragment scaffold_1650

This transcript is located in sequence: contig_55667

IPSWLETHWTRPLHLALTFVLALLLLQVVKLYLRRQGLLRALRLFPGPPPHWLFGNQREF

 YLEKELQQFNVLPEQYPCALPLWVGAFQVLLNIYDPEYAKILLNRRGGGLLSLEGKKWYQ

 HRHLLTPAFHLSILKPYIHVMNDSVCRMLDTWEKLSTQDNSVEICEPIRLMTLDSIMKCA

 FSVQTSSQTESFSTNYLSTVTKLSELIFCRLNNYLHHNDLIYRWSSQGQEFQALCQIAHQ

 LPAKIIQERREALKNNSEQDKIRKKKFLDFLDVLLCAKSENGEGLSNEELEAEVNTFVFG

 GHDTTASSLSWIFYCMAMNPEHQHQCREEIRNIIKYGDTITWDHLDQMPYSTMCIKEALR

 LYPPSITIARELSKPITFPDGRFLPTGMTVVLNIWALHHNPTVWENPQVFNPERFSQENS

 MKRHSYAFLPFSAGPRNCIGQQLAMLELKVGLALTLLRFELLPDLEKPPIPMPHLVLRSK

 NGIHLYLRPL

 

>Built_from_P24464_and_others have it already

329201 - 333231 bp (329.2 Kb) on chromosome fragment scaffold_14847

This transcript is located in sequence: contig_5893

EDLGKLNYLTMCIKESFRLYPPVPQVYRQLNKPVTFMDGKSLPAGSLVSLHIYALHRNPA

 VWDKPEVFDPQRFSPENSSTRHPYAFVPFSAGPRNCIGQQFAMMEMKVVIALCLLHFEFS

 LEPSKPPIKRLQLVLGSKNGIYLNLKKL

 

>Built_from_P24464_and_others have it already

208397 - 233419 bp (208.4 Kb) on chromosome fragment scaffold_14847

This transcript is located in sequence: contig_5894 LPRDFSSFLQTSVLLSLVLLLLKGVQLYRRRQWLLRTFQNFPGPPAHWFNGHFWEYQKAD

 EITVTLFWAKQFPSAFPRWFSGFTVALQVYDPEYMRILLGRPDPKADKFYRLLAPWIGKG

 LLILNGSTWFQHRRLLTPAFHYDILKPYVALMVDSVLVMLKKWEKLITQDSSLEIFEHVS

 LMTLDTIMKCAFSESIATARWRGLLLLYRNADDYIQAVKEQAILVFSRVRNDLYHNDFVY

 WFSPQGYQARRWAHLAHNHTDQVIKKRKQHLHQEGGLEAILKKRHLDFLDILLCSKTENG

 DSLSDKELRAEVDTFMFEGHDTTASGISWLLYSLAMNPEHQQKCREEIRDLLGDEMAIGW

 EHLNRMPYTTMCIKESLRLYPPVTSISRDLSKPLTLSDGRYLPAGTIVTLHIHALHHNPS

 VWPEPEVFNPLRFSPENLTSRHTHSFLPFSAGTRNCIGQQFAMNEMKVAVALTLLHFHLE

 PDATQPPQLFPRVVLRSKNGIHLKLTRI

 

>Built_from_P15129_and_others have it already

343484 - 368020 bp (343.5 Kb) on chromosome fragment scaffold_14847

This transcript is located in sequence: contig_5893

WLPVSFPRLWLWSIALVLALGLLQLTRLLARRQKLLRALDSFPGPPIHWLFGHAKEIKGE

 GALDKIISWANTYPSAHPLWFGRFIGFLNIYDPDYAKAVYSRGGKGLLVLEGPKWFQHRK

 LLTPAFHNAVLKSYVGLFAESTQDMLDKWEKKVRVNKCVEIFNDVGFMALDTLMKCIFGK

 TSRGQTKSDTDYYLAIADLTLLMQERVHAFQYHNDFLYWLTPHGRNFLRACKVAHDHTDK

 VIRERKAILKGEMLEKTQKKRHLDFLDILLGVKDENKIHMSDMDLRAEVDTFMFEGHDTT

 TSSISWFLYCMALYPEHQNRCRKEIQEILQGRDTVQWEDLGKMTYLTLCIKESFRLFPAV

 PQVYRQLSKPVTFADGRSLPEGSLVSLHIYALHRNRTVWTDPEVFDPQRFTPENTSTRHP

 FAFLPFSAGPRNCIGQQFAMMEMKVVTALCLLHFEFSPDPTQPPIKQTQLILRSKNGIHL

 NMNKL

 

Peptide hits for CYP4F last exon of 4F28

These are as assembled from the browser.

 

>67% to 4F11 Built_from_P98187_and_others cyan = insertion

missing 19 aa

2805728 - 2917035 bp (2.8 Mb) on chromosome fragment scaffold_11661

This transcript is located in sequence: contig_101126

LLVFLAISTWVLSRVITSVHRYYINCQRLRCFPQPPLQNWFLGHLRLIDSNEEGLIRTVQ

 LVNTFREIFLMWMGPFHPLVILCHPDYIRPLTSASANIAPKDKIFYGFLEPWLGDGLLLS

 KGDKWSHHRRLLTPAFHFDILKSYVKIFNQSTNIMHEKWKHLCAGSSTHLDMFEHISLMT

 LDSLQKCIFSYDSGCQNHNSNCQEKPSKYISTILELSVLSTKRSNQFFLYWDSVYYLTSQ

 GRRFTQACHLVHDFTDAVIKARQKVLAEQGVEAFLKDKGKGKTMDFIDILLLSKDEDGKP

 LSDKDIRAEADTFMFEGHDTTASGISWVLYNLAQHQEYQDRCRQEIQELMKGRETEEIEW

 NDLSQMPFLTMCIKESLRLHPPVPITFRQCTKDIQLPDSRVIPKGSVCLISIFGTHHNPT

 VWPNPEVYDPYRFDTNNPQKMSPLAFMPFSAGPRNCIGQNFAMSEMKVVLALTLLRFRVF

 PHGNPPRRKLELVLRTESGLWLKVEPVQHS

 

>64% to 4F3 Built_from_Q99N18_and_others

662774 - 710908 bp (662.8 Kb) on chromosome fragment scaffold_15213

This transcript is located in sequence: contig_8153

LGLLGLEPKVSSALLLIFLAFSTWILGKGLICIHQFRTNCQWLRCFPEPPEWHWLNGHAG

 VIKPSEEGIKRVLQFVAAFREVFVMWGGPFFPIVFICHPDYIKPLLSASANIAPKDKLFY

 GFFEPWLGDGLLLSSGDKWSRHRRLLTPAFHFDILKPYVKFFNQSTDIMHMKWRHLCVGD

 NVRLNIFEHISLMTLDSLQKCVFSHDSHCQEKPSSYISAILELSALVSRRNNQPLLYWNS

 LYYLTSQGRHFSRACNAVHVFTDDVIQNRRRVLAEQGSEAFLRNKRKGKTLDFIDVLLLA

 KDEDGKALSDEDIRAEADTFMFEGHDTTASGLSWALYNLSQHQEYQDRCRQEIQELLKGR

 QLEEIEWDDLSQMPFLTMCIKESLRLHPPVVAIARRCTKDIKLPDGRIIPKG

23aa Gap here

DPNRFDPN

 NTQISPLAFLPFSAGPRNCIGQNFAMAELKVALALTLLRFRILPDEHPPRRKPEVILRSE

 DGLWLRVEPL

 

