Ostreococcus P450s (Prasinophyte green algae)

 

Three different species of Ostreococcus each have 10 P450s

Ostreococcus tauri and O. lucimarinus and Ostreococcus RCC809

 

These were sequenced at JGI and they have genome pages there.

 

O. luciminarus JGI page.

O. tauri JGI page.

 

CYP51 is present, as well as CYP97A, CYP97B and CYP97C sequences.

CYP746 is found.  A CYP745 ortholog is present and a sequence like CYP747 is present.

Two other genes are not related to known P450s.

The two species sequences are from 69-95% identical to each other.

 

Nov. 9, 2006, revised with some name changes 4/13/2009

D. Nelson

 

>CYP51G1 e_gw1.11.00.152.1|Ostta456% to CYP51G1 Chlamy.

May be about 27 aa short at N-term

MTIILAIFILDQLSHGPLKGRRSPPVISVAPVWGGMVAFLAGPMRLMREAMPKYGEVFTVPVFHKRITFLIGPKVSEHFF

KAKDTEMSQKEVYEFNVPTFGKGVVFDVDHTTRAEQFRFFADSLKSNRLRMYVGMMVKEAEDFFAKWGDEGEVNLLDELS

ELIVLTASRCLLGREIRETLYSEVTELVHDLDKGMVPLSVFFPYAPIEAHRKRDKARKKLAQIFDKVIQARRESGASEPD

VLQTFIDARYKNGSKLSNDQVLGMLIAVLFAGQHTSSITSTWTGLLSIANKERVFPALEEEQRKIIKAHGNELDFDILAK

MDELHFAVKEALRMHPPLIMLLRYAQSAFEVETTEGKKYTVPKGHIVATSPAFAHRLDSVYSEPDTYKPGRFREPNAEDK

AAFASFIGFGGGRHGCMGETFAYMQIKTIWSILIRNFEFDMVGDLPEPDYEGMVVGPKHAGCRIKYKRRAKPLGK*

>CYP51G1 e_gwEuk.11.159.1|Ost9901_3 Ostreococcus lucimarinus 88% to 51G1

MTVVIFIFLLDQLSHGPLKGRKSPPVIDVAPVWGGMLAFLAGPMKLMREATPKYGEVFTVPVFHKRITFLIGPKVSEFFF

KAKDTEMSQKEVYEFNVPTFGKGVVFDVDHTTRAEQFRFFADSLKSNRLRMYVGMMVKEAEDFFSKWGDAGEVDLLEQLS

ELIVLTASRCLLGREIRETLYSEVTDLVHDLDKGMVPLSVFFPYAPIEAHRKRDAARKNLAKIFDKVIQARRESGASEPD

VLQTFIDARYKDGSRLTNDQVLGMLIAVLFAGQHTSSITSTWTGLLAIANKERVMPALEKEQKDIMKKHGKDLDFDILAK

MDELHFAVKEALRMHPPLIMLLRMAQVPFEVETSTGKKYTVPKGHIVATSPAFSHRLDNVYSDPNEYKPERFREPNPEDK

AQFASFIGFGGGRHGCMGETFAYMQIKTIWSILLRNFEFEMVGKVPEPDYTGMVVGPTAGQCKIRYKRRVL*

>CYP97A15 estExt_fgenesh1_pm.C_Chr_13.00010043|Ostta4 66% to 97A5, 49% to 97C5

May be about 40 aa short at N-term

MSKMPVATGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVSDNAVAKEMLLTQAKSFSKGLLSEILDFVMGQGL

IPANGEVWKIRRKVIVPSLHKKYVTSMVGMFGDCGLKGMAQLARAEKMGESVEMENFYSRFALDIIGKAVFNYDFDSLTT

DDPVIKAVYTVLREAEYRSVTFIPYWKVPPLRWLVPRQRQCQEALKVVNDTLDELIDRCKKIVEEEDEEFVEEYMNTDDP

SILHFLIASGDDVTSKQLRDDLMTLLIAGHETTAAVLTWTTFLLAKHPDIKQKVFEEVDRVVGDRNPTVADMRELVYTTR

VINESMRLYPQPPVLIRRALEPVTLGGYNIDAGTDFFISVWNLHRNPRIWPEPDAFKPERFPIEGPMPNEYTEDYAYLPF

GGGQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGATIHTTNGLHVRLKRREGRGGAEMSGAVRVYSS

SLR*

>CYP97A15 estExt_GenewiseEukaryote.C_Chr_130084|Ost9901_3 Ostreococcus lucimarinus

95% to 97A15

formerly CYP97A11

MPVASGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVSDNAVAKEMLLTQAKSFSKGLLSEILDFVMGQGLIPA

NGEVWKIRRKVIVPSLHKKYVTSMVDMFGDCGLKGMSQLARAEKANESVEMENFYSRFALDIIGKAVFNYDFDSLSTDDP

VIKAVYTVLREAEYRSVTFIPYWKVPPLRWLVPRQRQCQEALQVVNDTLDDLINRCKAVVEEEDEEFVEEYMNTDDPSIL

HFLIASGDDVTSKQLRDDLMTLLIAGHETTAAVLTWTTFLLAKHPEVKAKVFEEVDRVVGDRNPTVADMRALVYTTRVIN

ESMRLYPQPPVLIRRALEPVTLGGYNIDAGTDFFISVWNLHRNPRIWDEPDAFKPERFPIDAPMPNEYTEEYAYLPFGGG

QRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGATIHTTNGLHVKLKRRDGRGGREMDGTYVTGMALSN

LEDVDVVRGSIDAPT

>CYP97A15 gwEuk.21.62.1|Ost9901_3 Ostreococcus lucimarinus same seq as Chr_130084

