Carica papaya cytochrome P450 genes in name order.

Created Aug. 30, 2007, modified May 16,2008

D. Nelson

All genes are now named.

 

182 sequences in 50 families

143 genes + 39 pseudogenes

note: two genes may have allele pairs or duplicate sequences

This leaves 141 distinct genes

 

This file has some Vitis vinifera sequences included since they

Were often the closest match.

 

>CYP51G1

$supercontig_119:252784,254990

GS_ORF_31_from_supercontig_119 CYP51G1 82% to Arab. 51G1

88% to Vitis vinifera 51G1 (best GenBank hit) , 85% to Nicotiana tabacum

MDVDNKFFNMGLLILATIVVAKLISALVMPRSSKRLPPVVKSWPLVGGLLRFMKGPIIML

REEYPKLGSVFTLPLLNKKITFFIGPEVSAHFFKASESDLSQQEVYQFNVPTFGPGVVFD

VDYSIRQEQFRFFTEALRVNKLKGYVDQMVTEAEDYFSKWGDSGEVDLKYELEHLIILTA

SRCLLGREVRDQLFDDVSALFHDLDNGMLPISVIFPYLPIPAHRRRDRARKRLAEIFTSI

IASRKHAGNSENDMLQCFIDSKYKDGRPTTEGEVTGLLIAALFAGQHTSSITSTWSGAYL

LRHKEYLSAVVEEQRELIEKHGKKVDHDVLSEMDVLYRCIKEALRLHPPLIMLLRSSHSD

FSVKTRDGKEYDIPKGHIVATSPAFANRLSYIYKDPDRYDPDRFAAGREEDKVAGAFSYI

SFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELISPFPEIDWNAMVVGVKGKVMVRYKR

RQIA*

 

>CYP51G1 AM475390.2 Vitis vinifera

9521  MDVXXKFFNAXFLLVATLLVAKLISALIIPRSKKRLPPTIKAFPLIGGLIRFLKGPVVML  9342

9341  REEYPKLGSVFTLKLLNKNISFFVGPDVSAHFFKAPESDLSQQEVYRFNVPIFGPGVVFD  9162

9161  VDYSVRQEQFRFFTEALRVTKLKGYVDQMVMEAE   (0) 9060

3862  DYFSKWGDCGEVDLKYELEHLIILTASRCLLGQEIRNKLFADVSALFHDLDNGMLPISV  3686

3685  IFPYLPIPAHRRRDQARKKLAEIFANIIASRKETGKSENDMLQCFIDSKYKDGRPTTESE  3506

3505  VTGLLIAALFAGQHTSSITSTWTGAYLLRHKEYLSAVQDEQRSLMKKYGSKVDHDILSEM  3326

3325  DVLYRCIKEALRLHPPLIMLLRSSHTDFSVTTRDGKEYDIPKGHIVATSPAFANRLPHIY  3146

3145  KDPDRYDPDRFAVGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELE  2966

2965  LISPFPEVDWNAMVVGVKGKVMVRYKRREL  2876

 

>CYP71B46 old Bx

61% TO CYP71B35, three frameshifts in mid region

FGPP_ORF_70_from_ supercontig_33:452619..454410 (+ strand)

MIASFIPGWLLLLLLFTVLVVVKKKIGSRRQTNLPPGPPKLPIIGNLHQLGSLPHRSLAQ

MSKKYGPVILVQLGGVPTVVVSSAETAKEVLKVHDLDCCSRPSLAGTGRLSYDYLDIAFS

PFSEYWREVRKICVLEIFSTKRVQSFRFIREEEIASQMKFIAQSASTSSPVDLNQKLLAL

TANVICRVGFGMSFQGSEIDNDRFHEVIYEALAMLGSFSAADFFPYVGWIADRLSGLHAR

REKSFHDLDAFYERAIDHHRRSKKAEEGKEDIIDVLLKLETEK

VEIGDKPLS

RTHIKAI

LM

DVFLAGIDTAALTMTWAMTELIRNPRVM

KKVQAEIREKIGNRGKVREEELDQLEYLQLVVKETFRLHAPGPLLIPREAMTEFKISGYT

IYPKTRIQVNVWAIGRDPNIWKDPEEFIPERFQNSSIDFKGQNFELLPFGGGRRGCPGVY

MGAVMVELALANLLYCFDWELPQGMKKEDISTEEAAGLTVHKKEHLRLVPITYN*

 

>CYP71B47 old By

56% to 71B35

FGPP_ORF_71_from_supercontig_33 class=ORF position=supercontig_33:457127.

.458929 (+ strand)

Frameshift in first exon after RPKL

Intron boundary was not correct in model

MIGSFISGWLLLSLLFTMLALMKKKIESRRPKL

APGPPKLPVIGNLHQLGSLRHRSLAQ

MSKKYGPVMLLQLGGVSTVVVSSAETAKQVIKVHDLDCCSRPSLAGTGRLSYDYLDVAFS

PFGDSWRELRKICVLEIFSTTRVKSFRFIREEEVASLMKVIAQSASTSSPIDLNQKLLAL

TANVIYRVGFGTPFQGSEIDKDRFYEVFYEAMEMLGSFSAADFFPFIGWIADRLSGLHAR

REKSFHDLDAFYEKVIDNHLKSKKVEGKEDIIDVLLKLEGEKVEIGDKPLSKQHIKAILM

DVFLGGTDSAALTVIWAMTELSRNPKVMKKVQAEIREKIGNKGKVHEEELDQLEYLQLVVKETLRL

HPPGPFLLPREAMSEFKINGYTIYPKIQIQVNIWAIGRDPNIWKDPEEFIPERFEDSSID

FKGQNFELLPFGGGRRGCPGVYLAVLMVELALANLLYYFDWELPQGVKKEDISTEETTGL

AAHKKEHLKLVPIIYNYCP*

 

>CYP71B48 old Bz

57% to 71B34

FGPP_ORF_72_from_supercontig_33 class=ORF position=supercontig_33:464744..466583 (+ strand)

MVPFTVPAWLPLLLLLSFLVAVKKVMESKKRHPPGPPALPLIGNMHQLGKLAHQSLYQMS

KKYGPVIRLKLGSVPLVVVSSPETAREILKVHDTDTCSRPKLLGTGNYSYNYLDIAFAPF

GEYWREMRKISVLELFSNKRVQSFRFIREEEVDSLVESVSQSAASKSPVDLSEKLLFLTA

NVIWRVAFGGSFEENKCESGVFQEKVNEATSLMGCFAASDFFPCVGWIVDRITGLHGRLK

KSAKEMDIFLQKTIDKHEGKKVEEGKEDIVDVLLKIEKQQKEQGSVTLTRSHIKAILM (0)

DVFIAGIDTAEITMVWALTELMRNPRVMKKVQAEIREVVGNKGKVSEDDLEKLAYLNMAVKE

TWRLHPPGPLLIPREVISPFKINGYNIYPKTRVQVNAWAIGRDPKVWKDPEEFLPERFAG

SSIDFKGQHFELLPFGGGRRGCPGINMGNTLLQLALANLLYRFDWKLPDGMSKEDIDMEE

APGLTVHKKTHLELIPDLLN*

 

>CYP71B49 old Bq partial seq. exon 1 only

GS_ORF_53_from_supercontig_33:481289..493164 (+ strand)

Exon 2 in a seq. Gap

MVAMESLWFPLLLLALVLIIFLRKPQNRKVPPGPPKLPIIGNLHQFGDLPHRSLWDLSTK

YGPIMSFKIGSLFTFVVSSAETAKDVLKSHDLQTCSKHKFVNTKKLSYNFLDIAFSPYSD

YWRDVKKLAILEVFSIKRVQSFRFIRENEVALLLDAISQAASSSNPVNLTYQMFGYSASI

LFRIALGYSFHGSDLDKGSFYCLFHDISTLLGEVNAEDYIPYIGWIVDRINGHHAKLERV

FHEMNSIFENAINIHLDPKKNNQQSKDIIDVMLELDVDNQGRSAEPFVQRNHIKGLLM (0)

 

>CYP71B50P pseudogene 1

41% to 71B24

Pseudogene fragment after GS_ORF_53 sequence gap

GS_ORF_53_from_supercontig_33:481289..493164 (+ strand)

MMKITQDEVRNCKEKKEKVK*DNLD*IQYLKLVIKDTLRIHNVGSLLVV*EVMYQI

KINKYYVLSKDLIIDNTWRITRDLNYCDKIKYFFPKRFTKKIVDFR

 

>CYP71B51P pseudogene 2

Pseudogene 38% to CYP71B36

Located inside GS_ORF_54_from_supercontig_33:493368.

.515729 (+ strand)

PLFLLAIMLIILLTKPHNMKVPSRPSKLPILGNLHQFDNFPHRSLWDLSIKYGYLMFIKI

SYLSIFVVSSAKTVKEIFKFYDLQTCNRHKLISNWKLSYNFLDIGLFSYSNYWKEIKKLV

VLEIFIIKRVQTFRFIREDEVGLLLDIIS*ATSSANPINLAHQVFIYSVNIIFSLTLGYR

FRGSDHDKDNFHHLFHDISCLMGEFNVEDYIPYMGWMIDRVNDHHKKLERVFHELDIIF

*NAIHVHLHPERNNQQNKDIINVMMELDKNNEDQ*IELSIQFDHIKGLL

NILFSRIDTNANTIIQAITV

PRVMKVAQDEVRSCIGKKKRVLEDDLDQLQYLKLVIEETLRIHHVAPLLVAREVISHF

QINGMAFFLKT**FLILGELQEILNIGINLKSFF*KYL*IIFFYFKEQHFEFLQFGSGRR

ICP

 

>CYP71B52P pseudogene 3

46% to 71B2

FGPP_ORF_87_from_supercontig_33:565711..567427 (+ strand)

One stop codon, one frameshift, mid region not well conserved

May be a pseudogene

MNLVLFPIFLFALLLMVLLTRPQKRKVPPGPYKLPIIGNLHQFGDLPHRFLWDLSIKY

GPLMFIKIGSLSTFVVSSTEVAKEILKVHDLHTCSRPKLVNTRRLSYNFFDIGFSPYSDY

WRELKKLVVHEIFSIKKVQSFRFIREDEVGFLLDVISQAASSADRVNLTXXXXXXXXXXXXXXX

LGYNFRGSDHDNGSFHRLLNDVLT*WGEFSAEDCIPYVGWIIDRVNGHHKKLE

RVFHELDTIFQNAIHVHLHSEKNQQNKNIINVMLELDKDNQDRSTEPFLESDHIKAVLM (0)

DIFFGGIDTSA

NIIIWAMTELIRNPRVMNIAQNEVRSCIEKKERVSEDDLEKLQYLKLVIEETMRIHFLV

PLLTPREVISHFQINGYDIFPKDLIIINAWGIARDPNYWDKSEEFFPERFIDNPVDYKGQ

YFEFLPFGSGRRICPGMNMGLAIIELALANLLHCFNWEPPKGIKNHDISLDEEGGITLFK

KMPLELVPIAYPHS*

 

>CYP71B53P pseudogene 4

44% to 71B36

GS_ORF_59_from_supercontig_33:568355..570927 (+ strand)

Frameshift after NIAF, missing C-term

MDYVWFPFFLLAFILIILLTRPQKKKVPPGPSKLPIIGNLPQLGDLPHRSLCDFSFKYGSLMFIKI

GFLSTFVVSFAETAKEIFKTYDLHTCSRSKFISTRRFSYNFLNIAF

PYSNYWRELKKLVVCEIFSIKRIQSFQFIWEDEVSLLLDVISQAASSSNPINL

THQIFTYNASIIFRMALGYNFRGSDHDKSSFHRLLHNISSLLGEFSAEDYLPNLGWIID

RVNSHHEKLERVFHELDTIFQNAIYGHLHLERNDQQNKDIIDVMMELDKDNQYHSNKSSL

QSDNIKGLLM (0)

DIFFGGIDTSANTVMWAMTELIRNPRVMKIA*DEVRSCIGKKKRVSEDDLDQLHYLKFVI

XXXXXXXXXXX

LLAPREVISHFQINGYDIFPKDLIIVNVWAITRDPNYWDKSEEFFPERFINNSIDFKRQH

FEFLSFGSGR

 

>CYP71B54P pseudogene1

supercontig_144:757842,759880

GS_ORF_65_from_supercontig_144 52% to 71B36 between I-helix and PKG

pseudogene fragment (-) strand runs off contig upstream

flanked by a reverse transcriptase

47% to 71B2

DVYVGAIGTKQITMVSVLTD

LMKN

SRVIKKVQGEIIEVIGTKGKVNEDDVGKLEYLNMVVTENWRIHPPTAISAPKEVMFGFEV

DDHKIYPKT* IHVNVWAIG*GPKVWKDPEEFLSESF

AGSSIDFKG*HFKLLSFSAGRRICLAINMVNTMVEL

ANLLYLFD*KLPEWLSKEDINMDEALSPTAQKKTHLVLVPVAYV*

 

>CYP71B55 old Ba

supercontig_144:653105,659677 57% to 71B37

MFLFIIPA

WLPLLLLLSVLLVMMKKVIESKKQHPPGPPGLPLIGNMHQLDALVHQSLWQMSKKYG

PVIRLKLGSVSLVVVSSAETARQILKVHDIETCSRPKLLATGIFSYNYLDIGFTPFGEYW

KEVRRISVHELFSNSRVQSFRYIREEEVALLVRSISESSASNSPVDLTEKLFFLTSDVIR

RVAFGGNFEKNKCEKGGFQREINETMTIIGSFAASDFFPYVGWIVARLTGLKGRLQKSVQ

ALDAFLQETIDKYEGHNVEEGNEDLIDVLLKIEKQHKEQGSATLTRTHIKAILM (0)