>81% to 4F22 complete Built_from_Q766Z2_and_others

567537 - 603959 bp (567.5 Kb) on chromosome fragment scaffold_15213

This transcript is located in sequence: contig_78837

MVPITDQILKVLRLEKTSFRTYAISALLLSLLFIFFRFLVKVFQICHKFHITCQRLRCFP

 QPPGRNWLLGHLGMYLPNESGLRDEMKVLDTLRHVVLVWIGPFLPLVVLVHPDYIKPLLG

 ASAAIAPKDKLFYGFLTPWLGDGLLLSKGEKWSRHRRLLTPAFHFDILKPYMKIYNQCTD

 IMHAKWHRLTAGATASLDMFEHVSLLTLDSLQKCVFSYNSDCQEKNSDYITAIIELSALV

 VKRQYRIHHHLDFIYYRTADGRRFKKACDIVHRFTTEVIQERRQALNQQGAEAWLKSKQG

 KTLDFIDVLLLAQDEDGKQLSDEDIRAEADTFMFEGHDTTSSGLSWVLFNLARYPEYQDK

 CREEIQEIMKGRETDEIEWDDLAQMPFITMCIKESLRLFPPVTLISRRCTEDIKMPDGRV

 IPKGIICLVSIYGTHYNPSVWPDSKVFNPYRFDPENSQQRSPLAFIPFSAGPRNCIGQSF

 AMSEMKVVVALTLLRFRLSVDRTKKVRRKPELILRTENGIWLNVEPL

 

>66% to 4F3 Built_from_Q8BGU0_and_others

2704269 - 2734206 bp (2.7 Mb) on chromosome fragment scaffold_11661

This transcript is located in sequence: contig_103311

ILILAGLTLSTWILVQGLAWAHRYYINCQRLRCFPGPPCQNWFLGHLGMIHSSEEGLLYN

 QKLVCTFRDVCCLWIGPWCPVIRIFHPSYIKPVLLASAFILPKDDFFYSFLEPWLGNGLL

 LSKGDKWSQHRRLLTPAFHFGILKSYVKIFSQGADIMHAKWRRLCAEGNTRLDMFEHVSL

 MTLDSLQKCIFSYDSNCQEKPSAYISAILELSSLVTKRFQKPLLFWDALYSLTSEGRCFS

 RACRLVHHFSEAVIQDRRQILTKQGTESFLREKGKRKTMDFIDILLLAKDKDGKTLSNKD

 IQAEADTFMFGGHDTTASGISWALYNLAQHPEHQNRCRQEIEELLKGRQPEEIEWDDLAN

 MPFLTMCIKESLRIHPPVPMVSRYCTKDIQLPDGRVIPKG

19aa Gap here

SLVYNPYRFDTNNAEKIPPL

 AFIPFSAGPRNCIGQNFALYEMKVVLALTLLRFRVFPDDHPVRRKSELILRADNGLWLKL

 EPV

 

>65% to 4F11 Built_from_P98187_and_others missing 27aa at N-term

2895926 - 2917011 bp (2.9 Mb) on chromosome fragment scaffold_11661

This transcript is located in sequence: contig_107464

LALSTWILAQVLFFLNRYYTNIQQLRCFPQPLIWNWFFGHLGLVSGDKKSLIRIIDYVST

 FREVFLMWMGPFRPVIVLCHSDYIRPLTSASAHIAPKDNFIYGFLKPWLGDGLLLSGGDK

 WSRHRRLLTPAFHFDILKPYVKIFNQRPAPYFLSLAQEKWKRLCAEESTQLDVFDHVSLM

 TLDTLQKCIFSHNSNCQEKPSKYISTILELSVLSTKRSNQFFLYWDSVYYLTSQGRRFTQ

 ACHLVHDFTDAVIKARQKVLAEQGVEAFLKDKGKGKTMDFIDILLLSKDEDGKPLSDKDI

 RAEADTFMFEGHDTTASGISWVLYNLAQHQEYQDRCRQEIQELMKGRETEEIEWNDLSQM

 PFLTMCIKESLRLHPPVPITFRQCTKDIQLPDSRVIPKGSVCLISIFGTHHNPTVWPNPE

 VYDPYRFDTNNPQKMSPLAFMPFSAGPRNCIGQNFAMSEMKVVLALTLLRFRVFPHGNPP

 RRKLELVLRTESGLWL

 

>71% to 4V2 complete Built_from_Q6ZTM4_and_others

7805523 - 7835925 bp (7.8 Mb) on chromosome fragment scaffold_15156

This transcript is located in sequence: contig_10445

MWLVPVGQKVLYWGVTGAITLLGTVLTLILLQMLVAYVRKWQQMKTIPAFPYALPLVGHS

 LLMKSNSRDFFEQLIRYSEEFRKEPLLKLWIGPVPIVTLYHADNVEVLLSSSRQIDKSYF

 YKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEEFLDVMNEQANVLVNKLEKHVDQ

 EAFNCFMDITLCALDIICETAMGKNIGAQVNGDSEYVRSVFRMTNIIIRRMKMPWLWLDL

 WFLMFKEGWEHRKRLKILHDFTDKVISERVKKMKENEEQKEDDLKPKTIKRRAFLDLLLN

 TTDEDGNALSHQDIREEVDTFMFEGHDTTASAMNWVIYLLGSHPEAQRKVDNELDEVFGN

 SDRPVTVDDLKKLKYLDCVIKESLRLFPSVPFFARTLNSDCFIAGYKVPKDTEAIVFSYA

 LHRDPKHFPDPEDFQPERFFPENSHGRHPYAYVPFSAGPRNCIGQKFAVMEEKTVISWVL

 RRYWVESIQKREELGLMGELILRPHDGIWIKLKKR

 

>70% to CYP5A1 Built_from_P24557_and_others grey may be wrong

17976498 - 18229621 bp (18.0 Mb) on chromosome fragment scaffold_13486

This transcript is located in sequence: contig_89360

MEFLKFFNLEVNGTMVTMALVLVLLVLLKWYSTSAFSSLERVGIRHPKPLPFIGNLTFFR

 QGFWESHMELIKTYGPLCGYYLGRRMYIVVYEPQMIKEVLVKNFGNFTNRMVCGLETKPI

 ADSILFLRNKRWEEVRSTLTPAFSPKKLDEVIPLISQACDLLLTHLKPYAESGEAFDIQR

 SYGCFTLDVVASVAFGFQVDSQKRPEHPFVKHCRRFFQFSIPKCVLILIFAFPSIMIPLS

 RVLPNKNRDELSAFFNNVIRNMITLRDKQAEEERRRDFLQILLDARGAPSS

9aa gap here

AEVSQSAQNGDSSIPQATSRVLQKT

LTTDEIVGQAFIFLIAGYETITNTLSFVTYLLATNSECQEKLLR

 EVDEFSERNAVPKFCTLEEELPYLDMVIAETLRMYPPAFRFTRETEKDCDVMGLHIPAGA

 IVEMAVGYLHHNPEYWPNPETFIPERFSLEARQQHLPFTYLPFGAGPRSCIGVKMAMLEM

 KLTLLRLLQKFKFEICPETQVPLQLKSRSALGPQNGVYIKIVSR

 