95% to 97A15

KMPVASGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVSDNAVAKEMLLTQAKSFSKGLLSEILDFVMGQGLIP

ANGEVWKIRRKVIVPSLHKKYVTSMVDMFGDCGLKGMSQLARAEKANESVEMENFYSRFALDIIGKAVFNYDFDSLSTDD

PVIKAVYTVLREAEYRSVTFIPYWKVPPLRWLVPRQRQCQEALQVVNDTLDDLINRCKAVVEEEDEEFVEEYMNTDDPSI

LHFLIASGDDVTSKQLRDDLMTLLIAGHETTAAVLTWTTFLLAKHPEVKAKVFEEVDRVVGDRNPTVADMRALVYTTRVI

NESMRLYPQPPVLIRRALEPVTLGGYNIDAGTDFFISVWNLHRNPRIWDEPDAFKPERFPIDAPMPNEYTEEYAYLPFGG

GQRKCVGDQFAIFESIVSLAMLMRRFDFELDESKHPDGECGMTTGATIHTTNGLHVKLKRR

>CYP97E5 estExt_gwp_GeneWisePlus.C_Chr_01.00010469|Ostta4 63% to 97B6, 39% to 97C5

Formerly CYP97B14

MVARARVHASRGVDARRVRARGRARVDVIARAVKEPSSAPEEALPDENFKPEQLKFQDIVSLWVTQILQTYGGKESKDNA

PVCEGVIDDLVGGPIFLALYPYFRRYGGVFKLAFGPKVFMVLSDPVIVREVLKEKPFSFDKGVLAEILEPIMGQGLIPAP

YAVWKNRRRQLVPGFHKAWLDHMVGLFGHCSNELVRNLDKSAEDGEVVDMEERFCSVSLDIIGLAVFNYDFGSVTKESPI

ISAVYNCLQEAAHRSTFYFPYWNIPFATDIVPRQREFKQNMKIINETLNGLIQKAQKFEGTEDLEELQNRDYSKVKDPSL

LRFLVDIRGADVTDSQLRDDLMTMLIAGHETTAAVLTWGLFCLMQNPELMKRIQADIDEVMGDDDRTPTYDDIQKLESVR

LCIAEALRLYPEPPILIRRCLEDVTLPKGAGDAEVTLIKGMDIFISVWNLHRSPECWENPEEFDPFRFKRPFANPGVKDW

AGYNPELFTGLYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMVLRRYDFELTTDPKDIGMTMGATIHTEKGLPC

RVRRRQPVTTATAAAV*

>CYP97E5 eugene.0100010571|Ost9901_3 Ostreococcus lucimarinus

89% TO 97E5 O. tauri, 52% TO 97F1, 57% TO 97E2

MRRATPRRGDAARERAVGDAWNRAVVARAVKEPEEETIPSDDFKPEELKFRDIVSLWVTQILQTYGDKESKDNAPVCEGV

IDDLVGGPIFLALYPYFRRYGGVFKLAFGPKVFMVLSDPVVVREVLKEKPFSFDKGVLAEILEPIMGQGLIPAPYAVWKN

RRRQLVPGFHKAWLDHMVGLFGHCSNALVRNLDKAAASGEVVDMEERFCSVSLDIIGLAVFNYDFGSVTKESPIISAVYN

CLQEAAHRSTFYFPYWNLPFATDIVPRQREFKKNMSIINDTLNGLIKQAQQFEGTDDLEELQNRDYSKVKDPSLLRFLVD

IRGADVTDVQLRDDLMTMLIAGHETTAAVLTWGLFCLVQKPELLKRIQADIDEVFGDDDRTPTYDDIQKLESVRLCIAEA

LRLYPEPPILIRRCLEDVTLPKGAGDVEVTLIKGMDIFISVWNLHRSPECWENPDEFDPFRFKRPFKNPGVKDWAGYNPD

LLTGLYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMTLRRYDFELQKDPKDIGMEMGATIHTAGGLPMKIKRRT

PAA*

>CYP97E6 estExt_fgenesh1_pm.C_Chr_15.00010014|Ostta455% to 97Ba, 42% to 97C5,

formerly CYP97B15

MDLLKPEVRAAPLFVPLYDYYREYGGVYNLGAGPKWFVVVSDPVAVRTMFKDKADDFSKGILTDIMEPIMGDGLIPANKE

TWAKRRPVIGAGFHGAWLKHMCNLFGASAMRLAEKLDVAAEKGTTVELEGELYAMALDVIGKAVFNYEFGALKQETPIIK

AVYRVLRESEHRSTFPLQYWQIPGAMDLVPRQKQFKEDMKMINEELSTLINSAIESRNETGLEEMERRDYSNVEDASLLR

FLVDIRGDEATSTQLRDDLMTMLIAGHETTAAVLTWTLYLLAQHPEIMEEAVKEIEMCVENADGVPTPEEVRKLEKVRMI

LAEGMRLYPAPPILIRRAIKDVTLPRGGNGKEITLKAGTDCFIAVWNLHRSPDLWENPEKFDPSRFSRRFTNEAIEGWGG

LNPDLMTGLYPNEQSTDFSYVPFGGGQRRCAGDQFAMLEAVTSLSVLLKKFKFELDCPPNDVEMITGATIHTKKGLPMKI