DVYVGAIGTSQITMVWALSELMRNPRVLKKVQAEIRDVIGNKGKVNEDDVEKLEYLTMVV

KETWRLHPPAPLLAPREVMSQFEVNGYKIYPKTRIHVNVWAIGRDPKIWKEPEEFLPERF

AGSPIDFKGQHFELLPFGGGRRICPGSNMANTLLQLTLANLLYRFDWMLPERLSKEDINM

DEAPGITLQKKTHLVLVPVAHV*

 

>CYP71B56P pseudogene 5

73% to CYP71Ba

supercontig_144: 640976,642532

MVPFTMPAWLPLLLLLSVLLVVMKKVMESKKQQPQGSSSL

LIGNMHQLGALAHQSLWQMSKKYHPLIQLKLGSVPFIVVSFPEIARQILIVHDNKTCS*P

KCFFSYNFLDIGFTPFGEYWKEIRKISVHEFFSNS*VQLFRYIREEEVTSLIQSIS

QSAASKS

LVDLT*KLLFLTADVIWRVAFGGNFEKNKCESGEFQRKVRETTSLMGSFAASDFFPYIG

RIVDRLTGLYGSLQKSTQALDAFLQETIDKCEGHNVEEGKEDLIDVLLKLEKRHRE*GSV T

LTRTHIKAIL

SVYVGAIDASQITVVWALTELMRNPRVMKKVQAEIRDVIGNKGKVKENDIGKLE*LK

xxxxxxxxxxxxxxxxxx

REVMSGFEVNGYKIYPKTRIDINVWAMGRDSKIWKDPEEFLLEIF

LGSLIDFKGRHFELLPFGGGRRTCPGINMANTMVQLTLANLSYCFDWKLP*GLSKEDI

KMEETRGITAHKKTYFVLVPVACV*

 

>CYP71B57 old Bp

78% to 71Bz

GLHM_ORF_52_from_supercontig_144:634198..635833 (- strand)

MVPFTIPAWLPLLLLPCTLLVLMKKVMESKKQHPPGPPGLPLIGNMHQLGALVHQSLWQM

SKKYGPLIRLKLGSVPLVVVSSAETARQILKIHDIETCSRPELLATGSFSYNFLDIAFAP

YGEYWKELRKISNNELFSNKRVQSFRFIREEEVASLVQTLSQSAASKSLVDIKELLFSLS

TNVIWRVAFGESFEENKWESRVFQVKLKEAISLLGTFSASDLFPYVGWIIDRLTGLHGRL

QKSVQEMDVFLQEIIEKHEGKKVGEGKEDIVDVLLKIEELQNEQGSVTLSRNHIKAILKD

VFAAGIESTGITMVWALTELMRSPRVMKKIQAEIRDVMGNKGKVNEDDIEKLVYLNMVVK

ETWRLHPPAPLLIPREVMSPFKVNGYKIYPKTRLHVNVWAIGRDPKIWKDPEEFLPERFA

GSSIDFKGQHFEFLPFGGGRRACPGINMGSTLVELTLANLLYRFDWKLPNGMSKEDINID

EAPGISIHKKIPLQVVPAAYI*

 

>CYP71B58P pseudogene3

supercontig_144:615890,620568 pseudogene 48% to 71B34, 47% to 71AS1

75% to 71Ba

LFLVRLQLRYLKKVMESKKQSPLSPSRLPLIVNRHQLGGQLHQSLWQMSKKYGPIVRLK

LGSVSLVVVSSAETAR*ILKVEDFQTYNRPKLLATCIFSYNYFVIGFTPFGEY*KEVRKI

SIHELFSNSRF*SFRCIREEEVALVFQSISQSAASKSPAELTEKPFFLTSDVIRRVTSEG

NFEKNKYEGGGFQREINEMMSVIGSFAASDFFPYVGWIIDRLISLKGRL*KSVQALDAFL

*KTIDKYEGHKEEKGK*DLINVLLKIKK

QHKEQGSITLTKTHIKAILM

DVYVGAIGTLQITMIWTLTELMRNQKSRRNTILF*RYYEK*

KKVNEDDVGKLEYLNMVVKETWRLHPPAPLLVPIEVMSLVEVNGYKIYPKTRIHVNVWAI

ERDPQIWKDPEEFLLDRFAGSPIDFNGQHFQLLPFSGGCRICPDINMTITLVQLTLANLL

HCFDWKLLERLSKEDINMDEAPGITLHKKTNLVLVPVSYV*

 

>CYP71B59 old Br

supercontig_144:585007..609465  exon one , exon 2 in a seq gap

one stop codon present, 47% to 71B35, 83% to 71Ba

MVPFTIPAWLPLLLLLSVLLVVMKKVM*SKKQH

PPGPPGLHLIGNMHQLGGLLHQSLWQMSKKYGPVVRLKLGSVSLVVVSSDETARQILKVH

DFQTCSRPKLLATGVFSYNYLDIGFTPFGEYWKEVRKISVHELFSNSRVQSFRYIREEEV

ASLVQSISQSAASKSPVDLTDKLFFLIANMILRVAFGGKFEKNKCESGVFQRNVKETTSL

MGSFAASDFFPCVGWIVDRLTSLHGRLQKSAQELDAFLQETIDKYEGHKVEEGKEDIIDV

LLKIEKQQKEQGSVTLT

 

>CYP71B60P pseudogene2

supercontig_144:568153,568872

GLHM_ORF_44_from_supercontig_144

Pseudogene 50% to 71B34, 51% to 71AS1

MLKSIPITRPLGALLIFLNTSARWSENKLNIGHSLNGSVLLVVMKKVMESKKQDPPGRPG

LPLTGSMRQLGGLLHQSLWQMSKKYGPVVRWKLGNVSLVVISSAETPRQILKVHDFETCG

RPKLLATGIFSYDYLDIGFTPFGEYWKEVRKISVHELFSNSRVQSFRYIREEEIASLVQS

ISQSAASKSPVDLTEKLFFLKANVIWRVAFGGNFEKNKCEHVSEEXXXXXXXXXX

GSFAASDFFPYVGWIVDRLTGLYGRLQKSAQAL

DNFLQETID*YEGNKVEEGKEDLIDVL*KLEKQQ

XXXXXXXXXXXXXXXXXX

DVYVGGIDTSRITIVWALTELMRNPRVMKKVQAEIKGVIGNKGKAKEDDIEKLEYLNMVV

KETWRLHPPAPLLVPREVMSQFEVNGY

KTYPKTGIHINVWATGRDPKFWKDP*EYLPERFXXXXX

DFKGQHFEFLLFGGGRRGCPGINLAYKMVRLALANLSD

HFDWKLPEGLRKEDINVDEAPGITVPKKTNLVRVPVSHV*

 

>CYP71B61P pseudogene 6

73% to CYP71Ba

supercontig_96:1081786,1082412

IIHMC*NIYVGGINSS*ITIVWELAELTRNPRVMKKVQVEIRDLIVNKGEVKENDVEKLE

1081966 YLNMVVKETWRLHPPGPLLALREVMSEFEVNGYKIYPKTRIHVNGWAIR*DPKIW

1082131 KDPKEFLSERF

AGSSIDFKGQHFELLSFGEGRRGYPSMNIAYTMLRLALVNILYNFDWKLLEGLSKEDINM

GETRGITAHKKTHIVLALVAYV* 1082412

 

>CYP71B62P pseudogene 5

44% to 71B37

supercontig_881:382,1216

MVPFIIQTWLP

LLLLLSVVLVVMKKVIESKKQHPLGLPGLLLIGNPHKLDTLLH*SWWQILKKYDSV

V*LKVGSVSLVVVSSPGTTRQILIVHDTKTFSRPRLLAIGIFSYNYLDIDFAPFGE

FWRIVEVRKISVHEFFSNSRVQSFRYIREEDVALLIRSISQSAASKSPVDLTEKLFFLTS

DVIRRVALGGNFEKNKCKSGRFQMEINEMTSIIGSFAASDF

FPYVGWIVDRLTGLKGRLQKSVQALDSFLQETIDMYEGRQVEEGKEDLI

DVLLKLKKQ

 

>CYP71AN6 newe1

80% to 71newe2, 56% to 71AN1

51% to 71A10, 50% to 71A1

supercontig_103 :4840..6482 (+ strand)

GLHM_ORF_1_from_supercontig_103

MASRTPFLDQLWQQLHREDVCFSLIFLFLAIYLFKLMNSRRIRLNLPPSPPRFPIIGNFC

QIGSLPHHSIKAISEKYGPLMLLHFGSTPTLVVSSADMAREMFTTHDIVFSNRPRTLAAN

ILSYGCTDVGFSPYGDYWRQARKICVVELLSLNRVNSFQLVRDEEVTEAIESIRRTSLSG

SLVNLSKLLSVLSANIVSRCVIGRKVNEVGENTKLGKLANKMTKEINEFGFSDRFPYFYL

GYLIDILTGFVARLKETSKEFDVFLDQVIDEHMTLGNSNDEKLVDNHKKNFLHILLQLQQ

SNSLDFEFTRDNMKAILL (0)

DMFVAGIDTTSTTLEWTMAELMRNQNILKKAQDEVRSVVGKK

SKVEGNDVNMMNYLKCTIKESLRLHPPAPLLVPRETSKAINLGGYDIPPKTSVIINAIKI

QKDPNIWDRPEEFMPERFEENLVDYRIQDFQFIAFGGGRRQCPGLRFGVTSIEYILASLL

YWFDWRMLEGKRGEDLDMTETNGLTVHKKIPLHLVAIPYSP*

 

>CYP71AN7 newe2

44% to CYP71A1

supercontig_103:12600,18799  with a sequence gap before IPPK

MSSRTPFLDQLWRQLHRA

EVCFSLIFLSLAIYLFKLMSSRRTNLNLPPSPPRFPIIGNVFQMGS

LDFLSSATFSRWGPIMLLYSGSTPTLIVSSADMDREMLTTHDIVFSN

RPRTLAANILFYGCTDLGFSPYGDYWRQVRKICVVEMLSLNRVNSFQLVQDEEVVETIES

IRRTCLYGTLVNLSELLSILSTNIAFRCVIGRKVNKVGENIKLGKLVNKLTKEINEF

NFSDTFSYFYLGYLIDVLTGFTARLKETSREFDAFLDQVIDEHKTFGNSNDEEDNQKNNF

VHILLQLRTE

IPPKTNVIINAMAIQRDPNIWESPEEFMPERFK

ENPVDYRIQDFKFIAFGGGRRQCPGLRFGVTSVECILANLLCWFDWKMPEGKRGEDL 5228

DMFLFTLLQHPTLLDVCNLMLIVLRT*

 

>CYP71AN8P pseudogene4

29% to 71B35

GS_ORF_381_from_ supercontig_3:2964847..2976941 (- strand)

INLLSFSFTPTLVVSADSAGRVFTTHDISSSLTDPEPSPYANYWRQVKK

ICFVEFLSLKSVSSFQFVGDQEAVE*LTPYNQEAS

LADRVYCNC*FPTFYC*DILGM*QLTKLTRKSMEQFNEFNFSGGFSYFEYFIDVLTGLTT

CFKQTSREFDAFLVQVIKKHQTNDDELTDCRNNFVHAVLQLQ*TNSL--DFKLTQHKMKAILLH

 

>CYP71BE1 AM445470.2  Vitis vinifera 52% to 71D16

MEFPSSFLFPFLLFLFILFKVSKKSKPQISIPKRPPGPWKLPLIGNLHQ

LVGSLPHHSLRDLAKKYGPLMHLQLGQVSMLVVSSPEIAKEVMKTHDINFAQRPHLLATR

IATYDSTDVAFSPYGDYWRQLRKICVVELLSAKRVKSFQVIRKEEVSKLIRIINSSSRFP

INLRDRISAFTYSVISRAALGKECKDHDPLTAALGEITKLASGFCLADLYPSVKWIPLVS

GVRHKLEKVQQRIDGILQIVVDEHRERMKTTTGKLEEEKDLVDVLLKLQQDGDLELPLTD

DNIKAVIL

DIFGGGGDTVSTAVEWTMAEMMKNP

EVMKKAQAEVRRVFDGKGNVDEAGIDELKFLKAVISETLRLHPPFPLLLPRECREKCKIN

GYEVPVKTRVVINAWAIGRYPDCWXEAERFYPERFLDSSIDYKGADFGFIPFGSGRRICP

GILFGIPVIELPLAQLLFHFDWKLPNGMRPEDLDMTEVHGLAVRKKHNLHLIPIPYSPLT

VG*

 

>CYP71BE2 newa v1

59% to AM445470.2  Vitis vinifera

51% to 71D55 Hyoscyamus muticus (Egyptian henbane)

95% to CYP71newa v2

supercontig_1950:11781,9997

MDFESFFSTSFFTFLFLLLTLKIVKNTKAKNKRAAKLPPG

PWKLPLIGNIHQLICSLPHRSLRNLAK

KYGPLMHVQLGQVSTVVISSPEIAEEVLKNHDIVFSNRPRLVASDILAYNSTDIIFSPYG

DYWKKLRRICNIELLCPKRVQSFRLIREEEVARLIKTISLSEGLPINLSEKVFSLTYGIT

SRAAFGGKWKDQEALVSIVKKGVALASGFCLADMYPSCKVLELASGLRFTLEKLHKESDR

ILGDILNDHKQKRLKRTGATSPEQEDLVDVLL NFQRDGDLPLTDNNIKAVIL (0)