>78% to 7A1 Built_from_O46491_and_others complete

10089797 - 10099680 bp (10.1 Mb) on chromosome fragment scaffold_18689

This transcript is located in sequence: contig_42756MLTISLIWGIVVAICCCLWLITGIRRRRMGEPPLENGLIPYVGCALQFGANPLEFLRINK

 RKYGHIFTCKLMGKYVHFITNPFSYTTVMRHGKYFDSKKFNLAASAKAFGHRSIDPSDGN

 TTENVHETFIRTLQGDALNSLSEAMMENLQYVMRPPGLSKTNPDSWVTEGMYSFCNKVMF

 EAGYLTLFGKDLTRQEAQRTSILNNLDNFKQFDKIFPALVAGLPIHVFKNAHNAREKLAE

 DLKHENLQKRDNISELITTRMFLNDTLSTFDDMEKAKTHLALLWAAQANTLPATFWCLFH

 TIRSSEAMKMATEEVRKTLEKSGQKISFEGKPISLSQMQLNDMPVLDSIIKEALRLSSAS

 LNIRPAKEDFTLHLEEGSYNIRKDDIIAIYPQLLHLDPEIYPDPLTFKYDRYLDENGKPK

 NSFYCNGIKLKYYYMPFGWGLTMCPGRLFAVSEIKQFLILMLSYFEMQLVDSQVKCPPLD

 QSRVGLGILPPTNDIEFKYRLKYL

 

>52% to 7B1 missing N-term Built_from_Q76CE9_and_others

2305089 - 2377662 bp (2.3 Mb) on chromosome fragment scaffold_13290

This transcript is located in sequence: contig_69395

RRPGEPPLINGWIPFFGVAFQMKTDPFKKLKEYQKKYGDFFTLYINGKYFTFVLDPFQYP

 LVLKNHKQFDFFKFSNEIIHKVFTVSYRAQVMEKMKENYKYLQSKLLEKTVYNLMQNLQH

 VIKKQLLQTKNWEMSQLFKFCKSIMFEATYVTLYGKDPSPNSDEVIPELLEHFDKFDNEF

 LNFLFPIPTLSLRAAKISREKLIQNFSSEHMYKMLETSEIIRSRRNCLEKFTELPDHEKG

 AHHLVFLWASVANTIPTTFWTVYYLLQHPEAVAVLREEINHLLQSTGQKKEPDFNVQFTR

 EQLDSLVYLDSIIFEALRMISASANLRVNEEDFTLSTDKGEINLRKGDSIIIYPPMLHFD

 PEVFEQPEEFKFDRFVKDGKKKTTFFKRGQELPYCLMSFGSGITKCPGRFFAVFEIKQLL

 ILLFMFFDMELIEKEPLQFRKSRMFFGIQCPQSDVSFRYKLRC

 

>68%to 8A1  Built_from_Q6LEN0_and_others

6710216 - 6762832 bp (6.7 Mb) on chromosome fragment scaffold_15081

This transcript is located in sequence: contig_27741

MPWFFVAALLAALLLLLLLSRRRMRRPGEPPLDLGLIPWLGHASEFGKDAARFLSRM

EGKHGDIFTVLVAGRFVTVLLDPHSYDTVVWESSSKLDFHKYAIFLMEKIFDVQLANYNP

SMEKAKIKPTLLHKNLHALTEAMFNNLCNILLRDAGDIGKDWKETGLFQFSYNVMLRAGY

LTLYGTEGDDPVSQAQDRTHSEEVFQSFRQLDQLLMKLARSSLSAEEKKEASHIKARLWK

LLSPQGLMGRAHRSAWLDSYHQYLQDLGAAEEKQARAMLLQLWSTQGNAGPAAFWLLTFL

LKTPTALAAVLGELESTLQKEGQVLTQMASIPQGVLDNMPIFDSVLSESLRLTAAPFITR

EVLEDLVLPLADGREYSLRQGDRLLLFPFLSPQKDPEIYEDPEVFKYNRFLNQDGSEKRD

FYKGGKRLKNYNLPWGAGTNMCLGRSHAISSIKQFVIILLMQFDLKLKNPEEKIPSFDTS

RYGFGLMQPEHDITICYRFKP

 

>47% to 8B1 Built_from_Q8BFR7_and_others missing first 24 aa

783683 - 785131 bp (783.7 Kb) on chromosome fragment scaffold_16987

This transcript is located in sequence: contig_80802

LRQRKAREPPLDKGPIPWLGYSKEFSKDASIFLKKMQERHGDIFTVQLCGRYVTFVTDPF

 TYDAILKESKDKLGFSNLVSEKVIKIFDIQYEEGHQKISSNIHTKHLSASSLVVITQAVM

 DNLQTLLLEPDGGIRPASQEWKQDGLLEYCYSVIFRAGYLALFGSFPTSGKTGRIQDLLH

 SQKVFQEFRKFDRLFPRAFYSILHPKEKQEMKRLRHFFWDILSSQQILEKDNVSSWIHSI

 QQEMIENGVSDKGQSQNNLVLLWASQGSTTGVNFWTLFFLLKNPEALKAVREEAEGILRK

 MGKEKRPGGVPINFDYNMLKQTPVLDSVMEETLRLVVAPFLARSVMQDMTLKMDDGREYA

 LRKGDEVCVFPYLFLHMDPEIHSDPTTFKYDRFLTLDGSQKVVFYKQGRRIKSHMLPWGA

 GTTLCPGRFLALNQIKMFIFLMVTQYDMELVDQEAGIPPINVKRWGMGPLQPMYDVQFRY

 RLR

 

>56% to 11A1 Built_from_P05108_and_others

129928 - 158404 bp (129.9 Kb) on chromosome fragment scaffold_19296

This transcript is located in sequence: contig_28033

MLLARGVSHQSALAKSRHCLFGSPREDVWKSDVRRVQLQARGGDLHGFPVQARRPRPFSE

 VPTNGSNGWINLVRFWMEKEMHNIHFRNVRNFQQLGPIYREKLGNLESVFIINPEDAARL

 FKAEGSYPERYNIPPWTAYHLYMKKPLGILLKSSESWKKDRSFLNHLMLTADSVNNFEPL

 ISPVTQDFVKIIYKGIERSGEGKFTVNLNQDLFGFAFETICNIIFGERQGVLDELVDSEA

 QKFIDAVSTMFNTSVPMLNIPPELFRMVKAKVWRDHVASWDTIFNRAEDYVQSFYHEQKK

 RKELENYPGLLPCLLRKNTMDFESIKGNITELMAGGVDTTSMTIQWCMYEMARNIKVQDM

 LRAEVQTARRDTQGDIKKMYKAVPLLRAAIKETLRQLHPIAVTIQRYLPSDLVLQDYTIP

 AKTLVQVGLFAMGRDPNFFPNPEKFDPRRWLHEDTYFRALSFGFGPRQCIGRRIAELEMT

 IFLIHILENFKIEIHKFTDVGTTFNLILMPDKPIIFTFRPLKPQ

 

>CYP11B

Database location  : contig_82491  5602 to 5739 (+)

Genomic location   : scaffold_1920 5602 to 5739 (+)

5602 PQYSGIMAQLMAKAELSLESIKANMLELTAGSVDTVKAQLGSIITL 5739

Database location  : contig_82491  13191 to 13676 (+)

Genomic location   : scaffold_1920 13191 to 13676 (+)