KRRE*

>CYP97E6 fgenesh1_pg.C_Chr_14000053|Ost9901_3 Ostreococcus lucimarinus

92% to 97E6 O. tauri, 50% to 97E5

MRATPSTLRTPSRARAPGAANSRGSTARARAIQPPKAPDAYRGALFPGVEVPDNDLARSFSALFPWGNGARVTEKVLGDL

LKPEVRAAPLFVPLYDYYREYGGVYNLGAGPKWFVVVSDPVAVRTMFKDQADSFSKGILTDIMEPIMGDGLIPANKEIWA

KRRPVIGAGFHGAWLKHMCNLFGASAMRLADKLDTFVESEKTVELESELYAMALDVIGKAVFNYEFGALKQETPIIKAVY

RVLRESEHRSTFPLQYWQIPGAMELVPRQKQFKEDMKMVNDELSVLINNAIASRNETGLEEMERRDYSNVEDASLLRFLV

DIRGDEATSTQLRDDLMTMLIAGHETTAAVLTWTLYLLAQHPEIADDAVAEINACVENADGIPTPEEVRKLEKVRMILAE

GMRLYPAPPILIRRAIKDVTLPRGGNGKEITLKAGTDCFIAVWNLHRSPDLWEDPEKFDPSRFSRRFENPAIEGWGGLNP

ELMTGLYPNEQCTDFSYVPFGGGQRRCAGDQFAMLEAVTALSVLLKKFKFELACEPGEVEMITGATIHTKKGLPMKLKRR

*

>CYP97C18 gw1.09.00.100.1|Ostta4 53% to 97C5 of moss

formerly CYP97C12

APDWMTQLNRLWGGASEIPVADAKLEDITGLLGGGLFQPLFKWMLEAGPVYLLPTGPVTSYVVVSDAACIKQVLFNYGSK

YIKGTIAEAGEFLFGLGVALQELEPWKVRRKAVAPSLHRKYVEAMVDRCFALCADRMTTILEEEAANGAVGSVNLESRFS

KTALDIIGISVFNYDFKALTTAAPVIQATYTALKEVETRSMDLLPTWRLPEQFLRIVSPRQRNAQDAVTVIRDVTQRLVD

DCKRMVEEEEKVGGAEEWARDYLNESNPSVLRYLIAAREEVSSTQLRDDLLSLLVAGHETTASVLTWGTYELLKPENAEQ

LRLLRAELDEVLGTRPYPTFADLAKMPYLERCFHESMRLYPQPPVYTRRAVVEDVLPNGMTVPKNQDLLVSIYNLHRSPA

NWGPTSQQFEPMRFGPLANGQPNELNTDYRYVPFSAGPRRCPGDKFAVYEXIVIWATMLRRLDLELKAGHDVIMTSGATI

HTKSGLLATV

>CYP97C18 eugene.0900010237|Ost9901_3 Ostreococcus lucimarinus

93% TO 97C18 O. tauri

MAAPDWMTQLNRLWGGASEIPVADAKLEDITGLLGGGLFQPLFKWMRESGPVYLLPTGPITSYVVVSDPDCIKQVLFNYG

SRYIKGTIAEAGEFLFGLGVALQELEPWKIRRKAVAPSLHRKYVEAMVDRCFGPCADRMVSILEGEAGAGGVGGVNMESR

FSKTALDIIGISVFNYDFEALTTAAPVIQATYTALKEVETRSMDLLPTWRLPEKFLRVVSPRQRDAQDAVTVIRDVTQRL

VDDCKRMVEEEEKVGGAEEWARDYLNESNPSVLRYLIAAREEVSSTQLRDDLLSLLVAGHETTASVLTWGTYELLKPENA

EQLRLLRAELDEVLGTRPFPTFADLPKMPYLERCFHESMRLYPQPPVYTRRAVVEDVLPNGMTIPKNQDLLVSIYNLHRS

PTSWGPTSQEFEPMRFGPLANGQPNELNTDYRYVPFSAGPRRCPGDKFAVYEGIVIWATMFRRLDLELKAGHDVVMTSGA

TIHTKSGLLATVKARAMREVAEADRVDWANLKPAKDIGEEWMEKALFNSEATGAVSAGKCPMGH*

>CYP745B1 e_gw1.08.00.85.1|Ostta4 47% to 745A1 missing about 105 aa at N-term

IFQRHCVVVADPELVKRVMQTNLKNYKKDTEFSYEPFLEILGTGLVTSEGETWRAQRQRISSALRIEILDDIIAIATRAL

EKVRGKGEAVELAEEFRLLTLQVIAEAILSLTPEQSDEVMPNLYLPIMDECNRRSLEPWRKFLPTREWREHRKRVAALNK

YIVDLIRVRWKKRVSGETNPNPDILDRVLASVEMEEYGSDVEEQMCFEIKTFLLAGHETSAAMLVWTIYELVKNEDKMTE

AVAEANKVLGAVKPGNLPTRDELAHLDYCVSALKETLRLYSVVPVVTRRAVEDDVLGGCKIPKGTTVIISLQGIHHREDL

WPNAMSFEPERFLNGKGDEIGNYAYLPFIQGPRNCLGQYLALLEARVVLATLIRRFKFKSASANNGKKHTKAIPIAPADG

MWFTVE*

>CYP745B1 e_gwEuk.8.160.1|Ost9901_3 Ostreococcus lucimarinus

86% TO 745B1 (ORTHOLOG)