DIFGAGSETSSTTVEWAMSELLKNPRLMKKAQ

TEVRQVFDAKGYVDETELHELKFIESVVKETLRLHPSAPLLVPRESSEDCVIKGYEIPAN

TKVIVNGWAIGRDPKYWSEPEIFDPERFLDSRIDYKGKDFEYIPFGAGRRICPGISFAIP

NIISPLAQLLYYFDWKLPGGMNYEDLDMTEAFAVTVRRKYDLVLIPISYHPLSIK*

 

>CYP71BE3P newa v2 pseudogene

supercontig_12:1621528,1630869

95% to CYP71newa v1

Combined 44% to 71X11, 53% to CYP71D10 AF022459 Glycine max

Frameshifted twice in exon 1, one stop codon, possible pseudogene

MEFESFFSTTFFTFLFLLLILKIVKNTKAKNRRAAKLPPG

PWKLPLIGNIHQVICSLPHRSLRDLANKYGTLMHLQ

LGQVSTVVI

SSPEIAEEVLKNHDIVFSYRPCIVASDTMFYNSTDIIFSPYGDYWKKLRRICNIELLCPK

RVQSFRLIREEEVARLIKTISLSEGLPINLSEKVFSLTYGITSRAAFGGKWKDQEAVVSI

VKKGVELASGFCLADMYPSCKVLELASGLRFTLENLHKESDRILGDILNDHKQKRLKRTE

ATNPEQEDLVDVLL

NFQQDGDLPLTDNNI*AVIL

DIFGAGSETSSTTVEWAMSELLKNPRLMKKAQTEVRQVFDAKGYVDET

ELHELKFIESVVKETLRLHPSAPLLVPRESSEDCVIKGYEIPANTKVIVNGWAIGRDPKY

CSEPEIFDPERFLDSRIDYKGKDFEYIPFGAGRRICPGISFAMPNIILPLAQLLYYFDWK

LPGGMNYEDLDMTEAFAVTVRRKYDLVLIPISYHPLSIK*

 

>CYP71BF1 newb

supercontig_131:538118,539754 52% TO 71A26,

81% to CYP71newc seq GLHM_ORF_74_from_supercontig_131

52% to 71AR1 strawberry, 53% to 71AQ1

GLHM_ORF_73_from_supercontig_131

MWNSLWFTVLFIFLFRYFFLRCYSSSKKNSPPSPPKLPIVGDLHRLGSSPHRSLRALAQQ

YGPFMLLRFGSVPVLVISSAHAALDVMKTHDNIFSSRFKSSVFDKLVYNCKDVVLAPYGE

YWRQMKSICVIHLLSSKKVQCFQKVREEETMILTKKIQESYCSPMNLSETFTVLANDILC

RVAFGRKYGGDEENGKKLKELLTRFAQLTGTVDIGDYIPWLSWVSCVNGLNTKLEKLAKE

LDDLFEGIVEEHVNHLKNKSNTSDYGDVQDTDSKDFVDVLLWIQRENTIGFPIDRVTIKA

LILDMFIAGTDTTSTTLEWAMTELLRHPKVMKKLRNEVRTIAGDKSNIIEEDLGKMKYLK

AVIKEVLRLHPPLPLLMPRESVKDANVRGYDITAGTQVLINAWAIGRDPDSWEEAEEFKP

ERFLNSCIDFKGHDFQLIPFGAGRRGCPGIHFATILIEMILANVLHKCDWKPMPYRGAKE

HGIDLTESAGISVHRKFPLIAIPSPPRF*

 

>CYP71BF2 newc

supercontig_131:541317,550786

52% to 71A26 FRAMESHIFT AFTER WTM IN EXON 2

81% to CYP71newb

54% to CYP71AU1 tobacco and 71AU2 in tomato

MSIMLNSLCFSVLSVFLFLYFFLKYYCSS

EKILPPSPPKLPIIGNLHNLGLHPHRSLQALAQQCGPFMLLYFGSVPVLVISSANAAIDV

MKTHDNIFSSRIKSSVFDKLVYNCKDVVLAPYGEYWRQMKSMCVVHLLSNKKVQSFQKVR

EEETTILLKKIQESYYYSPMNLSETFAVLANDIVCRTAFGRKCSGDQESGKKLKELLARF

AELIGTFDLGDYIPWLSWVSYVNGLNARLEKVAKELDDLFEGIVEEHANRLKKKCDASDY

DDVQDFVDVLLRIQKENTTGFPIDRVTIKALIL (0)

DMFIAGTDTTYTTLEWTM

TELLRHPKVMKKLQ

NEVRTTAGTKSNVLEEDLGKMKYLKAVIKEVLRLHPPLPLLIHRESIKDVNIKGYDIAEG

TQVLINAWAIGRDPESWEEVEEFKPERFLDSCVDFKGHDFQLIPFGAGRRGCPGIQFATI

LIEMVLANILHQCDWTPLPYHGAKEQEIHLTESTGISVHRKFPLIAVPSPPCL*

 

>CYP72A73 old a

57% to 72A15

GS_ORF_91_from_supercontig_77

supercontig_77:919165,929164

MLTTIATTAILIAFVICVWRVLNWVWLNPKKLEKWLRQQGLDGNQYRLLHGDARESSMML

VEASSKPISLHHDIAPYVTPFLYQSLKKY (1)

GKNSFTWHGPTPRVTIMNPEQIKHVFAKTNE

FHRQELSPLLKLLVTGLVSHEGEKWAKHRRIINPAFHQEKLK (0)

NMLPAFYESNRDMMNKWEELVSDKEWIELDVWPHLNDLTRDII

SRTAFGSSHEEGKRIFQLMDELAILIQQLVQNVYIPGWR ()

FLPTKFNKKLKACDTEIRYLL

KGIINKREKAMKAGEVDNNDLLGMLMEANSREIQENGGGTGMSLTDVMDECKIFYFAGQE

TTSVLLVWTMVLLAKHPIWQTRARDEVLEVFGNNRPDFNGLNRLK ()

IVSMIIDEVLRLYPPATQLVRSIKKETRLGNLVLPAGVEINMPVMLVHHDREL

WGDDATEFKPERFAEGVSKATKNQVSFIPFARGPRICIGQNFALTEAKMALAM

ILQRFTFELSPSYAHSPILVATLHPQHGAPLILRRL*

 

>CYP72A74 old b

57% to 72A15

GS_ORF_92_from_ supercontig_77:929165,939164

MSTTYIHWVWLRPKKLERCLRQQGLDGNPYRFLYGDTIENSEMIRRARSKPISLSDDIAS

YVTPFLCQTVKNYGKNSFAWFGPRPRVTLMNPGLIKDVLTKIYDFRKPNTNPLTRVLVTG

LVNHEEEKWAKHRRIINPAFHLKKLENMVPAFHQSCSEMISKWEEMVSNEGWCELDVWPC

LVNLTSDVISRAAFGSSYEEGKRIFHLIDQLRYLTQQLIQSVYIPGWRFLPTKLNKKLKA

CDTEIRCSLKGVINKREKAMKAGEVDNDDLLGTLMEANSREIQENGGGTGMSLTDVIDEC

KIFYFAGQETTSVLLVWTMVLLAHHPIWQSRAREEVLRVFGHNKPDFNGLNRLKIVTMIL

YEVLRLYPPAVQLIRLVGKETKLGNLVLPAGVEISIPNILIHRDPELWGDDAGEFKPERF

AEGVSMATKNQSSFLPFSSGPRICIGQNFAMMEAKIALAMILQHFEFELSSTYTHSPVLV

LTAHPQYGANMILQSKYYDTDKDIKYGAFWKFIIFKFHFRGSRIRLITTAFNSAIASVYI

AATHKCTAEDSDTNMKIDLVATSGQQW*

 

>CYP72A75 old c

59% to 72A10

GS_ORF_93_from_supercontig_77:939442,942234

 = C-term part

MKLVMEKPVAINGGWIVLGAAG

VVLLMFTWAWRVLNWLWFTPKRLERCLQQQGFSGNPYRLLVGDMTENSQMIKEAMAKPIS

LTDDCAPRVFPFLYHIVKTY

GKNSFSWNGPVPRVTIMNPEHIKEILNRITDFPKQAASSNPLSRLVGTGLACHEGEKWAK

HRRIISPAFHLDKLK

NMVPAFYDSCSDMINKWEELVSGEGFCELDAWPYLVNLTSEIISRTAFGSSYEEGKRIFQLQDELAILTRQV

SQSIYISGWRFVPTKFNRKIKAVDKEIRASLKKMIENRERAMKAGEVSNDDLLGILMESN

SREIQEHGDNKNVGMSMADVIDECKIFYFAGQETTSVLLVWTMILLASHTTWQSRARDEV

FKVFGNKKPDLDGLNRLKVVTMILYEVMRLYPPGTMLLRSVVKETRLGDLLLPAGVSLAL

PIILVHHDRELWGDDAMEFKPERFAEGVSKATKNQVSFFPFAWGPRICIGQNFALAEAKM

AVAMILQRFTFESSPSYTHAPCMVLTLHPQFGAHLILRKFYP*

 

>CYP72A76P pseudogene 1

54% to 72A7 gap near N-term, frameshift after NEVMS

stop codon and a large seq gap inside this gene

probable pseudogene

GLHM_ORF_106_from_supercontig_77:969231,943487

overlaps GS_ORF_94 but more complete

frameshift after NEVMS

MKLQISVGGLAGWVALAATLILAWRILNWAWLKPKKLD 960

1740 AISKPINLTDYILPRVSPFFCNMMQ*YGK

FSWDGPVPRMIV

MIVMKPECIKDILTRRTDFQKQSAINPLIRPLGCGLPSLEGEKWANHRRIITPAFNFGKL

KNMLPAVYQSCSNMINKWEELVSAEGWCELDVWPYLVNLTSDVISQVAFGSSYEEGKRIF

ELQDELAKLITQACQKVYVPGWRFLPTKLNKKMRAIDKEIQDSLKGMIDKRKKAMEAGEV

NSDLLSALLESNSREIQENGEKKNVG

LSIADVIDECKIFYFAGQETTSVLLVWTMVLLAK

HTNWQSRARDEVLKVFGNEQPNFNGLFNQLKVV (1)

ITMILNEVMS

LYPPLPMFVRSVEKETKLGNLILPAGLRLSIPIILVHHSSEIWGDDALDFKPERFAEGVSK

ATKNQVSFCPFGWGPRICIG

QNLALLEAKMTLAMIFQRFTFELSPCYTHAPRMVFTIHP

EFGVHLILHKLY*

 

>CYP72A77P pseudogene 3      supercontig_77:977190,976771 (-) strand

73% to CYP72A pseudogene 1, 47% to CYP72Ca

977190 VTMILNEVMRLYPPLLMFV*SVDKETRLENLTLPTGLRL*MPIILVHHDYEI*GDDARDF 977011

977010 KPERFSEGVSNATKNQVSFFPFGWGLRIYIN*DLALLEAKVAWAMILQCFTFELSPCNNH 976831

976830 APRMVFNLEFDAHLILRSYI 976771

 

>CYP72A78P pseudogene 4      supercontig_77:983015,980848 (-) strand

81% to 72Ae, 54% to 72Ca

983015 GKYCFMWIGPAQRVTIMNPDDMTQVLGKMNDFQK 983014

982902 PLSNFLLTGLFLHQDLKWATHRRTINQCF 982816

981135 IIHRDPTF*GEDVGEFKLDRFADGVSKVTKSQVAFFPFVWGPRICFGQNFALIEAKMTLS 980956

980955 MMLQHFTFELSPSYSHAAYMVITMRCQHGAHMILHK 980848

 

>CYP72A79 old f

GS_ORF_98 from_supercontig_77:986030,983546

Gene 4 59% to 72A7

MELQISFGGLAVWVALAATLVLAWRILNWVWLKPKKLERCLRRQGFSGNPYRLLIGD

LKEMSNVINQAKSKPINLTDDILPRVSPFFCDMMQKY (1)

GKNSFMWLGVVPRVNLTNPEHIKEVFTKINDFKKP

GLNPLAKYLLTGLLFHEGEKWVTHRRIINQAFLLEKLK (0)

NMVPAFYKSCSDLISKWDGLVSVEGWCEL

DVWPYLTDLTRDVISRAAFGSSYQEGRRIFQLQDELAELTVQALLSFYIPGWR ()

FVPTKLNKRLKQVDKEIQVSLRGIIS

KRESAMKAGEVAKNDLLGILLEANSKEIQEHGDKKNTGMSIDDVIKECKIFYFAGQETTS

VLLVWTMVLLAQHTNWQSRAREEVLQVFGKNKPDFDGLNQLKVV (1)

VTMILYEVLRFYPPVVGLARLVDKEIRLG

DLVLPAGVEVAMPTIEIQRDPTFWGEDAGEFKPERFAEGVSKATKNQVAFSPFSLGPRIC

IGQNFALIEAKMALSMILQHFTFELSPSYTHAPYLVITMHPQHGAHLILRKI*

 

>CYP72A80P psuedogene 2

GS_ORF_98 from_supercontig_77:990576,987763

Gene 3 pssible pseudogene several frameshifts and a stop codon

52% to 72A7

MEISSAATAEVWVCLGTAI

LIWAWWMLNWVWLRPKKLEKWLRQQGLTGNPYRLFFGDKIENSMMLQKAMLCKSNSVTDD

CAPCVAPSFYYNVKKY (1)