62% to 11B

13191 TSFPMMTTLFELARNQDLQNALRKESLEVEAHLEENPAKLIKELPLLRAAIKETLR 13358

Database location  : contig_82491  15249 to 15464 (+)

Genomic location   : scaffold_1920 15249 to 15464 (+)

15249 TLVQIFLYSMGRSPEVFPQPECYDPSRWLISNTDQENNQISNFRYLVFGFGIRQCIGRR 15425

15426 LAEAEMILFLHHV 15464

GENSCAN00000091904 pep:Genscan scaffold:BROAD0.5:scaffold_1920:520:16237:1

missing the first 79 aa (exon 1) in a seq gap 52% to CYP11B

REKVGTLSTVNVHLPQDAEKVLRAEGPLPQRM

ATMPWIVHRRTRNHKCGIFLLNGKEWLNDRIKMNQDVLSPSGADHFIPLLNTICQDFVQY

LDVRIRRNVRQSFTFNLRPYVYRFTLEASVYALYGERLGLLKSSPNPDGLRFIQAINSMI

SSTSLLLYTPVNLSRLMYSKMWEKHFEAWDYIFQFADKCIQKIYQEMCLNGSPQYSGIMA

QLMAKAELSLESIKANMLELTAGSVDTTSFPMMTTLFELARNQDLQNALRKESLEVEAHL

EENPAKLIKELPLLRAAIKETLRLYPVGLILHRYLDRDTILQNYRVPAGTLVQIFLYSMG

RSPEVFPQPECYDPSRWLISNTDQENNQISNFRYLVFGFGIRQCIGRRLAEAEMILFLHH

VLKNFQVETLCKDDLNLSFHFVLQPKSYPLFTFSVLN

 

>missing piece from 11B1 human

MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRR

PGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFR (2)

 

>51% to CYP17 some variation in middle Built_from_Q6P200_and_others

2062265 - 2070997 bp (2.1 Mb) on chromosome fragment scaffold_14992

This transcript is located in sequence: contig_2255

MWWFLTISLLTLLYYIWQKQGSMGKKYLICMPHLPILGSLPYMNFHDPAHVYFTKLKEKY

 GNTFAFWMGPQYSVVVNHFSAAKEVLLKKGKDFASRPRMVTTDILSGSGKGIAFSEYGPQ

 WRMYRKLVQSSFSLLKDGSQKLEKLICQEANTLCKSLAAAQGKIQDPATDIFLAPNVICQ

 FCFSSSWNKDDEDFEIMMDYSNNILKTLKDSLVDIFPWIQARAIGPCPAVEKRKVLLIHF

 PLPSSQEKFNIDSVNNLLDALLKAKLDSDNPLVQEPEITDEHILMTVGDIFGAGVETTST

 VVRWCIAFLLHHPQVKEEIQKEIDQKIGFGRTPVLSDRNQLLHLESTIREVLRIRPVAPL

 LIPHMAWTDTSIGEYTIPKGTRIYINLWSIHHDPTQWNEPERFMPERFLDKNKDQLIIPN

 ASYFPFGSGPRVCVGEFLARSELFLFLAWILQRFDLEVPDDGELPSLDGLSGVVFQIIPF

 KLKVKLRKGWREAE

 

>82% to CYP19 complete Built_from_P46194_and_others

4181715 - 4207649 bp (4.2 Mb) on chromosome fragment scaffold_14961

This transcript is located in sequence: contig_68940

MILEMLNPMHYNLTGMVPEAMPAATMPILLLTCFLLLVWSYEDTSLIPGPGYCMGIGPLL

 SHGRFLWMGIGSACNYYNKMYGEFMRVWICGEETLIISKSSSMFHIMKHSHYISRFGSKL

 GLQCIGMHENGVIFNNNPALWKAIRPFFTKALSGPGLVRMVAVCVNSTVIHLDKLEDVTN

 ELGYVNVLNLMRRIMLDTSNVLFLGIPLDENAIVVKIQSYFDAWQALLLKPDIFFKISWL

 YKKYEKSVKDLKDALEILIEEKRHRLSTDDKLEDCMDFASQLIFAQGRGDLTGENVNQCI

 LEMLIAAPDTLSVTVYFMLLLIAKHPKVEEAVMKEIQTVIGERDIKIGDVQKLKVVESFI

 YESMRYQPVVDLVMRKALQDDVIDGYPVKRGTNIILNIGRMHRLEFFPKPNEFTLENFAK

 NVPHRYFQPFGFGPRGCAGKYIAMVMMKVILVTVLRRFHVQTLTGCCLERIQKKNDLSLH

 PDETRDFLEMIFIPRNTEKCQEQ

 

>CYP20 complete 80% to human Built_from_Q8WZ13_and_others

Database location  : contig_79650    42111 to  42182 (-)

Genomic location   : scaffold_14968 948199 to 948270 (-)

42182 MLDFAIFAVTFLLVLVGAVLYLYP 42111

Database location  : contig_79650    35306 to  35356 (-)

Genomic location   : scaffold_14968 941394 to 941444 (-)

35356 ASRQASGIPGITPTEEK 35306

Database location  : contig_79650    32360 to  32524 (-)

Genomic location   : scaffold_14968 938448 to 938612 (-)

32524 DGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTMDALRQHINPNRT 32360

Database location  : contig_79650    30506 to  30646 (-)

Genomic location   : scaffold_14968 936594 to 936734 (-)

30649 HPFETMLKSLLRYQSGLDGDAVENHIRKKLYENGVNKSLQSNFAFMVK (0) 30506

Database location  : contig_79650    12008 to  12175 (-)

Genomic location   : scaffold_14968 918096 to 918263 (-)

12175 LSEELLGKWLSYPESQHVPLCQHMLGYAMKAVTQIAMGNSFEDDQKVIHFQKNHNT 12008

Database location  : contig_79650     1776 to   1853 (-)

Genomic location   : scaffold_14968 907864 to 907941 (-)

1853 VWSEIGKGFLDGSLDKSTTRKKQYEE 1776

Database location  : contig_33922    15048 to  15164 (-)

Genomic location   : scaffold_14968 905386 to 905502 (-)

15164 ALMEIETVFKKVIKERRGRNFSQHIFIDSLLQGNLNEKQ (0) 15048

Database location  : contig_33922    10672 to  10722 (-)

Genomic location   : scaffold_14968 901010 to 901060 (-)

10722 ILEDSMIFSLAGCVITAN 10669

872403 - 901045 bp (872.4 Kb) on chromosome fragment scaffold_14968

This transcript is located in sequence: contig_33922

LCMWAVYFLTTSEDVQKKLHKELDQVLGKGPITQEKIDQLRYCRQVL

CETVRTAKLTPIAAKLQDLEGKVDQHIIPRETLVLYALGVVLQDHCAWPSPYKFDPDRFN

DESAMKNLSLLGFSGTQECPELRFAYMVATVLLSVLVRKLYLHPLEGQVIETKYELVTSS

KEEAWITVSKR

 