MQVNLKNYKKDTEFSYEPFLEILGTGLVTSEGETWREQRQRISSALRVEILDDIIAIATRAVDRLSEKLERVRGKNEPVE

LAEEFRLLTLQVIAEAILSLTPEQSDEVMPNLYLPIMEECNRRSLEPWRKYLPTPEWFAHRKRVAMLNEYIVNLIRGRWK

KRTSGEANENPDILDRVLASVEVEDYGADIEEQMCYEIKTFLLAGHETSAAMLIWTTWELVNNEEKMAKAVAEANKVLGK

VKPGRLPTRDELAHLDYNVSALKESLRLYSVVPVVTRRAIADDVLGGCRIPKGTTVIISLQGVHHREDLWPNPLSFEPER

FLDGKNDELGNYAYLPFIQGPRNCLGQYLALLEARVVLATLIRRFKFKSASTKNGAKHTKAIPIAPADGMWFTVE*

>CYP746A1 fgenesh1_pg.C_Chr_03.0001000270|Ostta4 51% to CYP746A1 Volvox, probable ortholog

MGFPSGPAGDRALELAYDPLRFLERARAAHGDACGVTLARESVVLVSSPDLARKVLRDENASFQKDGTAFFPGSSLAGNG

LLVSDGETWARQRRLSNPAFRKAAVETYARCMIDVGNRLVSQEWSKRGVRDVYADFNDATLEIVARALFGADVVGERANR

INGAIKDSFEFFGRRAATGMIIPEWAPTFDNFRYNEAVKRLDEEVYGLISKRRRDIAAGEEKGDLDLLDRLLLATDEEEP

ESKASGMSDKALRDELMTLMVAGQETSAILLSWACALISEQPEAGDKIANEVRELLQSKPPGSNLDAGDYSKLPYTEACI

LETLRIRPPAYMVGRCASRDVELRPHVFITKGTTVLVAPYLIQRDPKYWNEPTSFKPERWLVQSPYSDGTLARDALKNLG

PNDAYFPFGGGPRVCIGTGFAMMESVLLLALICQ

>CYP746A1 eugene.0300010366|Ost9901_3 Ostreococcus lucimarinus

82% to CYP746A1 ortholog

MSTATRGGARVARAGRCSGRRARASGRARRSGATKAGEDDALRGTLDAVAVATLRALGGVARDVAGNANVKPARFPRGPR

EDVALELVYDPLKFLERAREAHGDAVGLTLAGENVVLVSSPALARAVLVDQSECFQKDGTAFFPGSSLAGNGLLVSDGET

WARQRRLSNPAFRKAAVETYARCMIEVGERLVNKTWSRRGRRDVYADFNDATLEIVASALFGADVVGARASKINGAIKDS

FEFFGRRAATGMIIPEWAPTFDNVRYNDAVKRLDEEVYSIIAKRRRAMASGEQNNELDLLDRLLLEKDENEGDGNDATGM

SDKALRDELMTLMVAGQETSAILLSWACALIAERPYVGDKIATEVRQHLKTKENAGSSLDASDFSKLPYTEACILETLRI

RPPAYMVGRCAARDVELRSDVFITKGTTVLIAPYLIQRDSQYWNDPKAFKPERWLVKSPYSEGTLARDALKNLGPNDAYF

PFGGGPRVCIGTGFAMMESVLLLALICNACELRLPPGSSAPKPKALITLRPDEIKLDVGPRPRSVF*

>CYP800A1 fgenesh1_pg.C_Chr_07.0001000025|Ostta4

37% to 747A1 N-terms do not match

MGGAVRRTRAGRFGAASATETAKAEDDEVASAEVGVSVGASAMGGAEDEAS

GTACPYTAAKEALGLAPPPPTRRDENGNP

AMVDNVSFLKSLIKASQHPVGMPIAMLDWAAEKGECVGIKNAIGPFC VSILDPEIVEYVCFTNAKNYRLRMLPDAFRYVI

QNKGITGSDGQYNRDHRLMCQKPFINSFSLAEFSSTVEERIAHMCNTWQQAHAMGGGKPYEINIDYDSQQVTLDVIGKVA

FAYDFKRCEAHEAKTLRGEADEDGNVSKLLAAYNGSSEIMGELFITPGPILKLQNFLGLGRVRELKEQYA ILE SVGTKLM

SERRAIVKERLAAGDEEDYCLLDVLVKAKDADGQPLSDADLWGDINDIMAAGHRTTASNFTVNLWHVARYEHIQEQIEKE

VAALGGRPPTFQDVQEGKLPYTQRVVKESLRKYAPINLFPRLAEGPDTLPSGHKVEEGDFILLSTYAMGRNPRVWEDPNK

FDPDRFTDEAL

YAQAEKQASAVARGDPAKLEQARERMRRRMNA

GRDFTYTPFGAGPRSCIG

GVFALLAATTMLASTVQKFKLSKASHSKGAVGEEL

NIMYDTTICFPEGVWINLEPRERPLGA*

>CYP800A1 gwEuk.7.488.1|Ost9901_3 Ostreococcus lucimarinus, 86% to Chr_07.0001000025, ortholog