GKNCFSWDGPVPRMIVMNPEHIKDILTRRTDFSK

QNAINPLVRPLTCGLPSLEGEKCAKQRRIITPAFNFEKLK (0)

NMLPAIYKSCSN

MISKWEELVSAEGWCELDVWPYLVNLTSDLISQIAFGSSYEEGKRIFELQDELAKLITKL

AKKFM

YVLGWR

YIKVSTN*VMRAIDKEVQDSLKGIIDKRKKAMEAGK

VNNSDLLSVLLESNSRKIQEREEKKDVEMTIADVIDECKI

FYFAGQETTSVLLVWTMVLLAKHTNWQSRARDEVLEVFGNRQPNFNGLSQLKVV (1)

VTVILNEVMRLYPPLSVFVRSVEKETRLGNLILPAGLRLLMPIILVHHDSE

IWGDDALDFKLERFAEGVSKATKNQVSFFPFGWGPRICISQNLVLKAKVALAMILQHFTF

ELLPCYTHAPCMIFSIHS*

 

>CYP72A81 old e

GS_ORF_98 from_supercontig_77:995029,992551

Gene 2 58% to 72A7

MNLQISVTGLAVWVALISTLILAWRILNWAWLKPKKL

ERYLRRQGLSGNPYRLLSGDLKEMFDVSKQAISKPLNLTDDIVPRVSPFFCNMMQKY (1)

GKNTFIWLGVVPRVILRNP

EHIKEVFIKINDFKKPGGNPLAKYLLTGLLTREGEKWVTHRRIINQAFLLEKLK (0)

NMVPAFCQSCSD

LISKWEEFVSVEEWCEVDVWPYLTDLTSDVISRTAFGSSHQEGRRIFQLQDELAELTRQV

LRSFYIPGLR ()

FVPTKLNKR

LTEINKEIQVSLRGIISKRERAMKAGEFSKNDLLGILLEANSKEIQEHADKKNTGMSIND

VIEECKIFYFAGQETTSVLLVWTMVLLAQHTNWQSRAREEVLQVFGKNKPDFDGLNQLKVV (1)

VTMILYEVLRF

YPPVVGLGRSVDKETRIGDLVLPAGVEVALPTIHIHRDPTFWGEDAGQFKPERFADGVSK

AMKNQVAFFPFAWGPRICIGQNFALIEAKMALSMMLQHFRFELSPSYTHAPYLVITMRPQ

HGAHLILRKL*

 

>CYP72A82 old d

GS_ORF_98 from_supercontig_77:998493,995688

Gene 1 57% to 72A7

MELQISVAVAVALAATLILAWRILNWVWLKPKKLERCLRRQGLSGNRYRLFSGDLNEM

SDMLKQAMSKPIKLTDDIFTRVSPFFCNMMEKY ()

GKNSFMWFGMVPRVTLMNPEHIKQVLIKTNDFKKPSVNPLARYLLSGIVSHEGEKW

VTHRRIINQAFLLEKLK (0)

DMVPAFQKSCSDLVSKWEELVSVEGCCELDVWPYLTNLTSDVISRTAFGSSYQEGRRIF

QLQDELAELTIQSLRSFYIPGWR ()

FVPSKLNKRLKEINKEIKVSLRGIISKRERAMKAGEFAKNDL

LGILLEANSKEIQEHRDNNNSGMSIDDVIDECKIFYFAGQETTSVLLVWTMVLLAQHTNW

QAHAREEVLQVFRKNKPDFDGLNQLKVV (1)

ITMILYEVLRFYPPVVALTRLVDKETRLGDLVLPAGVEVALPT

ILIQRDPTFWGEDAGEFKPERFADGVSKAVKNPVAFFPFSWGPRICVGQNFALIEAKMAL

SMMLQHFKFELSPSYTHAPYWVITMRPQHGAHMILRKI*LQLKFFIPC*LNLIKVTTCLK

KSYHYSFLV*

 

>CYP72A83 old g

supercontig_2140:9099,10604

88% to 72Af, N-term off the end of the contig

QNMVPAFYK

SCSDLINKWEELVSVEGWCELDVWPYLTNLMSDVISRAAFGSSYQEGRRIFQLQDELAE

LTVKALLSFYITGWK

FVPTKLNKRLKEVNKEIQVSLRAIISKRESAIKAGEDAKNDLLGRLLEANSKEIQEHGD

KKNTGMSIDDVIECKIFYFAGQETTYVLLVWTMVLLAQHANWQSHVREEVLQVFDKNKP

DFDGLNQLKVV

VTMILYEVLRLYPPVAGLARLVYKDTRLGDLVLPAGVEVTLPIILIQRDPTFW

GEDAGEFNPERFAEGVSKATKNQVAFSPFSWGPRIFVGQNFALIEAKMALSMILQHFTFE

LSPSYTHAPYLVMTVHPRHGTHLMLGRI*

 

>CYP72C2 old a

56% to 72C1

N-term in a seq gap

GS_ORF_86_from_supercontig_77:897282..899560

SKPMQLSHDIVPRVLPFQHHVMRNY (1)

GKNSFTWIGPYPVINLMDPDMIKEILNRVYDFPKPKLISQTEALVSGLVRHEGQKWTKHR

SLLDPAYRFDKLK

LMLPAFEESCNEMIREW

EVVISEKGSMEVDIWTYCHDLFSDMIARAAFGNGYQEGKKIFILQQEQVELSLLAMKSLYIPG

YRYLPTKFNRRLKQTEKEMSAMLKDIIEKREKEMKRGETFDDLLGFYMTLNSKEIEENG

KTAGLTVPELIDECKAFYLAGENASSVLVTWTMVLLSMHQDWQTKAREEVLQVFGNKKPD

FDGLSRLKI (0)

VTMILHEVSRLYPPAVETYRMIYQETRLGKWKLPGGVMIRLPITMVQHDQDLWGDDVNEF

KPERFSSGVAEATKGQVSYFPFSWGPRTCIGKNFGMLQAKFSLSIILQRFWFELSPSYSH

APYPSVTLQPQSGAHIVLHKRV*

 

>CYP72C3 old b

69% to 72Ca, C-term in a seq gap

supercontig_1272:15255,13644

MIEIEIEVWRMGWIAGTVAWIWMIWKVINWVWLKPKKLEECLRQQGLNGT

PYKLLIGDIRENNMM

NTKAQSKPMDSLSHDIVSRVIPFELDVITKY

GKNSFMWKGPWPALILMDPEMIKEVLNRFNEFQKPRLTSVPRTLLSGLVKHEGDK

WAKHRSLLNPAYRIDKLK

LMLPAFEASCEEMFKEWEAMASAEESLEVDTWACFHDLSCKMLARAAFGSYHEEGRKIFL

LQKEQVDLGLQALKSLLIPGSR

YLPTKANRRTNETEKEMIASFKAIIDKREKAMERGETFNNDLLGFYMELNSKQIKENG

KEAGMTLAELIDECKAFYLAGENATSVLLTWTMVLLSMHQDWQTKAREEVLQIFGNEKPD

FEGLNRLKI (0)

 

>CYP72C4P pseudogene 1        supercontig_77:914334,914218 (-) strand

84% to CYP72Ca

914334 TVIMQRFWFELSPSYSYAPYPSVTLQPQYGAHIVLHKRM 914218

 

>CYP73A78 AM455281.2 Vitis vinifera

complement(join(39309..40044,40169..41037))

MAHLLNKPVFFSTLLTIILLSSTRLLASYLSISPPLIASFLPLA

PLILYLFYSIAKRSASLPPGPLSIPLFGNWLQVGNDLNHQLLASMAQKYGPVFLLKLG

SKNLAVVSDPELASQVLHTQGVEFGSRPRNVVFDIFTGNGQDMVFTXYGDHWRKMRRI

MTLPFFTNKVVHHYSEMWEEEMELVVDDLRNKESVKSEGLVIRKRLQLMLYNIMYRMM

FDSKFESQEDPLFIQATRFNSERSRLAQSFDYNYGDFIPFLRPFLRGYLNKCRELQSR

RLAFFNNYFVEKRREIMAANGEKHKIRCAIDHIIDAQLKGEISEANVLYIVENINVAA

IETTLWSMEWAIAELVNHPHVQCKIRDEITTILQGDAVTESNLHQLPYLQATVKETLR

LHAPIPLLVPHMNLEEAKLGGYTIPKESKVVVNAWWLANNPSWWKNPEEFRPERFLEE

ESGTDAVAGGKVDFRFLPFGVGRRSCPGIILALPILALVIAKLVMNFEMRPPIGVEKI

DVSEKGGQFSLHIANHSTVALTPIAA

 

>CYP73A79 old a

supercontig_2 :3548202..3550796 (+ strand)

93% to CYP73A42v1  Populus tremuloides, 86% to 73A5, 64% to CYP73Ab

GLHM_ORF_426_from_supercontig_2

MDLLLLEKTLLAVFFAVVLAITISKFRGKRFKLPPGPIPVPVFGNWLQVGDDLNHRNLTD

LAKKYGDIFLLRMGQRNLTVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT

VYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEDEAARVVEDVKKNPESATNGIVLRRRLQL

MMYNNMYRIMFDRRFESEDDPLFNKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK

ICKEVKERRLQLFKDYFVEERKKLASTKSMTNEGLKCAIDHILDAQQKGEINEDNVLYIV

ENINVAAIETTLWSIEWGIAELVNHPQIQAKLRNELDTMLGPGVQITEPDTYKLPYLQAV

IKETLRLRMAIPLLVPHMNLHDAKLGGYEIPAESKILVNAWWLANNPAQWKNPEEFRPER

FLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKID

TSEKGGQFSLHILKHSTIVMKPRSF*

 

>CYP73A80 old b

64% to 73A5 Arab., 77% to Vitis vinifera AM455281.2, 82% to CYP73A29 

Citrus sinensis, 81% to CYP73A27 Nicotiana tabacum (tobacco)

AF368378

supercontig_115:473019,475212

GLHM_ORF_45_from_supercontig_115

MAVTRHLLSKPISFVALITFSISSLLLFPSQISSITLSLPLLIFFLYSIFNSSSSTKLPP

GPLSVPVFGNWLQVGNDLNHRLLASMAETYGPVFLLKLGSKNLAVVSDPELAAQVLHTQG

VEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVRHYSDMWEEEME

LVVRDLQRDDDEKGKKRRGVVVRRRLQLMLYNIMYRMMFDAKFESEEDHLFVQATGFNSE

RSRLAQSFEYNYGDFIPLLRPFLRGYLNRCRDLQKRRLAFFNNNYVEKRRKIMAANKENH

KITCAIDHIIEAQLKGEITEENVLYIVENINVAAIETTLWSIEWAIAELVNHPEVQKKIR

DEIRAVLKKNPATESNLQELPYLQAVVKETLRLHTPIPLLVPHMNLEEAKLGWFTIPRES

KVVVNAWWLANNPKWWKDPENFRPERFLEEETRTEAVAGGKVDFRFLPFGMGRRSCPGII

LALPILGLVIAKLVSNFEMKTPPGVKKIDVSEKGGQFSLHIAKHSTVVFEPVLLPQ*

 

>CYP74A12 C-term only

79% to 74A Arabidopsis

the rest of this seq is in a seq gap

supercontig_64:178957-179167

EKLLKHVLWSNGPETETPTVGNKQCAGKDFVVLAARLFVIEL

FSRSDSFEIDVATAPLGSTVTIKSLKRASF*

 

>CYP74B13 AM441513 PLN 18-MAY-2007 Vitis vinifera

11751 MLSSTVMSVSPGVPTPSSLTPPSPPSSSPVRAIPGSYGWPVLGPIADRLDYFW 11593

11592 FQGPETFFRKRIDKYKSTVFRTNVPPSFPFFVDVNPNVIAVLDCKSFSFLFDMDVVEKKN 11413

11412 VLVGDFMPSVKYTGDIRVCAYLDTAETQHAR 11320

10198 VKGFAMDILKRSSSIWASEVVASL 10127

10125 DTMWDTIDAGVAKSNSASYIKPLQRFIFHFLTKCLVGADPAVSPEIAESGYVMLDKWVFL 9946

 9945 QLLPTISVNFLQPLEEIFLHSFAYPFFLVKGDYRKLYEFVEQHGQAVLQRGETEFNLSKE 9766

 9765 ETIHNLLFVLGFNAFGGFTIFFPSLLSALSG-KPELQAKLREEVRSKIKPGTNLTFESVK 9589

 9588 DLELVHSVVYETLRLNPPVPLQYARARKDFQLSSHDSVFEIKKGDLLCGFQKVAMTDPKI 9409

 9408 FDDPETFVPDRFTKEKGRELLNYLFWSNGPQTGSPSDRNKQCAAKDYVTMTAVLFVTHMF 9229

 9228 QRYDSVTASGSSITAVEKAN* 9166

 

>CYP74B14

64% to 74B2, 66% to CYP74B5 AF239670  Psidium guajava fatty acid hydroperoxide lyase

65% to CYP74B10 AY242385.1 Citrus sinensis, 62% to Vitis vinifera AM441513

supercontig_1880:323-1993

MMMKLMNISPTMSSPSSPPSSSPLASNSISTPPSSALPLRTIPGSYGWPLLGP

LSDRLDYFWFQGPETFFRKRMEKNKSSVFRTNVPPSFPFFLDVNPNVIAVLDVKSFSHLF

DLEIVEKKDVLVGSFVPSTRFTGDVRVGVYLDTAEPKHSEVC (0)