42182 MLDFAIFAVTFLLVLVGAVLYLYP (0) 42111

35356 ASRQASGIPGITPTEEK (2) 35306

32524 DGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTMDALRQHINPNRT (1) 32360

30652 SHPFETMLKSLLRYQSGLDGDAVENHIRKKLYENGVNKSLQSNFAFMVK (0) 30506

12175 LSEELLGKWLSYPESQHVPLCQHMLGYAMKAVTQIAMGNSFEDDQKVIHFQKNHNT 12008

1853  VWSEIGKGFLDGSLDKSTTRKKQYEE 1776

15164 ALMEIETVFKKVIKERRGRNFSQHIFIDSLLQGNLNEKQ (0) 15048

10722 ILEDSMIFSLAGCVITAN 10669

      LCMWAVYFLTTSEDVQKKLHKELDQVLGKGPITQEKIDQLR

      YCRQVLCETVRTAKLTPIAAKLQDLEGKVDQHIIPRE

      TLVLYALGVVLQDHCAWPSPYK

      FDPDRFNDESAMKNLSLLGFSGTQECPELR

      FAYMVATVLLSVLVRKLYLHPLEGQVIETKYELVTSSKEEAWITVSKR*

 

>54% to CYP21 Built_from_Q16741_and_others

661804 - 666034 bp (661.8 Kb) on chromosome fragment scaffold_16657

This transcript is located in sequence: contig_90421

MLLSVVLLLVLLATLHWLWMRRTISPYHFPPLVPGFFHLFQADLPSHLQSLAQRYGPLYR

 VHLGMQDVVVLNSKKAIEEALTKNWLDFSGRPQTFTNQEVSKNSHDLSLGDYTPLWKAQR

 KLARSALLYVQNTMEPIIGQMVQDLCKRLLAQAGSPVPIHKELSMFTGSIISFLSFGEKV

 CSSELFSSESVIQQFYSCIQELMVVWDSWQIQILDVLPILRVFPNSGLRKLRRLVKKRDR

 IVQEQLSRHKETMVEGQIRDLTDYMLQKLREQAEGSNRLSEEHVHMALVDIFIGGMETMS

 STLTWALAFLLHHPEIQRRLQEELDEELDSGSPGSLPNYRDRDRFPLLNATITEVLRLRP

 AAPLALPHYTRQPSTICGFDIPKNTIVIPNIYGAHHDDRIWEQPYDFRPDRFLESEPSQA

 GIPFSCGVRVCLGETMARFELFLILAQLLWTFKLLPVEGNASLPSLKPEFGAFMLKAPNF

 LVRLLPR

 

>78% to 24A1 Built_from_Q07973_and_others complete

1174349 - 1194096 bp (1.2 Mb) on chromosome fragment scaffold_15081

This transcript is located in sequence: contig_75336

MSSPIRKSPYVAAFMKQIRGLRQPPRPVTSSVCGPQPPEAPPICPLMVPSEVQSASALPG

 PTNWPLLGSLLEILWKGGLKKQHHTLAEYHKKFGKIFRMRLGSFDSVHLGSPCLLEALYR

 KESMYPQRLEIKPWKAYRDYRQEGYGLLILEGKDWQRVRSAFQKKLMKPTEIMKLDDKIN

 EVLADFMQRIDDLCNEDGQIEDLYSELNKWSFESICLVLYEKRFGLLQNNASEDALNFIT

 SIKTMMSTFGRMMVTPVELHKTLNTKVWQMHTQAWDNIFKAVKSCVNNRLEKHLENPSED

 FLCDIYHHNQLSKKELYAAVTELQLGAVETTANSLLWVLYNLSRNPRVQKKLLEEIERIL

 PDHRSPNAEDLKNLPYLKACLKESMRLTPSVPFTTRTLDQETVLGDYALPKGTVLMLNTQ

 FLGSNEENFEDWSQYRPERWLQEKKKIHPFAHLPFGIGKRMCIGRRLAELHLHLALCWIV

 RKYNIVAIDDEPVEMLHLGLLVPNRELPIAFLAR

 

>86% to 26A1 complete Built_from_Q6V0L0_and_others

3712218 - 3715824 bp (3.7 Mb) on chromosome fragment scaffold_13599

This transcript is located in sequence: contig_70228

MGFSALLASALCTFVLPLLLFLAAVKLWDLYCLSTRDHSCSLPLPPGTMGLPFFGETLQM

 VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRQILLGEHRLVSVHWPASVRTIL

 GSGCLSNLHDSLHKKRKKLIMQAFNREALQCYVPVIAEEIKNALERWLQCGDSGLLVYPE

 VKRLMFRIAMRILLGCESGSATDGDSERELVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR

 NLIHARIEKNICAKLGGQREPEAGGWRVKDVLQLLIEHTQENGERLDMQELKQSATELLF

 GGHETTASAATSLITYLGLHHHVLQKVREELKTKGLLCKSSHDEKLDIDILEQLKYIGCV

 IKETLRLNPPVPGGFRIALKTFELNGYQIPKGWNVIYSICDTHDVADIFTNKEEFNPDRF

 LLPYPEDSSRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPT

 VYPVDNLPTKFMHFKGEM

 

>92% to 26B1 complete Built_from_Q6NY30_and_others

8913 - 28856 bp (8.9 Kb) on chromosome fragment scaffold_14649

This transcript is located in sequence: contig_42450

MLFEGFDLVSALATFAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG

 ETGHWLLQGSCFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRS

 TRMLLGPNSVANSIGDIHRNKRKVFSRIFSHEALETYLPKIQLVIQDTLRAWSSNPDAIN

 VYQEAQKLTFRMAIRVLLGFSIPEEDLSQLFEVFQQFVENVFSPQKCDLPFSGYRQGQAR

 HTLQKGLEKAIREKLQSTQGKDYSDALDILIESSKEHGKEMTMQELKDGTLELIFAAYAT

 TASASTSLIMQLLKHPNVLEKLREELRANGILHNGCVCEGSLRLDTLIGLHYLDCVIKEV

 MRLFTPVSGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVDVFDPERFSQAR

 SEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELASRTFPRITLVPVLH

 PVDGLSVKFFGLDSNQNKILTETEAMLGAAV

 

>74% to 26C1 Built_from_Q6V0L0_and_others complete

3693033 - 3704934 bp (3.7 Mb) on chromosome fragment scaffold_13599

This transcript is located in sequence: contig_70228

MFPLGMSSLSVAEAALTILLSLGLLLSVAQHLWTLRWTLSRDRACALPLPKGSMGWPFFG

 ETLHWLVQGSRFHSSRRERYGTVFKTHLLGKPLIRVSGAQNVRTLLLGEHRLVSSQWPQS

 ARILLGSHTLLGAVGEPHRQRRKILARVFSHAALESYMPRIQATLRRELWTWCGVPGPVS

 VYSATKALTFRIAARILLGLRLEESECNELAKTFEQLMENLFSLPLDVPFSGLRKGIRAR

 DLLHEHMEKAIREKLQRSEPGGQKDALDFIINSAKEQGWELTMQELKESAIELIFAAFFT

 TASATTSLLLLLLKYPSSIEKIRQELASHELTRQSDSERSCPGLEVSRWPECECDPDLTL

 EKLSRLHYLDCVIKEVLRLLPPVSGGYRTALQTFELDGYQIPKGWSVMYSIRDTHETAAI

 YRSPPEGFDPERFGSAWEEHRAAGRFHYIPFGGGVRSCIGKELAQAILKLFAVELVRTVR

 WELATASFPDMQTVPIVHPVDGLQVFFYPLPPS

 