      MRSLARTRSGASSAPELVAEEDDEVATATSS GESVVVGGEDAVEGETEG

      GACPYTAAKEALGFAGPPP 62268

62267 TRPDADGNPAMIDSKSFLKSLVKAAQHPVGMPIAMLDWAAEKGECVGIKN 62118

62117 AIGPFCVSILDPEIVEYVCFTNAKNYRLRMLPDAFRYVIQNKGITGSDGQ 61968

61967 YNRDHRLMCQKPFINSFSLSQFSSTVEERIAYMCNTWTSAAAMNPGKPME 61818

61817 INIDVDSQQVTLDVIGKVAFAYDFEQCEAHEARTLRGEEGKNDNISKLLN 61668

61667 AYNGSSEIMGELFITPGPILKLQNFLGLGRVRELKEQYA 61551

61550 ILESVGTKLMSERRAVVKERLAAGDEEDYCLLDVLVKAKDAD 61509

61424 GNPLSDADLWGDIN

61382 DIMAAGHRTTASNFTVNLWHVARYEHIQRGIEEELEALGGRPPTFKDVQD 61333

61332 GRLPYTQRVVKESLRKYAPINLFPRLAEGADTLPSGHKVEAGDFILLSTY 61283

61282 AMGRNPRVWENPEKFDPDRFTDEALYAQAEKQASAVAKGDPAKLEQARERMRRRMTA 60912

60911 GRDFTYTPFGAGPRSCIG 60894

60857 GVFALLAATTMLASTVQKFKLSKAGPGRDKLGEEL

60752 NIMYDTTICFPEGVWINLEPREEPVGA* 60741

>CYP801A1 estExt_fgenesh1_pg.C_Chr_07.00010215|Ostta4 weak similarity to CYP4

MRSSEVIGNLVNAFDVASNASTIAAVALLGIFTLGLFFILFVRARARATLARASVPAVTWRPKFLWRLYSRSARSLLQRV

EQRFRRGDGSGRGRRAFGAVVGACPFVHVGEARLARDVLRETSRKAPLYHAFEAFSGTGIFTAEGDDWDGKRTEVLRAFH

DVGLASLRDRAVEESASAVEEMREVVERGGGEIEARALPILQRLALRVTFAYLTGVSLRRACEDVGRERSEVEGEYLDAA

TTLRHLIPARARSIWIFSDLLYGLTPVGRLEARKIRTTRSLSALALRTAKEESPLGRLRVGEAHLREKSIKVGKDEYPKG

LLDEATTLLFAGHDTQSATLSWCLLRLVQDVEVQSELRASLRDDIIEEALGLPPSKSGSRQRRSSEKTTKPAWATSAFAP

TLEAVIRETLRLHPVAPLVVRMLSSDTHSEKMTIPKGCAVGVWLSSVHRDESVWERPEEFDPKRWFGGPAHARTGSMGGS

SNDDDDNGGILTPSRDRSNALRHKGVGYMPFAYGPRSCVGQHLAQVTMRVALAHLVHAFEFAPSADLDASMPSVGFTVTP

STGAPVRVRLAARAPA*

>CYP801A1 eugene.0700010342|Ost9901_3 Ostreococcus lucimarinus

72% to Chr_07.00010215, ortholog

MPLPLDVTARVAVARAVSDVDARAVVAFALAFALVVALVVVARARRVLARANVAAVRWRPKFLWRLYQRSARSLLRRVED

RFSRTARDGGGSGRRAFGAVVGACPFVHVGEAKLARDVLRGTTVKSPLYHAFEAFSGTGIFTAEGEDWEGKRGEVLRAFH

AVGLQALRDRAVEESARIVRGMKLELERGGTREMETLALPTLQRLALRVTFGYLTGNSLAEACAEVGRAQADVESEYLAA

ATTLRHLIPARARSIWIFSDFLYGLTPVGRLEAKNIRTTRMLSSLALRTAKKDSPLGMLRGGEMHLRERAVRVGDDEFPK

GLLDETTTLLFAGHDTQSATLSWGLLRLVDNEKIQNELRVSLFDDVIVEALGLPSKRRKKRASSDGKKAAWATSAFAPML

ESVIRETLRLHPVAPLVVRMLSADVSSAEMTIPKGCAVGVWLSSVHRDDAVWDRPEEFDPKRWTATSHARTGSTGSFTED

SEEDSSLGPASGKPASGLKHKGVGYMPFAYGPRSCVGQHLAQVTMRVALAHLIEAFEFAPSADVDASTPSVGFTVTPSTG

APLRIRLATKIDP*

>CYP802A1 fgenesh1_pg.C_Chr_07.0001000106|Ostta4

MSGKRHQATRANFKRVLGRFALETYAETIGERTRAFVEDLSGRSRSKSEENGEKVVSFRPGVECVDFALDLLFELFLGHV

PDERYKRAMVAYNAGLLSLGKWSPEFKSGRTALDELVRYCENHFRSVVAANELDDPKYFFYKQYSTAKDENGETFSDERI

ATTCVLMVWGAYIEAAALMGHAFTLLGEHADTRRAVAHEFSDAVCSPMDGCRRIATLDDIMALKFTNAVTKESLRVMPQT