NLTMELLQRGSKVWQSELLSNLDKMWDMVEATVAEKGKATYLGPLQQCIFNFIMKALA

GIDPAVSPQIANSGYIMLDRWLFLQLLPTVNIGILQPLEEIFLHSWAYPFFLVRNDYKNL

YDFIKQNGKEVLQIAETKFGLTEEETIHNLLFVIGFNAFGGFSVFLPSLLDAISSDQTGL

QDKLKKEVREHSVPGSGLDFETMSKMELVKSVVYEALRFKPPVPTQYGRARKDFRLTSHD

SVYDIKKGELLCGFQPLVMRDPEVFDEPEKFKPDRFLGEGSKLLSYLYWSNGPQTGSPSE

SNKQCAAKEVVPLTACLVVAHLFLRYEKISGGSGSITALEKTK*

 

>CYP75A28 AJ880356.1 Vitis vinifera

MAIDTSLLLEFAAATLLFFITRFFIRSLLPKPSRKLPPGPKGWP

LLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSMVVASTPEAARAFLKTLDINFSN

RPPNAGATLLAYHAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRAVELGHML

RAMLELCQRAEPVVVPEMLTFSMANMIGQVILSRRVFETKGSESNEFKDMVVELMTSA

GYFNIGDFIPSIAWLDIQGIQRGMKHLHRKFDWLLTKMMEEHTASAHERKGNPDFLDV

IMANQENSTGEKLTITNIKALLLNLFTAGTDTSSSVIEWSLAEMLKNPSILKRAHEEM

DQVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPKNT

RLSVNIWAIGRDPDVWESPEEFRPERFLSGRNTKIDPRGNDFELIPFGAGRRICAGTR

MGIVLVEYILGTLVHSFDWKMPDEVEINMDEAFGLALQKAVSLSAMVTPRLHQSAYAV

 

>CYP75A30

54% to 75A11, 76% to CYP75A28 Vitis AJ880356.1 (best blast hit)

supercontig_157:358009,359643

restored cyan seq to model

GLHM_ORF_51_from_supercontig_157

MAALNVFLLREIAIAVLLFFITRYCFRKILNHPSHGRRLPPGPKGWPVIGALPHLGSMPH

VSLAKMAKTYGPIMHLKIGTFDMVVASTPDAARTFLKTLDANFSNRPPNAGATHLAYDSQ

DMVFADYGAKWRLLRKLSNLHMMGGKALDDWSKVRSVELGYMLAAMVESSQKNEP

VVVAELLTYGLANMIGQVILGRRVFVTKGSESNE

FKDMVVELMTTAGYFNIGDFIPSIAWMDLQG

IVRGMKKLHKRFDALLTRMIEEHTTSSHERKEKPDFLDVLMAYRDNSEGESLTITNIKAL

LLNLFTAGTDTSSSIMEWALAEMLKNKSIMKRAHDEMDKVIGRSRRLEEHDIQKLPYFQA

ICKETFRKHPSTPLNLPRVSSEPCVVNGYYIPKNSRLSVNIWAIGRDPDVWENPEEFNPD

RFMDPKNAKMEPRGNDFELIPFGAGRRICAGTRMGIVLVEYVLGTLVHSFEWELEDEGEE

VNMEEVFGLALQKKVALSAKVRPRLHPSVYVS*

 

>CYP75B32   Vitis vinifera (core eudicotyledons; Vitales)

            AJ880357

            Bogs,J., Ebadi,A., McDavid,D. and Robinson,S.P.

            Identification of the Flavonoid Hydroxylases from Grapevine and

            Their Regulation during Fruit Development

            (er) Plant Physiol. (2005) In press

            flavonoid-3'-hydroxylase

            67% to 75B1

MNPLALIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIVGNLPHL

GPVPHHSIAALAKTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAK

HIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQ

TPVNLGQLLNVCTTNALGRVMLGRRVFGDGSGGEDPKADEFKEMVVELMVLAGVFNIG

DFVPALEWLDLQGVAAKMKKLHARFDAFLGAIVEEHKISGSAGSERHVDLLSTLISVR

DNADGEGGKLTDVEIKALLLNLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAV

VGRSRLVTDLDLPQLTYVQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLL

VNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLG

LRMVHLLTATLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVFGK

 

>CYP75B37

61% to 75B3 Arab. 72% to 75B32 Vitis (top hit in GenBank)

supercontig_94:557128,559997

GLHM_ORF_45_from_supercontig_94

MSLETLFYFLLLSISIYTLLNLLSRDRRCLPPGPRPWPIIGNLPHIGTMPHHTMAAMART

YGPLLYLRMGLVDVVVAASASVAEQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPYGP

RWRMLRKICSVHVFSAKALDDFRHVRQEEVAVLTRTLASAVTKEVNLGQLLTVCTVNALG

QVMLGRRVFGDGTGGDDPKAGEFKSMVVEAMLLAGVFNIGDFIPALDWLDLQGVAAKMKK

VHKRFDAFLTSILEEYKMYGVDGSSNRHKHMLGTLISLQDDDSEGGKLTDTEIKALLLNM

FIAGTDTSSSTIEWAMAELIRHPKILAQVRRELDSVIGPNRLVTESDLPHLTYFQAVIKE

TFRLHPSTPLSLPRIAAESCEINGYHIPKGATLLVNVWAIARDPNVWSDPLEFRPERFLS

GGEKPDVDVRGNDFEVIPFGAGRRICAGLNLGIRMVQLLTATLVHAFDWKVAGDVMPEKL

NMDEAYGLTLQRAVPLMVHPSPRLAHHVYQPAS*

 

>CYP76A10 AM451133.2  Vitis vinifera

6415  MEWTTNFLVWLIIPFLSALLLLLHRL

6337  KSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLAGLRDTYGDVVWLNLGYIGTMVXQSSKA  6158

6157  AXELFKNHDLSFSDRSIHETMRVHQYNESSLSLAPYGPYWRSLRRLVTVDMLTMKRINET  5978

5977  VPIRRKCVDDLLLWIEEEARGMDGTATGLELGRFFFLATFNMIGNLMLSRDLLDPQSRKG  5798

5797  SEFFTAMRISMESSGHTNFADFFPWLKWLDPQGLKKRMEVDLGKSIEIASGFVKERMRQG  5618

5617  RAEESKRKDFLDVLLEFQGDGKDEATKISEKGINIFIT (0)  5504

5412  EMFMAASETTSSTMEWAMTELLRSPESMTKVKAELGRVIGEKRKLEESDLDDLPYLHA  5239

5238  VVKETLRLHPAAPFLVPRRAVEDTKFMGYHIPKGTQVFVNVWAIGREAETWDDALCFKPE  5059

5058  RFVDSNMDYKGQNFEFIPFGAGRRICVGIPLAYRVLHFVLGSLLHHFDWQLERNVTPETM  4879

4878  DMKEGRGIVICKFHPLKAVP KIKPIST*4795

 

>CYP76A11

59% to CYP76A4 AB016061.1  Petunia x hybrida IMT-6, 47% to 76G1

59% to Vitis 76A10

supercontig_5:729080,731396

GLHM_ORF_111_from_supercontig_5

MGWLIFFPPLLFLLLLYKRSFLNRRLPPGPPGWPIVGNLFDLGTMPHRTSAGLRKKYGDI

LWLKIGAVNSVVILSTKAATEFFKIHDHAFLDRAVTEVMRAQDFHLSSLSLAPYGPYWRV

LRRLVTVEMLVNKRIKETVSVRQKSVDQMLVWIEEEAEKKHGVGIHVARFVFLMTFNLLG

NLMISRDLIEPASRDGSEFFKAMMGFIEWTSKPNLADSFPWLQWLDPQGLKKNMEKDVGN

AIDIASKFVKERIKEKKVGDREGQRKDFLDLLLEFEGTGKDEPARFSERDINIFIMEIFV

AGSETTSSTIEWALTELLLNPESMAKAKAEITQVLGSKTKVEENDIANLPYLQFIIKETL

RLHPPIPFLVPRKARQDTEFTGYRIPKNTQALVNVWAIGRDPEVWDDPLSFKPERFSEST

IDFKGQHYELIPFGAGKRMCAGLALAQRILHLVLASLLRRFDWELDQSLDRERLDMKEKI

GVTMRKSEPLLAVPVKRVT*

 

>CYP76F8

60% to 76F2 Vitis (best blast hit), 46% to 76H5 rice, 48% to 76C4

supercontig_29:416698..418279 (- strand)

GLHM_ORF_64_from_supercontig_29

MEFIITALLFLLGVSVLFNLLRHHSKSRSKSKSTNLPPGPKSIPIIGNLLLLGQNPHRSL

AKLAKTHGPIMTLKLGQLTTILVSSPAMAKHVIHKNDVVFSNRTIPDAIRAHQHDQFSLV

WLPLSKPWSTRRKICNSYMFSVQKLDANRDLRRKKVDQLLADVRKCCLAGQAIDIGQAAF

TTMLNLMSNTFFSLDLADPSGDTAREFKEIVGCIMEGIGKTNLADFFPVLRKFDIQGIRR

RTVINFGKFFELSDRMIIQRLESRKKTGISTDDFLDSLLSVAENSDEGFDRNDIKHLLLD

LLLAGTDTTSNTIEWAMAELLKNPETLTRARVELQEKLGKGKVVEESDISGLTYLQAIVK

ETFRLHPIVPFLHRKAGEEVEICGFTVPKDAQVLVNIWAVERDESVWENPNSFQPERFME

KDVDIRGKDSELIPFGGGRRICPGLPLATKMLHLMLASLLHSFDWKLEEGLTPLGTDMEE

KFGLTLHKAQPLLAIPQLL*

 

>CYP76F9P pseudogene

supercontig_395:13121,13399

59% to 76F8 C-term

13121 PKNAQILVNVWAMARDSGIWETLYGFEPETFMGQDIDVKGGDIKLIPFGAGIRICPGLPL 13300

13301 YMRMVHLMLASLCCFDWKLGGG*TPKDLDMTEN 13399

 

>CYP76G6 AM452176.2  Vitis vinifera

3925  MEYEMVGIVIALVLWAVWAMVTERRHRRLEELGQLPPGPRSWPVVGNIFQLGWAPHVSFAK  3743

3742  LAGKHGPIMTLWLGSMSTVVISSNEVARXMFKNHDVVLAGRKIYEAMKGDRGNEGSIITA  3563

3562  QYGPQWRMLRRLCTSEFFVXSRLDAMRGVRGGCIDRMVQFVTEAGTSGTHAIDVGRFIF  3386

3385  LMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVMELAGRPNVADFLPILRWFDPQGIRR  3206

3205  KTQFHVERAFAIAGGFIKERMETMAKGSGEAKSKDFLDVLLEFRGDGVEEPSRF  3044

3043  SSRTINVIVF

      EMFTAGTDTTTSTLEWA  2864

2863  MAELLHTPRILNKVQAELRXVVKPGSKLEEKDMENLPYLIAVIKETLRLHPPLPFLVPHM  2684

2683  AMNSCKMLGYCIPKETQVLVNVWAIGRDPKTWKDPLVFMPERFLEPNMVDYKGHHFEFIP  2504

2503  FGSGRRMCPAVPLASRVLPLALGSLLHSFNWVLPDGLNPKEMDMTERMGITLRKSVPLRA  2324

2323  MPVPYKGIQTQVFA* 2279

 

>CYP76G7

61% to 76G1 Arab., 76% to CYP76G6 AM452176.2  Vitis vinifera best GenBank hit

supercontig_5:739696,741359

GLHM_ORF_113_from_supercontig_5, added cyan seq to model

Seems to be about 14 amino acids short before I-helix,

But the DNA sequence is contiguous here

MELYEILGLTIVILIWITWVMERHNRRVKELGSLPPGPRRWPVVGNIFQLGLEPPHHSLA

RLARKHGPIMTLWLGSMGTVVISSSEVAQEMFKNHDVVLAGRKIYEAMKGNYGHEGSLIT

SQYGPHWRMLRRLCTTEFFVTSRLDTMRGVRGRCIDRMVQFIEDAGRDSGKNGIDVGRFF

FLMAFNLIGNLIFSKDLLDPSSERGARFFYHAGKVMELAGKPNIADFFPVLRVLDPQGIR

RKTQFHVERAFEIAGGFIKERMEKEMSAMEEDGDIKKQKKKDFLDVLLEFRGDGVEE

VSRFSSRTINVIVF

EMFTAGTDTTTSTLEWAMAELLRNPEKLKKVQEELRRSKKKPEEKDVNDLPYLRAVIKETLRL

HPPLPFLVPHMAMNSCKMMGYHIPKESQILVNVSAIGRDPKNWDDPLAFKPERFMEPNKM

DYKGQHFEFLPFGSGRRMCPAHPLASRVLPLALGSVLQAFDWVLADGVKAEEMDMAERMG

ITLRKSVPLKAIPIPYKPPHGC*

 

>CYP77A14 AM463740.2 Vitis vinifera complement(2718..4265)