>63% to 27A1 missing N-term 20 aa Built_from_Q9DBG1_and_others

322949 - 360101 bp (322.9 Kb) on chromosome fragment scaffold_13176

This transcript is located in sequence: contig_57835

CPLGARAKAVDPTALPPELAEAPGAVSSTAGPEARQLRSLDELPGPGQLHSLFRLFVQGY

 VLHLHELQVVLKSKYGPIWKLPLLPYTSVYLANASLMEQLLRQEGKHPLRHDMALWKEHR

 DSRGFAYGPFTTEGEEWYQLRQALNSRMLKPSDAALYTDSLNEVIGDLLVQLEDIKAKSL

 SGDQVPDVANFFYFFALEAITYILFEKRIGCLKPPIHPEMETFVKSVGLMFKNSLYVTFL

 PKWTRPLFPFWNRYLENWDIIFTFGKKLIEEKLKDMAAELKDGNSDKIRMSGYLHFLLSS

 GELTPDEAVGSLAEILLAGVDTTSNTMTWALYHLAQDPETQEALYKEVVGVVPPGKIPQY

 KDFAHMPLLKAVLKETLRLYPAVPTNSRVNSEKDVIVGDFLFPKNTQFVLCHYAMSHDPD

 IFPSPKKFLPKRWLRRNQTGPVGVNHAFGSIPFGYGVRACLGRRIAELEMYLVLSRLIQQ

 YEVTLSPGMQKVNPLSRIVLVPDKLVNLNFHKR

 

>74% to 27B1 human

>Built_from_Q7Z654_and_others_1 pep:novel N-term of 27B1 69%

scaffold:BROAD0.5:scaffold_14999:2842005:2843914:1

MAQTLKPVTKMSQFARWILELGAKLGSKRRERAPSGLTDIPGPSTLGFLTELFCQGGLSR

LHELQVQDSARFGPVWFASFGKVQTVYLAAPALIEQLLRQEGPHPERCSFSPWVEHRRRC

HRACGLLTAEGDEWQRLRSLLAPLMLRPRAAAGFAETLDGVVGDLVRHLRRCRGRVGDSR

DLVTDVAAEFYKFGLEGRPRVR

GIGAVLLGSRLGCLELAVPPETEAFIRAVGSVFVSTLLTMAMPEWLNRLCPGPWARLCGD 308

WEQMFAFGE

Database location  : contig_25217      4867 to    5040 (+)

Genomic location   : scaffold_14999 2844365 to 2844538 (+)

4867 GEPHNSSVSGPHLTRFLFQKEVPEAAILGNIAELLLAGVDT

Database location  : contig_25217      5904 to    6074 (+)

Genomic location   : scaffold_14999 2845402 to 2845572 (+)

5904 VSNTLSWALYELAHHPGVQTALHAEITGALAPGSPSHPATTLAQLPLLKAVVKEVLR 6074

Database location  : contig_25217      6544 to    6621 (+)

6544 LYPVVPGNSRVPDKDIRVGDYVIPKD 6621

Database location  : contig_25217      7408 to    7518 (+)

Genomic location   : scaffold_14999 2846906 to 2847016 (+)

7408 ILTHFEVRPEPGAGLIRPMTRTVLVPERSINLKFVDR 7518

Database location  : contig_25217      6650 to    7039 (+)

Genomic location   : scaffold_14999 2846148 to 2846537

MAQTLKPVTKMSQFARWILELGAKLGSKRRERAPSGLTDIPGPSTLGFLTELFCQGGLSR

LHELQVQDSARFGPVWFASFGKVQTVYLAAPALIEQLLRQEGPHPERCSFSPWVEHRRRC

HRACGLLTAEGDEWQRLRSLLAPLMLRPRAAAGFAETLDGVVGDLVRHLRRCRGRVGDSR

DLVTDVAAEFYKFGLE (1)

GIGAVLLGSRLGCLELAVPPETEAFIRAVGSVFVSTLLTMAMPEWLNRLCPGPWARLCGD 308

WEQMFAF (1)

AQQHVERGKAAASTGEPHNSSVSGPHLTRFLFQKEVPEAAILGNIAELLLAGVDT

5904 VSNTLSWALYELAHHPGVQTALHAEITGALAPGSPSHPATTLAQLPLLKAVVKEVLR 6074

6544 LYPVVPGNSRVPDKDIRVGDYVIPKD 6621

     TLVTLCHYSTSRDPGQFPDPNSFHPNRWLGGQPAPHPFAS 6958

6959 LPFGFGKRSCIG*RLAELELKLALAR (0) 7036

7408 ILTHFEVRPEPGAGLIRPMTRTVLVPERSINLKFVDR* 7521

 

>84% to 27C missing first 68aa Built_from_O15528_and_others

456659 - 486181 bp (456.7 Kb) on chromosome fragment scaffold_11906

This transcript is located in sequence: contig_68482

HLKVKTLKEMPGPRTLANLVEFFWKDGFSRIHEIQQKHTLEYGKIFKSHFGPQFVVSIAD

 RDMVAQVLRAEGITPQRANMESWQEYRDLRGRSTGLISAEGEQWLKMRSVLRQRILKPKD

 VAIFSGEVNQVIADLIKRIYVLRNQEADGETVTNVNNLFFKYSMEGVATILYECRLGCLE

 NNVPQLTMEYIEALELMFSMFKTTMYAGAIPKWLRPFIPKPWKEFCRSWDGLFKFSQIHV

 DNKLKDIQSQLDRGESLRGGLLTHLLISKELTLEEIYANMTEMLLAGVDTVSFSVLFSYL

 LAKHPEVQQSVYHEIIKNLGKKHIPTAEDIPKVPLIRALLKETLRLFPVLPGNGRVTQED

 LIIGGYLIPKGTQLALCHYATSYEEENFPMAKEFKPERWLRKGNMDRVDNFGSIPFGYGL

 RSCIGRRIAELEIHLVMIQLLQHFEIKTSPLTKTVHAKTHGLLTPGESINVRFVTR

 

>58% to CYP39 missing a small piece Built_from_Q9NYL5_and_others

2343462 - 2438219 bp (2.3 Mb) on chromosome fragment scaffold_15124

This transcript is located in sequence: contig_13525

MEIFLTALFIILGFTAFYLFHQRRDPQNPPCISGWIPWIGAGFKFGEAPLEFIEQARIKY

 GPVFTVFALGNRITFVTEEEGIDVFFKSKDINFEHSVQELIEKIVSVPKDIFFSFHGILY

 GLMKNKMRISHLYQFTEKMVEELHEQLETLGTDGKNDLFNLVRNSLYPVTVNFVFGKGLY

 PITHKKIVEFHEHFQNFDEGLQFASQMPECFIRNWSKSKKWFLTLFEKSIPDLER

9aa gap here

TIMQL

 ITNALRQGTSEHKAPNYALLMLWASLSNLATVACWTIMFILHNPSVYKNVMEGIVSVFGE

 AGKNNIKISEKDLKKLPLIKWCVLETIRLVSPGIITRKVMEPMKILSYTIPAGDILMLSP

 FWIHRNPKYFPEPELFKPERWEKADLEKNASLDCFVAFGGGKYPCPGRWFVLLEIEIFVA

 LLFYKYQLHLVDPFPKQSLKQLMGVQRPVTSCRVEYKCR

 

 

>CYP46

cannot find this gene.  It probably is in a sequence gap

 

>CYP51 processed PSEUDOGENE, 85% to CYP51 human

 

Query location     : unnamed             15 to     482 (+)

Database location  : contig_73625     83905 to   85251 (+)

Genomic location   : scaffold_13408 2350085 to 2351431 (+)