AGGLRVNPSDRSFDGYDIPAGYVLTADPRIPFRDEAIFPDPDEFKPERFIAGTAEAGANNVANDTFFPGGMGQHQCPGIN

LATVMTSVFLAEMMSTFGDRGWREKTEKRYVTVPIVILDPSYEVELFV*

>CYP802A1 ost_07_008_042|Ost9901_3 Ostreococcus lucimarinus

69% to Chr_07.0001000106, ortholog

MASRATARAAASHDARAATRRARVGGAARESAARRRASGRATSDVDGASGRATSDVDGASGRATSADAFDLGQAIGTLAR

GERGATLPPGRVGALGVRETLEYLADSNGFVRRRVERYGPIFKTALFFKPAIVFGSREAVREFLKFEGELPADEALPETF

RELHTEYGALRMTGSRHAATRANFGKVLGRAALESYAPAIGERTREFVEDVARRSGKETSSFRPGAECVDFALDLLFELF

LGHVPEAKYKDAMKAYNGGLLSLGKWSSEFKAGKLALEDLTSYVEAHYRGVKARGELDRPEYFFYKQYSQAVDEFDEVFS

DDRIATTCVLMVWGSYIEAAALMGHACVLLGEHDDARRAVLREFERVCCDDENGCRRIGTLADIMSMQYTSAVAKESLRV

MPQTAGGLRVNPSPRKFASFDVPAGYVLTADPRIPFRDEANFPDPDAFKPERFVPGTHEAKQNDVSSETYYPGGMGQHQC

PGISLATVMTQIFLAELVSAFPNGWRGKTAPKYVQVPIVILDREYEIEFLR*

 

Ostreococcus RCC809 micro algae (from Dr. GotohÕs FamAln analysis)

10 sequences

July 17, 2014

 

>CYP51G1 Ostrrcc811.438 Ostrrcc811 + [1:1892]  ( 438385 - 440276 ) Astespec00120.840 + 7:506  ( 1 - 506 ) N   2096.02

88% to CYP51G1 Ostreococcus tauri

MAAPTLASEIVDAVRALPLAVSVPMVLTTVTILVFLLDQLSHGPLRARGSPPVIAVAPVW

GGMMEFLAGPMRLMKKAMPEYGEVFTVPVFHKRITFLIGPKVSEFFFKAKDTEMSQKEVY

EFNVPTFGKGVVFDVDHATRAEQFRFFADSLKSNRLRMYVGMMVKEAEDFFAKWGDEGEV

DLLEQLSELIVLTASRCLLGREIRETLYSEVTSLVHDLDKGMVPLSVFFPYAPIEAHRKR

DAARKKLAMIFDKVIQARRESGASEPDVLQTFIDARYKDGSKLSNDQVLGMLIAVLFAGQ

HTSSITSTWTGLLSIANKSRVIPTLEEEQRKIMKEHGNNLDFDILAKMDELHFAVKEALR

MHPPLIMLLRMAQVPFDVETSDGKKYTIPKGHIVATSPAFAHRLENVYSDPDVYNPGRFR

EPNPEDKAAFASFIGFGGGRHGCMGETFAYMQIKTIWSILLRNFDFELVGNLPEPDYEGM

VVGPKKSCVRYKRRALK

>CYP97E5 Ostrrcc81.197 Ostrrcc81 + [1:2373]  ( 197065 - 199437 ) Micrrcc216.518 + 4:642  ( 1 - 642 ) N   2844.58

91% to CYP97E5 Ostreococcus lucimarinus

MPLDDTVSVARARHSTRSTAAVDDLLVHVPFVRARMSTARATRPRASRDGAHLRMSPSVP

TARRRRRPRANRGTNDRTNDGSSRPDRVRRARRLARIRATARALAREEETMPSDDFTPEE

LKFQDVVSLWVTQILQTYGDAESKDNAPVCEGVIDDLVGGPIFLALYPYFRRYGGVFKLA

FGPKVFMVLSDPVVVREVLKEKPFSFDKGVLAEILEPIMGQGLIPAPYAIWKNRRRQLVP

GFHKAWLDHMVGLFGHCSGELVRNLDAAAAAGETVDMEERFCSVSLDIIGLAVFNYDFGS

VTKESPIISAVYNCLQEAAHRSTFYFPYWNLPFATDIVPRQREFKQNMAVINDTLNGLIA

QAQQYEGTDDLEELQNRDYSKVKDPSLLRFLVDVRGADVTDAQLRDDLMTMLIAGHETTA

AVLTWGLFCLVQKPELMKRIQADIDEVFGDDDRAPTYEDIQRLESVRLCVAEALRLYPEP

PILIRRCLEDVTLPKGAGDREITLIKGMDIFISVWNLHRSPECWENPDEFDPFRFKRPFA

NPGVKDWAGYDPDLLTGLYPNEIASDYAFIPFGAGARKCIGDQFAMLESTVAMTMTLRDF

DFELQKNPEDVGMEMGATIHTAGGLPMKVTRRRR

>CYP97A15 Ostrrcc813.141 Ostrrcc813 - [1:2411]  ( 142647 - 140237 ) Chlarein2.8722 + 12:718  ( 1 - 718 ) N   2139.15