MAPAFAAASSTYSPYYHIFFTALAFLISGLIVLLSRKTKSKKLN

LPPGPPGWPIVGNLFQFARSGKQFFQYVRELRPKYGPIFTLKMGNRTMIIISSAELAH

EALIEKGQSFASRPRENPTRTVFSCNKFTVNAAVYGPVWRSLRRNMVQNMLSASKIRE

FSNLRDVSMDKLIDRLRSEAEANDGAVWVLKNARFAVFCILLSMCFGVEMDEETIEVM

DDLMKTVLITLDPRLDDYLPLLSPFFSKQRKAATEVRKRQIKTVVPFIERRRAALENP

GSDKTAASFSYLDTIFDLKIEGRKSSPTNPELVTLCSEFLNGGTDTTGTAVEWAIARM

IENPEIQSKLYEEIKTTVGDRKVQEKDMEKMPYLNAVSKELLRKHPPTYFSLTHAVTE

PAKLAGYDIPTDANVEFFLPPISEDPKLWKNPEKFDPDRFLLGGEDADITGVTGVKMM

PFGVGRRICPGLSMATVHVNLMLARMVQDFEWSAYPENSKIDFSEKLEFTVVMKNPLR

AKIKPRV

 

>CYP77A15

supercontig_128:322239,323816 74% to CYP77A4 Arab., 71% to 77A Vitis

GLHM_ORF_51_from_supercontig_128

MALFSSSSSSSLVLHDCNLFFTFLIFVFSAFLFLASRKTKSKRLNLPPGPPGWPVIGNLF

QFTTSGKPFFKYADELRQKYGPIYTLKMGTRTMIIISDAKLCHEALIDRGSLFATRPPEN

PTRTVFSCNKFTVNAALHGPIWRSLRRNMVQNMLSSSKLKEFRHVRDTAMDKLIERIHLE

AEANGFVSVLKTARFAVFCILLTMSFGIEMDEETVEKMDQMMKTVLIILDPRIDDYLPIL

RPFFSKQRKRAMEVRKGQVDFVSKFIEQRRNALNNPGSDKTATSFSYLDTLFDLKVEGRT

TTPSNEELVSLCSEFINGGTDTTATAIEWGIAELIANPKIQSKLHDEIKRTVGVSRKVNE

KDVDQMEYLQAFVKELLRKHPPTYFSLTHAVTETTTLAGYDIPANTNVEIYLPGISKDPK

LWEDPEKFDPERFFSGKESADMTESGGVKTMPFGIGRRICPGLGMATLHVSLMLARMVQE

FEWSAYPPNSELDFTGKLEFTVVMKKTLTATVKPRGSMVPLVNGE*

 

>CYP77B6 AM482217.2 Vitis vinifera

complement(join(77743..79008,79044..79164,79203..79270))

revise it at N-term

79270MELTDLLLLSLALIFLRFWWRYWSVTGGGPKNLPPGPPGWPLVGNLVQVILQRRPFI  79100

YVVRDLRAKYGPIFTLQMGQRTLVIVTSSE

LIHEALVQRGPIFASRPEDSPTRLVFSVGKCAINSAQYG

PLWRTLRRNFVAELITPTRIRQCSWIRKWALENHMRRLQMEVSEKGFVEVMSNCRLTI

CSILICICFGAKISERRIKEIESVLKDVMLMTTPKLPDFLPVLTPLLRRQLREAKELR

KKQMECMVPLVRSRRAFVESKGAPGRSSSEMVSPIGAAYIDSLFGLEPAERGRLGEEE

LVTLCSEIINAGTDTSATTVEWALLHLVMNQDIQQKLYKEIIDCVGKNGVVTEGDVEK

MPYLGAIVKETFRRHPPSHFVLSHAATKDTELGGYTIPADVNVEFYTAWVTEDPDLWQ

DPAEFRPERFLQGDGVNVDVTGTRGVKMVPFGAGRRICPAMNLGTLHVNLLIARMIHA

FKWIPAPGSPPDPTETFAFTVVMKNPLKAIILPR

 

>CYP77B7

supercontig_198:121695,126901

76% to 77B1, 77% to CYP77B6 AM482217.2 Vitis vinifera

best GenBank hit

MELTDLLILCSALIFLRLWWRYCYHAGQKRSKNLPPGPPGWPLVGNLLQ

VIFQKRHFVFVVGDLRAKYGPIFTMQMGQRTLVI

VTDDKLIHEALVQRGAAFASRPPDSPIRLVFS

VGKCAINS

AEYGPLWRTLRRNLVTEMITPTRVRQCSWIRKWALESHMARLKTESIEQGFVEVMSNCRL

TICSILICLCFGAKISEERIKHIESILKE

VMLVTSPKLPDFLPVLTPLFRRQMQEAKELR

KRQLDCLVPLIRNRRAFVEKGENPNGEMVSPVGAAYVDSLFGLEPAERGSLGEEEYVTLC

SEIISAGTDTSATTAEWALFSLVTHQDVQEKLYNEIVACVGKDGVIEEEDVEKMVYLDAV

IKETLRRHPPGHFLLSHAAVKDTELGGYHIPAGVNVEFYTAWVTENPDIWSDPAEFRPER

FLEGDGVGVDVTGTRGVKMVPFGAGRRICPAWSLGVLHINLLVARMVHAYEWLPVPEYPP

DPTETYAFTVVMKNPLKAIVVPR*

 

>CYP78A33 old a

supercontig_144:387175,395203

71% to CYP78A6

MRTDINSIWVFPLASKCTGFTQENIAWPLFVVALGWLLITLLYWVFPGGPAWGKYWFKTF

SFKFVANPIPGPRGLPLVGSMSLMASLAHHRIAAAADTCRARRLMAFSLADTRVIVTCNP

DVAKEILNSSVFADRPIKESAYSLMFDRAIGFAPYGVYWRTLRRIAATHLFSPKQIKIAE

SQRRLIASQMVTLFAANGGHHHRVRQVLKRASLNNMMSSVFGRKYRLDSVNNEVEELKEL

VDEGYELLGTLNWTDYLPWLSEFDPQKIRFRCSSLVPKVNRFVSRIIAEHRAQTGGDRTP

DFVDVLLSSEGSDKLSDSDMIAVLWEMIFRGTDTVAVLIEWILARMVMHPDVQSRVQDEL

DEVVGRSRAVDESDMGSLTYLTAVVKEVLRLHPPGPLLSWARLAITDTTIDGYHVPAGTT

AMVNMWAISRDPQVWTDPLEFVPERFLGERVEFSVMGSDLRLAPFGSGRRVCPGKNLGLT

TVSYWVAYLLHEFEWTVGDDKGVDLSEVLRLSCEMANPLTVKVQLRCTVTLP*

 

>CYP78A34 old b

supercontig_196:198260,200978

GLHM_ORF_26_from_supercontig_196 69% to 78A7

MELSWVTKDSSWWVFTLPACFGSHNLLDAYFLLSFFTLSLSLYLLTWAFSPGGVAWKNGR

SKLGSVPISGPRGLPFLGSLFTLSRGLAHRSLAAMARSSANLQLMAFTLGSTPLVVSSDP

YTAKEILTSPHFADRPIKQSAKSLMFSRAIGFAPNGTYWRLLRRIAASHLFSPRRIMAHD

AGRQKDCAAMLREIAIEQKISGFVALRKHLQLAALNNIMGSVFGKRYDPGRESEELQKLR

DMVREGFELLGSFNWSDYLPWLSYFYDPFRINERCSKLVPRVTKFVRAIIEEHRRERFSE

SKKLAETGDFVDVLLSLDGDEKLQEDDMVAVLWEMIFRGTDTTALLTEWVMAELVLHPEV

QTKLRNEINEAVGNKNVTDADMGRLTYLQAVVKETLRVHPPGPLLSWARLATSDVQLKNG

MVIPANTTAMVNMWAITHDPNVWAEPLEFRPERFLESDMDVRGGDLRLAPFGAGRRVCPG

KNLGLATVNIWVAQLVHRFEWVEEVTKPVDLSEVLKLSCQMKYPLHVVAMERNGCL*

 

>CYP78A35 old c

70% to 78A10, 53% to 78Aa

GLHM_ORF_108_from_supercontig_94:1066500,1071499

MEFDLPFLSRTGFSPFLSFELCVYLLLFISIFAFWLTPGGLAWALYKFRVQASPASTRPA

LPGPSGLPILGLLMPFIGPFTHRTLGLLANSLKTKSLMAFSVGFTRFVISSDPNTAKDLL

NSSAFADRPVKESAYELLFHRAMGFAPFGEYWRNLRRISATHLFSPKRVSFFGEFRRKIG

EEMMKETKGLMEKSGEVRVRTVLHFGSLNNVMMSVFGRKYEFGDQSCVEGKELERLVSEG

YELLGMFNWSDHFPVLGWLDLQGVRKRCRELVRKVNIFVEKIIEGHRVKRANNGQSDEEG

DFVDVLLDLELKENNGLSESDMIAVLWEMIFRGTDTVAILLEWILARMVIHPEIQAKAQS

EIDMIVGTKGYVSDSDLPNLPYLKAIVKETLRMHPPGPLLSWARLSIHDTHIGNHFVPAG

TTAMVNMWAITHDNEVWAEAEVFKPERFIEEDVSIMGSDLRLAPFGSGRRVCPGKALGLA

TVELWLAQLLHGFKWVPSEEAGVDLCEQLKLSMEMKNSLVCKAIARVSSG*

 

>CYP79B6 old a

supercontig_136:740365,743529

GLHM_ORF_83_from_supercontig_136  58% to 79B3

MALGIRFFDWWLTMKILVIVLFILIMLIKRSTKIRAYKKLPPGPLPWPIVGCIPEMLTNK

PVFRWIHRTMKELDTEIACFRLGNTHVIPVTSPEIAREILKNKDSIFASRPTSFATKTFS

GGYRTAVISPYGDQWKKMRKVLTSEIICPARHKWLREKRTEEADNLVSYIYNQYKWGKKV

NLRIAVRFYSGNVIRRLTFDKRYFYDSVPDDAGPSRHEIDHVEALFTALGYIYAFCISDY

FPWLIGLDLDGHEKIVKEANRVIEKYNNPVIEERIQYWRSRDKKPSGKKMKKTVEDLLDV

LITLNDSKGEPLLTTEEIKAQSREIMMAAVDNPSNAVEWIMAEMINQPAILSKAVEELNR

EVGKERLVQESDVPRLNYIKSCIREAFRLHPVAPFNVPHVSLTDTTVAGYFIPKGSHVLL

SRLGLGRNPNVWDDPLKFKPERHLNEIDDDDNEVSLTEHDLRFISFSTGRRGCIAASLGT

CMTTMLLARLLQGFSWSATENEGCTDLNEGEDDMFLGKPLVVWAEPRLAPNLYPSADKS*

 

>CYP79B7 old b

56% to 79B3, 58% to 79A12 barley

GS_ORF_11_from_supercontig_213:86297..89401 (+ strand)

MIVTLNLLGLTKKWPITSSPSSSTTPISSAFFITIEALVFMALILIIKRLRSPFCKSNQH

KLHSKQGPLPPGPLPWPVIGSVPEMIWNKPVFRWIHQIMNELDTNIACIRLGNTHVIPIS

CPKIAREILKNQDSIFASRPLSFSAHTISGGYLTTVLSPFGDQWKKMRRVLTSEIICPTR

HKWLEDKRVEEADNLVTYIYNQYKNNKNVDLRIATRYYCGNVIRRLMFDKRYFFEPIVDA

SPSVHEINHVEALITALGFTYAYCISDYFPGLVGLDLDGHEKIIKEANNVIDKYHDPIII

ERVQQWRNPNDPNYGEKDVHDLLDILITLKDSSGEPLLTLEEIKAQSR (0)

ELIMAAVDNPSNVVEWIMAELINHPDVLQKAMEELDREVGRERLVQESDIPRLNYIKSCI

REGFRLHPVAPFNVPHVALSDTTVAGYFIPKGSHVLLSRIGLGRNPNVWQYPLEFRPERH

LNESYEVALTEHDLRFISFSTGRRGCIAASLGTCMTTILLTRLLQGFSWSLLGKEGSVDL

GEAETDLFLAKPLVTRAEPRLPPHLYLASNN*

 

>CYP79B8 old c

59% to 79B2

85% to GS_ORF_11_from_supercontig_213

GS_ORF_5_from_ supercontig_213:32639..36808 (+ strand)

MTVTLNLIGLTKNWLITSSSSSSTTPILRALFTTIQALVFMALILIIKKLRSLSRKSSQQ

KLPSKKTPLPPGPLPWPVIGSVPEMLLNKPVFRWIHRIMDELETNIACIRLGNTHVIPVS

CPKIAREILKNQDSIFASRPLSFAAHTYSGGYVTAVISPFGDQWKKMRRVLTSEIICPAR

HKWLHDKRAEEADNLVTYIYNQYKNSKNVDLRIATRYYSGNVIRRLMFDKRYFREPMADA

GPSVHEIDHVEALFTALGFLYAYCISDYFPGLIGLDLDGHEKIVKEANSVIEKYHDPIIK

ERIQRWRNPNDPNCGKKEIQDFLDVLITLKDSNGEPLLTPEEIKAQSR (0)

EIMMAAVDNPSNVVEWIMAELINRPNILQKAMEELDREVGRERLAQESDIPR

LNYIKSCIREGFRLHPVAPFNVPHVALSDTTVAGYFIPKGSHVLLSRIGLGRNPKVWQDP

HEFRPERHLNECYDVALTEHDLRFISFSTGRRGCIAASLGTCMTTMLLARLLQGFSWSLP

GKQSCVDLSEAENDLFLAKPLVARAEPRLPPHLYPASN*

 