 

Missing N-term, has two frameshifts and a stop codon

ENAYEKYGPVFSFTMVGKK 84162

84163 FTYLLGSEAAALLFNSKNEDLNAEDVYGRLTTPVFGKGVAYDVPNPV 84303

84304 FLEQKKMLKTGLNIAQFKQHVSIIEKETKEYFESWGESGEKNLFEALSEL 84453

84454 IILTASHCLHGKEIRNQLNEKVAQLYADLDGGFTHAAWLLPGCLPLPSFRRRDQVHQAI 84630

84631 KSIFHNAIQKRRESKEKYDNFLQTLLDSTYKDGHSLTDDEIAGLL 84765

84766 IGLLLAGQHTSSTTSAWMGFFLARDKILQEKCYLE*RNVCGEDLPPLHYDQL 84921

84922 KDLQLLX

KETLRLRSPMMRLAKTPQMVAGYTIPQGHQV

CVSPTINHRLK 85065

85066 DSWIERLDFNPDQYLQDNPVSGEKFTYMPFGAGRHRCIGENFAYVQIKTIWSILLRLYEF 85245

85246 DLVNGYFPTVNYTTMIHTQHNPIIQYK*

 

Query: 68  ENAYEKYGPVFSFTMVGKKFTYLLGSEAAALLFNSKNEDLNAEDVYGRLTTPVFGKGVAY 127

           ENAYEKYGPVFSFTMVGK FTYLLGS+AAALLFNSKNEDLNAEDVY RLTTPVFGKGVAY

Sbjct: 92  ENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAY 151

 

Query: 128 DVPNPVFLEQKKMLKTGLNIAQFKQHVSIIEKETKEYFESWGESGEKNLFEALSELIILT 187

           DVPNPVFLEQKKMLK+GLNIA FKQHVSIIEKETKEYFESWGESGEKN+FEALSELIILT

Sbjct: 152 DVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILT 211

 

Query: 188 ASHCLHGKEIRNQLNEKVAQLYADLDGGFTHAAWLLPGCLPLPSFRRRDQVHQAIKSIFH 247

           ASHCLHGKEIR+QLNEKVAQLYADLDGGF+HAAWLLPG LPLPSFRRRD+ H+ IK IF+

Sbjct: 212 ASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFY 271

 

Query: 248 NAIQKRRESKEKYDNFLQTLLDSTYKDGHSLTDDEIAGLLIGLLLAGQHTSSTTSAWMGF 307

            AIQKRR+S+EK D+ LQTLLD+TYKDG  LTDDE+AG+LIGLLLAGQHTSSTTSAWMGF

Sbjct: 272 KAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGF 331

 

Query: 308 FLARDKILQEKCYLE*RNVCGEDLPPLHYDQLKDLQLLK

 

 

Query: 368 AILFLRAIR----------------CVSPTINHRLKDSWIERLDFNPDQYLQDNPVSGEK 411

            ++ +R  R                CVSPT+N RLKDSW+ERLDFNPD+YLQDNP SGEK

Sbjct: 383 IMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEK 442

 

Query: 412 FTYMPFGAGRHRCIGENFAYVQIKTIWSILLRLYEFDL 449

           F Y+PFGAGRHRCIGENFAYVQIKTIWS +LRLYEFDL

Sbjct: 443 FAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDL 480

 

AGAGAAAATGCATATGAGAAGTATGGACCTGTATTTAGTTTT

ACAATGGTGGGCAAGAAGTTTACATACCTCCTTGGCAGTGAAGCTGCTGCCCTGCTCTTC

AACAGCAAGAATGAAGATTTGAATGCAGAAGATGTTTATGGCCGGCTCACTACCCCAGTC

TTTGGAAAGGGAGTTGCTTATGATGTGCCCAATCCAGTATTCTTGGAACAAAAGAAAATG

TTAAAAACTGGCCTTAATATAGCCCAATTTAAACAACATGTTTCCATAATTGAAAAAGAA

ACAAAGGAATACTTTGAAAGCTGGGGAGAAAGTGGAGAAAAAAACTTATTTGAAGCCCTT

TCTGAGCTAATCATTCTCACGGCTAGCCACTGTTTACATGGAAAAGAAATCAGAAACCAG

CTGAATGAAAAAGTGGCCCAGCTCTATGCAGATCTAGATGGAGGCTTCACCCATGCTGCT

TGGCTCCTACCAGGTTGTCTGCCTTTGCCCAGTTTCAGGCGCCGGGACCAAGTACATCAA

GCAATCAAAAGCATTTTCCATAATGCAATCCAGAAACGTAGGGAGTCAAAAGAAAAATAT

GATAATTTCCTCCAAACTTTGCTAGATTCTACCTACAAGGATGGGCATTCTTTGACAGAT

GATGAAATTGCAGGGCTGCTTATTGGACTTCTGTTAGCAGGGCAGCACACGTCATCCACC

ACAAGTGCTTGGATGGGCTTCTTTTTGGCCAGAGACAAAATACTTCAGGAAAAATGTTAC

TTAGAATAGCGGAATGTCTGTGGAGAAGATTTGCCTCCTTTACACTATGATCAGCTCAAA

GATCTACAGCTGCTTaaAAAGAAACATTAAGACTCAGATCTCCTATGATGAGACTGGCCA

AAACTCCCCAGATGGTGGCCGGCTATACTATTCCTCAGGGCCATCAGgTGTGTGTCTCCC

ACCATTAACCACAGGCTGAAAGACTCTTGGATAGAACGCCTGGACTTCAATCCTGACCAA

TACTTGCAGGATAACCCTGTGTCGGGGGAGAAGTTTACGTACATGCCCTTCGGAGCTGGT

CGGCATCGTTGTATTGGTGAGAACTTTGCGTATGTTCAGATTAAGACAATTTGGTCCATC

CTCCTCCGCTTATACGAATTTGATCTTGTTAATGGATATTTTCCTACAGTAAATTACACA

ACTATGATTCACACTCAGCATAACCCAATAATCCAGTACAAATGA

 

 

>CYP51 gene, N-term not well conserved, scaffold_19203 4882809-4895137 (+)

Database location  : contig_83911    134425 to  134583 (+)

Genomic location   : scaffold_19203 4882809 to 4882967 (+)

134425 MALLGMLEGAAEAVGGGRLSAVLAAFVCTLSLAYLLRRGLGLLQGPEQLPREA (0) 134583

ATGGCCCTACTCGGGATGCTGGAGGGCGCCGCGGAGGCGGTGGGCGGCGG

GCGACTGTCGGCCGTGCTGGCCGCTTTCGTGTGCACGCTCAGTCTGGCCTACCTGCTGCG

CCGCGGCCTGGGCCTCCTGCAGGGTCCGGAGCAGCTGCCCAGAGAAGCGGT

 

(0) KCPPYIFSPIPFLGHAIAFGKSPIEFLENAYEK (0)

AGAAATGTCCACCCTACATCTTCTC

TCCTATTCCTTTCCTTGGTCATGCAATAGCATTTGGGAAAAGTCCTATTGAATTTCTAGA

AAATGCATATGAGAAGGT

 

Database location  : contig_83911    137398 to  137574 (+)

Genomic location   : scaffold_19203 4885782 to 4885958 (+)