92% to CYP97A15 Ostreococcus lucimarinus

MTTLSTARATPRRRASVSKVSGDARRVVVRSRATPRAVMRRMTSMRSMRERERRGETTTA

TRAENGDGGSGKTLEERIASGEFTKASDTGPFRAVADGLRKLVPEDSGPVGRGVSLSLAR

LSRRWRTEAMSKMPVASGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVSDNAV

AKEVLLTQAKSFSKGLLSEILDFVMGQGLIPANGEVWKMRRKVIVPSLHKKYVTSMVDMF

GDCGLKGMSQLARAETAGESVEMENFYSRYALDIIGKAVFNYDFDSLTTDDPVIKAVYTV

LREAEYRSVTFIPYWKVPPLRWLVPRQRKCQEALEVVNDTLDELISRCKKVVEEEDEEFV

EEYMNTDDPSILHFLIASGDDVTSKQLRDDLMTLLIAGHETTAAVLTWTTFLLAKHPEVK

AKVFEEVDRVVGDRNPTVADMRELVYTTRVINESMRLYPQPPVLIRRALEPVSLGGYNID

AGTDFFISVWNLHRNPRIWDEPDAFKPERFPVEAPMPNEYTEEYAYLPFGGGQRKCVGDQ

FAIFESIVSLAMLMRRFDVELDASKHPDGECGMTTGATIHTTNGLHVKLTRRQGRGGAEM

RGVYTEGKQTLSNLEDVDVAGGSIDAPSASADEFDEAVGEDDDDIADTKEKLERATRIVE

SEKEEVGQAR

>CYP97E6 Ostrrcc814.189 Ostrrcc814 + [1:2126]  ( 188447 - 190572 ) Micrpusi9.1042 + 4:617  ( 1 - 617 ) N   2637.71

87% to CYP97E6 Ostreococcus lucimarinus

MASMPSPTRLPRVATTTTTTTRRVRRDEPSSGHRARVRARALDSKPPAASDAYRGALFPG

VEVPDNDLARSFARLFPWGNGARVTEKVLGDLLKEEVRAAPLFVPLYDYYREYGGVYNLG

AGPKWFVVVSDPVAVRTMFKDRADSFSKGILTDIMEPIMGDGLIPANKEIWAKRRPVIGA

GFHNAWLKHMCDLFGASAMRLADKLDAAAETKETVELEGELYSMALDVIGKAVFNYEFGA

LREETPIIKAVYRVLRESEHRSTFPLQYWQIPGAMDVVPRQKQFKEDMKMINEELSVLIN

NAISSRTETDLEEMERRDYSKVEDASLLRFLVDIRGDEATSTQLRDDLMTMLIAGHETTA

AVLTWTLYLLAQHPEIAEEAVEEINACVSDSNGVPTPEEVRKLQKVRMILAEGMRLYPAP

PILIRRAIEDVTLPRGGNGKEITLKAGTDCFIAVWNLHRSPDLWENPEKFDPSRFSRRFE

NPAIEGWGGLNPDLMTGLYPNEQSTDFSYVPFGGGQRRCAGDQFAMLEAVTAMSVLLKKF

DFKLACSPSDVEMITGATIHTKKGLPMKIKRRATR

>CYP800A1 Ostrrcc86.710 Ostrrcc86 + [1:2834]  ( 709727 - 712560 ) Micrrcc204.71 + 6:504  ( 1 - 504 ) N   1578.14

89% to CYP800A1 Ostreococcus lucimarinus

MVEYVCMTNAKNYRLRMLPDAFRYVIQNKGITGSDGEYNREHRLMCQKPFINSFSLQEFS

STVEERIAYMSNTWREAAQMGGGGPLEINIDNDSQMVTLDVIGKIAFAFDFEQCEAHEAK

TLRGEEGKKDNISKLLDAYNGSSEIMGELFITPGPILKLQNFLGLGRVRELKEQYSILES

VGTKLMSERRELVKERLAAGDDEDYCLLDVLVKAKDADGNALSDADLWGDINDIMAAGHR

TTASNFTVNLWHVARYEHIQRAIEEEVAALGGRPPTFEDVQEGRLPYTQRVVKESLRKYA

PINLFPRLAEGPDTLPSGHQVEAGDFILLSTYAMGRNPRVWVDPDKYDPDRFTDEALYAQ

AEKHANQVARDDPSKLEQARERARRRMTAGRDFTYTPFGAGPRSCIGGVFALLAASTMLA

STVQKFKLSRAGPGRDKLGDELNIMYDTTICFPEGVWINIEPRDKPLGADEEEDAGDDWM

DRAEAAADARLDATR

>CYP746A1 Ostrrcc86.880 Ostrrcc86 - [1:2039]  ( 881176 - 879138 ) Astespec00069.64 + 11:757  ( 1 - 757 ) N   1481.75

79% to CYP746A1 Ostreococcus lucimarinus

MDDDCADVCLDDLPPKIPPRKPIYASREGRERRRGAMRAGSDAGAGRRTRTRAMDASFAS

VSRGVRARGARARCRARRNEAEEMFRGAFDAFAAASLRAIGGVASDVVGGAKGMPIGFPS

GPREDVALELAYDPLKFIERVSRAHGDASGLTLAGERVVLVSSPALARDVLLDKSDCFQK

EGTAFFPGSSLAGNGLLVSDGETWARQRRLSNPAFRRAAVETYARCMVEVGGRLVRDKWS

KRGVRDVYADFNDATLEIVASALFGTDVAGARASKINGAIKDSFEFFGRRAATGMVIPEW

APTFDNIRYNDAVKRLDEEVYAIIAKRRDAAARGDDNGELDLLDRLLRATDDEDADGSGM

SDQALRDELMTLMVAGQETSAILLSWACALIAERPDVGDNIAEEVRELLKSKGTGLDAGD

FRHLPYTEACVLETLRIRPPAYMVGRCASQDVELHQGVFVTKGTTVLIAPYLVQRDPKYW

EDPTAFKPERWLVQSPYSDGTLARDALKNLGPNDAYFPFGGGPRVCIGTGFAMMESVLLL

ALICSECELRIPPNASPPEPKALITLRLESCELAVAPRPRKI

>CYP800A3 Ostrrcc87.620 Ostrrcc87 + [1:2153]  ( 619653 - 621805 ) Micrpusi4.933 + 4:709  ( 1 - 709 ) N   1562.02