>CYP80J1

$supercontig_107:92704,94425

GLHM_ORF_13_from_supercontig_107 CYP80J1 45% to 80B3,

Papaver somniferum (S)-N-methylcoclaurine 3'-hydroxylase

51% to 80E3 Vitis vinifera

MQSLNLESILNNADSSATLPLLLLLFSIVFLVAIKQKSSRKLPLPPGPRPWPIVGNLPQL

GKKMHVSMADLAKTHGGLMSLRLGTQLVIVGSSPEAATEILKTHDKELCGRHVPMVSFAT

DPKLNKDSIAWSYECGKEWMAFRALMRTELFSTKIVETQYHVREKNVRAMVDYLSRKQGE

LVAMRDVVYIYTFNTLGNVYFTRDFMDFDGEEGRRVSALVREMMELWSAPNISDLYPILS

RFDLQGLRKKADVCVKKMCDLWDHSIRERREIRGKSRHDSSDLAPKNKDFLDILLESGFD

DEQISYIFL

ELLAAVSDGSTSTVEWALSEMVKNPEAMKKARQELSEQISESFVTESQL

SKLPYLHACIKETLRLHPPAPVLLPRRAAQDLEIMNHTIPKNAQVLVNVWAIARDEKIWK

DPMSFKPERFINSSVDYKGNDFEYLPFGAGRRICAGLPMATRQVLLALANLIHQFEWSLP

DNLRPEQLDMEELFGVTLLKENPLALIPKRKF*

 

>CYP80J2

$supercontig_107:98665,100334 CYP80J2

GLHM_ORF_14_from_supercontig_107 95% to 80J1

MQTLIESILPTDSSATLPLVLLLFSIVFLIIVKQKSSNKLPLPPGPRPWPIVGNLPHLDK

KMHVSMADLAKTHGGLMSLRLGTQLVIVGSSPEAATEILKTHDKELCGRHVPMVSFATDP

KLNKDSIAWSYECGKEWMAFRALMRTELFSTKIVETQYHVREKNVRAMVDYLSRKQGELV

AMRDVVYIYTFNTLGNVYFTRDFMDFDGEEGRRVSALVREMMELWSAPNISDLYPILSRF

DLQGLRKKADVCVKKMCDLWDHSIRERREIRGKSRHDSSDLAPKNKDFLDILLESGFDDE

QISYIFLELLAAVSDGSTSTVEWALAEMVKNPEAMKKAREELSEQIPEKFVCESQLPRLP

YLHACIKETLRLHPPAPVLLPRRAAQDLEIMNHTIPKNAQVLVNVWAIARDEKIWKDPMS

FKPERFINSSVDYKGNDFEYLPFGAGRRICAGLPMASRQVLLALANLIHQFEWSLPDNLR

PEQLDMEELFGVTLLKENPLALIPKKKF*

 

>CYP80J3

99% to CYP80J1

101960..103681 (- strand)

GLHM_ORF_15_from_supercontig_107

MQSLDIESILKNADSSATLPLLLLLFSIVFLLVIKQKSSRKLPLPPGPRPWPIVGNLPQL

GKKMHVSMADLAKTHGGLMSLRLGTQLVIVGSSPEAATEILKTHDKELCGRHVPMVSFAT

DPKLNKDSIAWSYECGKEWMAFRALMRTELFSTKIVETQYHVREKNVRAMVDYLSRKQGE

LVAMRDVVYIYTFNTLGNVYFTRDFMDFDGEEGRRVSALVREMMELWSAPNISDLYPILS

RFDLQGLRKKADVCVKKMCDLWDHSIRERREIRGKSRHDSSDLAPKNKDFLDILLESGFD

DEQISYIFLLHELLAAVSDGSTSTVEWALSEMVKNPEAMKKARQELSEQISESFVTESQL

SKLPYLHACIKETLRLHPPAPVLLPRRAAQDLEIMNHTIPKNAQVLVNVWAIARDEKIWK

DPMSFKPERFINSSVDYKGNDFEYLPFGAGRRICAGLPMATRQVLLALANLIHQFEWSLP

DNLRPEQLDMEELFGVTLLKENPLALIPKRKF*

 

>CYP81B19 old a

supercontig_21:1436011,1437644

GLHM_ORF_191_from_supercontig_21 44% to 81D1, 45% TO 81A5

61% to 81Bb, 55% to 81B2 tobacco

MAAIWYLYCSLIFSMLYFFTKRFSKKIENLPPRPFPCLPVIGHLHLLKQPIFKTLSEIAK

KHGDLLLLQYGSRPVLLVSSPAAAEECFTTNDVACANRPRFLMTKHFAINNTSLAWAPYG

DHWRNLRRLVSLELLSSGRLQLLQWIRVNEVKSMVSSLIKRQNRPLDMRVVFFELTLNVM

MMMIAGKRYVGDNITDAKEAKKFREIHGETFKIGGTMAIVDYIPWIKSWKLEKQMIELQK

ERDAFMQNLIEERRRKMKSNRRDGESWKTLIDVILILQETDPEYYSDAMIRSLILVLILA

GTDTTINTMEWSLSLLLNHPEVLKKVQMEIDNQIGENKRLLEESDLPKLPFLRSIILESN

RMYPPLPLLVPHETSKDCIIGGFRVPSGTMISTNAWAIQNDPNTWEDPRSFKPERHKSSV

GFPELGGRDGFKLMPFGSGRRGCPGEALAVRTVGLALGTLIQCFDWSRVGEEMVDMTEAI

AFSLQKGEPLQAKCKPRAIMAKFLSQEKLFSITDIY*

 

>CYP81B20 old b

80% to 81Bf, 85% to 81Bc

supercontig_21:1438585,1440177

GS_ORF_141_from_supercontig_21 43% to 81A6

MAVWYLYSLLIFLVTSIFTRHFLNKIQNLPPTPFPCLPVIGHLYLLKRPIYRTLSRISKR

SGDVLLLQFGSNRVLVVSSPSAAQECFTKNDIIFANRPHFLMGKHLAYNFTAISWAPYGD

HWRNLRRISSLELLSPTRLQMLYHIRADEVRTMIRNLLESQDQVVDLRTSFFELALNIMM

RMIAGKRYYDKNVEDVREANRFRELHDETLKLSGLTAIEDFLPWIKSWDLERKLIECQKK

RDGFMQDLIEEGRRKMKFDSCDGERKKTMIDVLLSLQESEPEYYSDLIIKGLMLILLMAG

TDTTINTMEWALSLLLNHPEELKRAETEIKNQIPEGRLLHESDLPNLPYLRCIINETMRL

YPAAPLLAPHRSSAECSVGGFRIPAGTTLMVNVWAIQHDPKIWEDPTKFKPERFREMSET

AGAGAKDGYCLMPFGSGRRSCPGDGLAMKVIGLTLGSLIQCFEWTRADKEMVDMTEGVSF

TLQKAKPLRAKCRPRATMAELLSKI*

 

>CYP81B21 old c

85% to 81Bb

supercontig_21:1447584,1451390

GS_ORF_143_from_supercontig_21 44% to 81A6

MAVWYLYSLLIFLAISIFTRHFLNKIRNLPPTPFPCLPIIGHLYLLKPPIYRTLSRISKR

NGGVFLLQFGSNRVLVVSSPSAAEECFTKNDIVFANRPHFLIGKHLAYNFTIMSWAPYGD

HWRNLRRISCLELLSPARLQMLYHIRADEVRTMIRNLLDSQHRLVDLRTSFFESTLNTMM

GMIAGKRYYDKNVEDVKEANRFREIHVETSKVAGLTAIGDFLPWIKSWDVERRMIECQKK

TDGFMQDLIEEGRRKMKIDSCDGERKKTMIDVLLSLQESEPEYYSDLIIKGLMLILLLAG

TDTTISTMEWTFSLLLNHPEELIRAQIEIDNHISESRLLHESDLAHLPYLRCIINEAMRM

YPATPLLAPHRSSAECSVGGFCIPAGTTLMVNAWAIQNDPNVWANPTKFKPERFREILKT

AGAGTKDGFCLMPFGYGRRSCPGDGLAMKVMGLTLGSLIQCFEWTRVDEEIVDMTEGVSF

TLQKAKPLQAKCRPRATMADLLSGI*

 

>CYP81B22 old d

78% to CYP81Bb

supercontig_21:1452408,1453994

GLHM_ORF_196_from_supercontig_21 43% to 81A6

MAVWYLYSILGLIVLSIFTKHFLNKIQNLPPTPFPCLPIIGHLYLLKQPIHATLSRIAKR

YGHVLLLRLGSRKVLVVSSPSAAEECLTKNDIVFANRPRFLIGKHLAYNFTTISWAPYGD

HWRNLRRIASLELLSPTRLQMLYDIRADEMRMMIRTLLDSQERVVDLRPLLFELTLNMMM

RMITGKSYYGKNVGDLEEANRFREFHVETFKLGSATTIGDFFPWIKSWNIERRMIACQTK

RDGFTQELMEERRRKMKADSYYGGRKETMLDVLLSLQESEPEYYSDEIIKGLMLDLILGG

TDTTINTMEWALSLLLNHPEELERAQIEIDNHISEGRLLHESDLPHLPYLRSIINETMRM

YPAPLLAPQESSAECSVGGFRIPAGTTLMINVWAIQNDPNIWTDPTNFKPERFKGISETT

GVKDVFRLMPFGYGRRSCPGDGLALRVIGLTLGSLIQCFEWTRVDKEMVDMTEGISFTLQ

KARPLQAKCRPRAAMAEMLSKI*

 

>CYP81B23 old e

87% to CYP81Bf

supercontig_688:5847,16242, with a seq gap in mid region

MAVWYLYSLLLFLPVFVFTKHFLNKIQNLPPTLFPCLPIIGHLYLLKQPIY

RTLSRISEQNGDVLLLRFGSRKVLVVSSPSAAEECFTKNDVVFANRPRFLIGKHLAYNFS

GMSWAPYGDHWRNLRRISSLELLSASRLQMLYHIRADEVKNMIRNFLKCQDCLVD

LRTSFFELTLNMMMRMIAGKRYYGENVEDVKEAKRFR

EFHAETFKLSGSAPIGDFIPWVKSW

DLEKRMIECQKKRDEFMQDL

 

 

DGFFLMPFGYGRRSCPGDGLAMRVIGLTLGSLIQCFEWSRVDDEMVDMSEGVCFT

LQKAKPLQAKCRTRAAMADLPSRM*

 

>CYP81B24 old f

58% to 81B2v2 tobacco, 45% to 81F3

last part of GS_ORF_225_from_supercontig_17

supercontig_17:2384354..2385990 (+ strand)

MAVWYLSSLLLFLVLSIFTKHFLNKIHNLPPTIFPCLPIIGHLYLLKQPIYRTFS

RISKQNGHVLLLRFGSRQVLVVSSSSAAEECFTKNDIFFANRPRFLIGKHLAYNFTSISW

APYGEHWRNLRRIASLELLSATRLQMLYHIRADEVKKMIRNILESQDNLVELRTSLFELT

LNMMMRMIAGKRYYGQNVEDVKEAKRYREFHAETFTLSGSAPIGDFIPWVKSWDLEKRMI

DCQKKRDEFMQDLIEERRRKMKADNSDGEKKKAMIDVLLSLQESEPEYYSDEIIKGLML (0)

FSVEVLLMAGTDTTINTMEWTLSLLLNHPEELKRAQMEIDNHIPEGCLLQESDLPHLPYL

RCIINEAMRMCPAVPVLVPHESSAECTVGGFRIPAGTTLMVNVWAIHHDPKIWEDPEKFK

PERFRGISKTAGAGVKDGFFLMPFGYGRRSCPGDGLAMRVIGLTLGSLIQCFEWSRVDDE

MVVMTEGVTFTLQRAKPLQAKCRPRAAMADLLSRI

 

>CYP81D14P pseudogene 3

GS_ORF_90_from_supercontig_6:676464,678071  (+ strand)

80% to GS_ORF_89_from_supercontig_6

LFSSSSISYAR*QKRNRRQQNSAAKCSFSLSFFGHLHRLRESLLHRTLWSLSQRLGPV

FSLQLGSRFVVVESSPSAVEECFTTNDVILANLANRPRFIMGKDFAYDNSSVITAPYGDH

WRNLRRICAIEIFSSTRLNASSSTRNDDNQFLLRMLRRASSGSGFFSRVELRPMFTELMF

NTLIRTLAGKRYSGENLSCVEEMSEFRELIDEIVEFAGATNLADFLPVLR*VDYQGIARR

SERLGRKTDAFLLGLVDEHRRKKXXXXX

ENTMISHLLSLQESNPEYYTDEIIKSLVSVS

LIAGTDTTGTTLEWAMSNLLNHPYVLQQAKTESDTYVGVDRLINESDHPNLTYFNAIISE

TLRLYPASPLLVPHESSDECKISGYHIPRGTMILVSAWGIHRDPKVWNDPTSFRPERFED

GNSGAHCKVVPIGVWGRACPGMVLGVRMVGLG

LGSLLQCFEWKRVGEEEIDMGEGEGKGITMPKAHPLIAMCKTRDVLDKFF*

 

>CYP81D15P pseudogene 2

GS_ORF_90_from_supercontig_6:675583,675827

Upstream of CYP81D pseudogene 3

62% to GS_ORF_87_from_supercontig_6

NFSKLEYLQHIIFETLRFHLLAPLLLPHVSSDYCVINSYDMLTNIILL

LID*A*TIHKDPKI*EDPTSFKSKRFEKSKVEAQKL

 