137398 (0) YGPVFSFTMVGKKFTYLLGSEAAALLFNSKNEDLNAEDVYGRLTTPVFGKGVAYDVPNP (0) 137574

AGTATGGACCTGTATTTAGTTTTACAATGGTGGGCAAGAAGTTTACATACCTCCTTGGC

AGTGAAGCTGCTGCCCTGCTCTTCAACAGCAAGAATGAAGATTTGAATGCAGAAGATGTT

TATGGCCGGCTCACTACACCAGTCTTTGGAAAGGGAGTTGCTTATGATGTGCCCAATCCA

GT

 

Database location  : contig_83911    138346 to  138471 (+)

Genomic location   : scaffold_19203 4886730 to 4886855 (+)

138346 (0) VFLEQKKMLKTGLNIAQFKQHVSIIEKETKEYFESWGESGEK (1) 138471

AGGTATTCTTGGAACAAAAGAAAATGTTAAAAACTGGCCTTAATATAGCCCAATTTAAACAA

CATGTTTCCATAATTGAAAAAGAAACAAAGGAATACTTTGAAAGCTGGGGAGAAAGTGGA

GAAAAAAGT

 

Database location  : contig_83911    139883 to  140059 (+)

Genomic location   : scaffold_19203 4888267 to 4888443 (+)

139883 (1) NLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWLLPGWLPLPSFR (2) 140059

AGACTTATTTGAAGCCCTTTCTGAGCTAATCATTCTCACGGCTAGCCACTGTTTACATGGA

AAAGAAATCAGAAGCCAGCTGAATGAAAAAGTGGCCCAGCTCTATGCAGATCTAGATGGA

GGCTTCACCCATGCTGCTTGGCTCCTGCCAGGTTGGCTGCCTTTGCCCAGTTTCAGGT

 

Database location  : contig_83911    143390 to  143509 (+)

Genomic location   : scaffold_19203 4891774 to 4891893 (+)

143390 RRDRAHQAIKSIFHNAIQKRRESKEKYDDFLQTLLDSTYK 143509

AGATTTTGG

AATTACAGGCGCCGGGACCGAGCACATCAAGCAATCAAAAGCATTTTCCATAATGCAATC

CAGAAACGTAGGGAGTCAAAAGAAAAATATGATGATTTCCTCCAAACTTTGCTAGATTCT

ACCTACAAGT

 

Database location  : contig_83911    143854 to  144048 (+)

Genomic location   : scaffold_19203 4892238 to 4892432 (+)

143854 (2) DGRSLTDDEIAGLLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCYLEQRSV 144012

144013 CGEDLPPLHYDQ (0) 144048

AGGGATGGGCGCTCTTTGACAGATGATGAAATTGCAGGGCTGCTT

ATTGGACTTCTGTTAGCAGGGCAGCACACGTCATCCACCACCAGTGCTTGGATGGGCTTC

TTTTTGGCCAGAGACAAAACACTTCAGGAAAAATGTTACTTAGAACAGCGGAGTGTCTGT

GGAGAAGATTTGCCTCCTTTACACTATGATCAGGT

 

Database location  : contig_83911    144942 to  145037 (+)

Genomic location   : scaffold_19203 4893326 to 4893421 (+)

144942 (0) LKDLHMLDRCLKETLRLRPPIMTMMRLAKTPQ (0) 145037

AGCTCAAAGATCTACATATGTTAGATCGCTGCTTAAAAGAAACATTGAGACTCAGACCTCCT

ATCATGACTATGATGAGACTGGCCAAAACTCCCCAGGT

 

Database location  : contig_83911    145436 to  145603 (+)

Genomic location   : scaffold_19203 4893820 to 4893987 (+)

145436 (0) MVAGYTIPPGHQVCVSPTVNHRLKDSWRERLDFNPDRYLQENPASGEKFAYVPFGA (1) 145603

AGATGGTGGCCGGCTATACTATTCCTCCGGGCCATCAGGTGTGTGTG

TCGCCCACCGTTAACCACAGGCTGAAAGACTCCTGGAGAGAGCGCCTGGACTTCAATCCT

GACCGGTACTTGCAGGAGAACCCTGCGTCGGGGGAGAAGTTTGCCTACGTGCCCTTCGGA

GCTGGT

 

Database location  : contig_83911    146574 to  146738 (+)

Genomic location   : scaffold_19203 4894858 to 4895137 (+)

146574 (1) GRHRCIGENFAYVQIKTIWSVLLRLYEFDLVNGYFPTVNYTT 146699

146700 MIHTPHNPIIRYKRKTI* 146753

AGGTCGGCATCGTTGTATTGGTGAGAACTTTGCGTATGTTCAGATTAAGACA

ATTTGGTCCGTCCTGCTCCGCTTATACGAATTTGATCTTGTTAATGGATATTTTCCTACA

GTGAATTATACAACCATGATTCACACGCCGCATAACCCAATAATCCGATACAAACGAAGA

ACAATATGA

 

134425     MALLGMLEGAAEAVGGGRLSAVLAAFVCTLSLAYLLRRGLGLLQGPEQLPREA (0) 134583

       (0) KCPPYIFSPIPFLGHAIAFGKSPIEFLENAYEK (0)

137398 (0) YGPVFSFTMVGKKFTYLLGSEAAALLFNSKNEDLNAEDVYGRLTTPVFGKGVAYDVPNP (0) 137574

138346 (0) VFLEQKKMLKTGLNIAQFKQHVSIIEKETKEYFESWGESGEK (1) 138471

139883 (1) NLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWLLPGWLPLPSFR (2) 140059

143390 (2) RRDRAHQAIKSIFHNAIQKRRESKEKYDDFLQTLLDSTYK 143509

143854 (2) DGRSLTDDEIAGLLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCYLEQRSV 144012

144013     CGEDLPPLHYDQ (0) 144048

144942 (0) LKDLHMLDRCLKETLRLRPPIMTMMRLAKTPQ (0)

145436 (0) MVAGYTIPPGHQVCVSPTVNHRLKDSWRERLDFNPDRYLQENPASGEKFAYVPFGA (1) 145603

146574 (1) GRHRCIGENFAYVQIKTIWSVLLRLYEFDLVNGYFPTVNYTTMIHTPHNPIIRYKRKTI* 146753

 

>74% to 72A23 rice Plant contaminant Built_from_Q8LL73_and_others

20228 - 21896 bp (20.2 Kb) on chromosome fragment scaffold_12286

This transcript is located in sequence: contig_98823

APRVTPFMHRLVLEHGRTSMSWFGPSPKVTIVDPDLAKDVLSNKFGHFEKLKVPALSKML

 GSGVASHEGEKWVKHRRILNHAFHLEKLKRMLPAFSTCCEELVSRWAAESLGSDGSCELD

 VWPELQNLTGDIISRTVFSSSYSEGRRIFQLQVEQASLVMTNIRKIMIPGYMYLPTANNR

 KMRRNNREVESILREIIGKRIQAMEQGEGTKDDLVGLLLETNMRDDMGMTIEDVIEECKV

 FYFVGMETTLVLLMWTMVVLSMHPEWQDRAREEVTALFGRDDKPEYDGLSRLKVVTMVLY

 EVLRLYPPATSVVRQTYKEMEVGGVTYPAGVILELPVLLIHHDPDIWGGDAREFRPDRFS

 EGVSRASKDPGAFLPFGWSPRICIGQNFALLEAKMALCMILQRFEFGLAPSYAHAPHTMI

 TLHPMHGAQLKLRAI