65% to CYP801A1 Ostreococcus lucimarinus

MAMGASALVRALVAHVVAARERVSLVDVARALIAFALCAGGWFLVARARARAVVANAGVE

TMRWRPKVLWRLYQKSQGSLLRRVEARFSRARSRRAFGAVVGTCPFVHVGEAKLARDVLR

ETSVKAPLYHAFEAFSGKGIFTAEGKDWEDKRSDVLKAFNVVGLTPLRDRAVEESARMVR

DIKGKLLQSLHRRGNVLEMQMLPVLQRLALRVTFGYLTGVSLDEACKKFGQDPARVENSY

LKASTFLRQSIPARARSIWMFSDVLYRLTPVGFSEWIKIKVTRKVSSLALRAAKEDSPLG

VIRSGKSHFKDGPVFVRFKRFPRGMLDEVTTLLFAGHDTQSATLSWCLLQLVDKVEIQEE

LRSSFNDRTMADALGLSWTGNKRWKDVDAEETPTPAWATSAFAPLLEAVLRETLRLHPAA

PLVVRKLTSDVKSKDDIIPKGCAVGVWLSSVHRDEEVWDSPEEFDPSRWLGHAARHVRAG

SASSFTEDEDDAQGSPLSRATSDRASPRPDGALRHKGVGYMPFAYGPRSCVGQQLAQVTM

RVALAHLIESFVFTPSDDADARSPSVGFTVTPTTGAPVRVRLAK

>CYP745B1 Ostrrcc88.255 Ostrrcc88 + [1:1934]  ( 254795 - 256728 ) Chlarein5.207 + 10:579  ( 1 - 579 ) N   1498.39

85% to CYP745B1 Ostreococcus lucimarinus

MTSASVERVAFGVAIIALAMHVAWRVVVERVVRATLASARWVRREWVLATGGARRAARYV

PALGHTIALFRAVGSYPCTWDLFARWGVEAAPRPARVQIFQRHCVVVADPALVKRVMQTN

LKGYKKDTEFSYEPFLEILGTGLVTSEGETWKAQRQRISSALRIDILDDIIAIATRAVER

LSEKLEGAKRTRKPVEMAEEFRLLTLQVIAEAILSLTPEQSDEVMPNLYLPIMEECNRRS

LEPWRKFLPTPEWFAHRKRVAMLNAYIIDMIRARWKKRMSGVKNPNPDILDRVLASVDED

EYGAKVERQMCFEIKTFLLAGHETSAAMLIWTTWELVNNEEKMKKAVDEAKRVFAEVKPG

ALPTRKQLDKLDYNVSALKESLRLYSVVPVVTRRAVDDDVLGGCRIPKGTTVIISLQGVH

HREDLWPNPLAFEPERFTGGKGDELGNYAYLPFIQGPRNCLGQYLALLEARVVLATLLKR

FKFVSASSKNGAKHTKAIPIAPADGMWFTIE

>CYP97C18 Ostrrcc89.639 Ostrrcc89 - [1:2615]  ( 640141 - 637527 ) Micrpusi3.379 + 4:644  ( 1 - 644 ) N   2740.75

93% to CYP97C18 Ostreococcus tauri

MRAMATSGGARVGTPMTRRTRARVARSTARVAMTRATRRASFSHRARRVVRPNATENVTE

EAFDEADLDNIVFADLSEEAAISNKSGAGATMAAPDWMTQLNRLWGGESEIPVADAKLED

ITGLLGGGLFQPLFKWMRESGSVYLLPTGPITSYVVVSDPACIKQVLFNYGSKYIKGTIA

EAGEFLFGLGVALQELEPWKIRRKAVAPSLHRKYVEAMVDRCFGPCADRMVTMLESESAS

GPVGGVNMESRFSKTALDIIGISVFNYDFEALTTAAPVIQATYTALKEVETRSMDLLPTW

RLPEQFLRAVSPRQKAAQDAVTIIRDVTQKLVDDCKRMVEEEEKVGGAEEWARDYLNESN

PSVLRYLIAAREEVSSTQLRDDLLSLLVAGHETTASVLTWGTYELLKPENAEQLRLLRAE

LDEVLGTRPYPTFADLPNMPYLERCFHESMRLYPQPPVYTRRAVVEDVLPNGMTVPKNQD

LLVSIYNLHRSPDNWGPTSQEFEPMRFGPLANGQPNELNTDYRYVPFSAGPRRCPGDKFA

VYEGIVIWATMIRRLDLELKPGHDVVMTSGATIHTKNGLLATVKPRAMREAPVSSAGKCP

MGH