>CYP81D16 old e

GS_ORF_89_from_supercontig_6:669662,671325

55% to GS_ORF_87_from_supercontig_6

MEVTWLFQLLVTLITVLFFINYLRKVRRSQSPADKILPPSPPFSLPFLGHLHLLREPLLH

RTFWSLSQRLGPVFSLQLGSRFVLVVSSPSAVEECFTTNDVVLANRPQFIMGKDLAYDYS

SVITAPYGDHWRNLRRICSIEIFSSTRLNASSNTRNDETQFLLRRLRRTSSGSGLFSRVE

LRPMFTELTFNIVIRMLAGKRYYGENLSCVEEAKEFRELIGEIVEYGGATNPADFLPVLR

WVDYQGIAKRSERLGRKTDAFLQGLIDEHRRKKGSPEFENTMISHLLSLQESSPDYYTDL

IIKGLVLIMLVAGTDTTGITIEWAMSNLLNHPYVLQKAKTELDTYVGADHLINESDLLNL

TYLNAIISETLRLYPASPLLVPHESSDECKIGGYHIPRGTMVLVNAWGIHRDPKVWDDPA

SFRPERFEDGQGDAHYKLLPFGAGRRACPGMALGIRTVGLVLGSLIQCFEWKRAGEEEID

MGEGKGITMPKAHPLIAMCKARDVLDKFF*

 

>CYP81D17P pseudogene 1

GS_ORF_88_from_supercontig_6:661821,6668154

76% to GS_ORF_87_from_supercontig_6

MESTATL*SSLTLIVLLPILRLLLQFSGFRSNQKLPPSPPWLPFVGHL

HLLKPPIHRTFHKLSQTYGPIFSLRFG

SRLVFIVSSPSIAEECFTTNDVCLANRPPLLVGKHIGYNYTTMVSSPYGSHWRNLRKIGA

IEIFTSNRLNMFLSIRKDEVRRLLCRLARDSRPGFTKVELKSLFSDLTLNNMMRMVAGKR

YCGEGASNEKEANEFKEVISAALELAGASHXXXX

LPVRRIARS*LREKCEEYWERMDRFLQGLTDENRRNEEGNSMINH*LSLQQSEPENYNDQIIKGLIM (0)

VILIVGIDSSVVTIEWTLSNLLNHSDILNKARIEINNAVGEDCLIDE

XXXXKLEYLQNIIFEXXXXX

PPALLLLPHMSSDHCVIRGYDVPSNTISLINA*AIHRNLKK*EDPTSFKLERFENNK

 

>CYP81D18 old d

60% to 81D8

GS_ORF_87_from_supercontig_6:658617,660459

MESTAALYASLTLIFLLPIIRLLIQFSGFRSNQKLPPSPPRLPFVGHLHLLKPPIHRTFH

KLSQTYGPIFSLRFGSRLVFVVSSPSIAEECFTTNDVVLANRPRLLVGKHISYNYTTMAT

SPYGSHWRNLRKIGAIEIFSSNRINMFSSIRKDEVRRLICRLARDSRRGFIKVELKPLIS

DLTLNNMMRMVAGKRYCGDGVSNGKEANEFKELISVVHELAGASHPGDFLPVLKWIGHNY

EKKVKNTAKRMDGFLQGLIDEKRRNEEEGNSMIDHLLSRQQSEPEYYNDQIIKGLIMVIL

VAGTDTSMVTIEWALSNLFNHPDILNKARAEINVKIGENRLIDEFDLPKLEYLQNIIFET

FRLYPAAPLLLPHMSSDQCVIHGYNMPSDTILLINAWTIHRDSEIWKDPTSFKPERFEKN

KEEALKLIMPFGLGRRTCPGAGLAQRLVSLVLGSLIQCFEWERVSEKEIDMREGKGITMS

KLEPLEAMCRARPIMDKVLKYAD*

 

>CYP81D19 old c

57% to 81D8

GS_ORF_86_from_supercontig_6

Too long at N-term, missing C-term in a seq gap

MEITAALYSSLTLILLLPILRFLLQFSGFRSNQKFPPSPPRLP

FVGHLHLLKPPIHRNFHKLSQTYGPIFSLRFGSRLVFVVSSPSIAEECFTTNDVVLANRP

RLLVGKHIGYNYTTMASSPYGSHWRNLRKIGAIEIFSSNRLNMFSSIRKDEVRRLICRLA

RDSRRGFVKVKLKPLFSDLTLNNMMRMVAGKRYCGDGVSNEKEANEFKELISAVLQLAGA

SHPGDFLPVLKWIGHNYEKKVKNTAKRMDGFLQGLIDEKRRNEEGNSMIDHLLSLQQSEP

EYYNDQIIKGLAM

IILAAGTDTSMVTIEWALSNLLNHP

 

>CYP81D20 old b

supercontig_6:652529..655017 (-) strand

55% TO 81D2 REMOVE INTRON SEQ IN MID REGION

GS_ORF_85_from_supercontig_6

MEDSTVLYTSLTLIFIFFLRKLLQFSNSRTNQKLPPSPHGRLPLIGHLHLLKHPTHRTLY

DLSLKYGPILSLRFGSHLVFVVSSPSIAEECFTTNDVVLANRPRHLSGKYIDYDNTTMVA

APYGSHWRNLRKIGSIEIFSTHRINMFSSIRKDELKRLLCRLGRDSREGFTKVELKSLFT

NLTLNNMMRMVAGKRYCDDGTNNEEEAIEFKEIAAGIFKLSGASNVGDFLPILNWFGHSF

EKKLKEMGERMDRFLQRLIDERRNNGGRNTVVDHLLTLQQSEPEYYTDKVIKGLIL

VILVGGTDTTSITIEWALSNLLNHRDVLINVKTEIDT

QVGQNRLLDESDIPNLQYLQNVIFETLRLYPTAPLLVPHMSSSHCVINGYDMPPNTILIT

NAWAIHRDPEIWEEPSRFNPDRFINNKVDVHKLIMPFGLGRRTCPGAGLAQRMVCLILGS

LIQCFEWERVSGDEINMEGEEGLAMSKLKPLEALCKARPIVNEFMGDVD*

 

>CYP81D21 old a

71% to GS_ORF_87_from_supercontig_6

supercontig_6:627926,630253

GS_ORF_82_from_supercontig_6

MENPILLYISLALIFILFLLKLLQFSNSRTNQKLPPSPTGRLPLIGHLHLLKHPIHRTLH

GLSLKYGPILSLRFGSRLVFLVSSPSIAEECFTTNDVVLANRPRLLMGKYIGYNNTTMVA

SPYGSHWRNLRKIGSIEIFSNHRINMFSSIRKDEVKRLLCRLGRDSRGGFTKVELKSVFT

DLTLNNMMRMVAGKRYCGDGTNNEEEAMEFKEILAGVIKLGSASHPGDFLPILNWFGHSF

EKKLKKMGERMDRFLQCLIDEKRNNGGGNTMIDHLLTLQQSKPEYYTDEVIKGLILVILS

AGTDTISITIEWALSNLLNHRDALIKARIEIDTQVGQNRLIDESDFSNLQYLQNIIFETL

RLYPPAPLLIPHMSSNHCIINGYDMPPNTILMTNAWTIHRDPEIWEEPLKFNPDRFRNDE

VDAEKLIMPFGLGRRTCPGAGLAQRMVCLTLGSLIQCFEWERINEEEINMEEGKGITMSK

LKPLEALCKARPIINELMEDVD*

 

>CYP81K3

58% to CYP81K1

supercontig_21:1470336,1471961

GLHM_ORF_199_from_supercontig_21 43% to 81M1

MEISPYFLPLILFLFFLTKLLLRRNQSLPPSPPALPIIGHLHLINKPLHHALDTFKSKYG

PILYLHFGSLPVLVVSSPSAIEECFTKNDVVLANRPRSVAGDHLSYNYTVYGFAPYGDLW

RTLRRLTVLQVFSSSSLQKYSSVREEEVAILCRRLFKICSNGVQKVDLKRLLCLTIANIM

LRIIAGKRGVEGKEAEMEKENQFLAEFKERFFPSMSMGVCDFIPFLRLIGYKGLEKIAIR

MRRLRDEYMQNLIDEIRLKGRSSSLKDEISVIEILLSLQDSDPEFYTDDIIKSVLLMLFN

GGTDTSGITMEWAMSLLLNNPEAMNKLRSEIDKNVGHGRLINDSDLPKLHYLRCVIHETL

RLYPATPLLLPHLSNADCTVGGYDIPRGTMVLVNIWSLHRDPSVWEEPMKFKPERFEGML

GEREGFRYVPFGAGRRACPGAGMGIRTISLAVGGLVQCFEWGKMGEREVDMSQALVVTMS

KAKPLEVLCRPRQDFIHMLSRL*

 

>CYP82C16P pseudogene

supercontig_31:1974574,1974974

48% to 82C14P poplar

1974574 KELDIHVGKERHVSESIIFSLVYLQRIIKNTMQLYHVRPLVKCHITNDCTVGGYHVASD 1974750

1974751 NRLSINIWKICRNP*VWSNSLEFKIE 1974828

RFLTNNKNIGVRSQNLEYT

FGFGRTTCSGLYLAFQMMELGFVAILYTF 1974974

 

>CYP82C17

70% to 82C5 poplar, 64% to 82C4

supercontig_64:153531,155182

GS_ORF_15_from_supercontig_64

MGISLAAVGFYLILLFIRSKLKTNYKDVKNREAPEPAGVWPIIGHLRLLGGTDQLLYRTL

GAMADKYGPAFNIRLGYRRAIVVSSWEVAKECFTINDKALASRPTTGAAKHMGYNYAVFG

FAPYSSFWREMRKIATLELLSNRRLEMFKHVWVSEIEMGVKELCSSMAKSNNRVLVYLKQ

WLEDITLNIVARMVAGKSYFGASTTAGCEDEEARRCQKATNEFFHLIGIFVISDALPFLG

FLDFQGHEKAMKKTAKEPDAILETWLEEHRRRRISERRNAAETNKDFIDVMLSLEEEGKF

SDLQYDANTSIKSTCLIIIVVIYIYIILGGSDTTAGTLAWAISLLLKNLSILKNAQDEIE

NHVGRERQVEEADIKKLVYLQAIIKETLRLYPAGPLLRPREAMDDCSINGHSIPAGTRLV

VNVWKIQRDPSVWENPNEFKPERFLTLNRADCDVRCQQSELIPFGSGRRSCPVASFALQV

LHLRLARLLHAFDFTTPFGQPVDMSESPGLTIPRATPLQVLVTPRLPPTLDGY*

 

>CYP82L3

60% to 82L2 Poplar, 52% to 82G1

supercontig_428:22538,26196

GLHM_ORF_5_from_supercontig_428

MDFPSDYIHSISVFLTLLMIYALSKTFLFKQSNKSSAARKIPEPSRPWPLIGHLHLLGRH

DPICRQMGSMADMLGPIFWLKLGRHRLLVVSSPELVKNCFTTNDKILATRPSIAAGRYMG

YNNAILALAPQGKYWRDIRKLVTVELLSTDRLELLKHIRFLEVDTFIKELYKQSAAVDLS

KSFEGLTFNMILRMVMGKRYSSDDYGEGNSEVSRYKSAIKKAEYLSGVFVEADAIPWLEW

LDIQGHVRSMKETAKELDSVISGWLDEHLQKRRQATAELQDSDFMDAMLSTLPEDAVISG

YTRHIIVKATALILTLTGSESISITLTWALSLLINNPTVVKVAQDELDREIGKEKWVEES

DMNKLNYLQAIVKETLRLYPPGPITGLREAMEDCDIGGYLVPKGTRVIVNIWKLQRDPRV

WKNPCEFRPERFMADNNGDHQNKFEFIPFSSGRRGCPGATYGLQVVQLTVARLLQGFHVR

AAVGSSVDMREGLGISMPKVNPLHVCLTPRLHHRLYH*

 

>CYP83B1

67% to 83A2/83B1

supercontig_26:1706286,1707877

GLHM_ORF_253_from_supercontig_26

MDWVILLAALPLLLVLVFQKYKNAPRLPPGPKGLPFIGNLHQMESHNPQHFMHRLSKIYG

PIMSFKIGSKRVVVVSSAELAKEALKTQDLNFCNRPLLCGQQKMSYKGLDLGFGQYTPYY

REMRKLYVINLFSPKTVQSFSPVRVDEVSRMMDKMTKAALKAEIIDLSEMMLSFTNAVVC

RTAFGKRYAEYGEEMRRFIELLYETQAMLGVFFFTDYFPYLGWLDHFTGLRSRLNKAAKA

LDIFLQGIINERLDPNMPKPEKECLIDLLLQFCKDQPFSSVEFTHQNVKALIM (0)

DVVIAGTDTAAAAVVWAMTYLMKNPEALKKVQEEVRSLVGDRGY

VTEDDVPNLTYMKAVVKEALRLEPVIPLLLHREALEDCKIGGYDIPAKTILQVNAWAIAR

DREAWGQNPEEFRPERYIDKPVDYKGQDFELIPFGSGRRMCPGMHLGVAMLELPFANLLY

KFDWELPPGVKAEEIKMDVMTGLAMHKKDHLLLLPKKHI*

 

>CYP84A26 old c

77% to 84A1

GLHM_ORF_241_from_supercontig_6

supercontig_6:1648677,1654540

MDSLLNSFTHQPVTMSFFFIVPLLLVLGLISRLRRKHPFPPGPKGLPLIGNMMMMDQLTH

RGLAKLAKRYGGLFGLRMGFLNMVAVSSPEVARQVLQAQDSIFSNRPATIAISYLTYDRA

DMAFAHYGPFWRQMRKICVMKVFSRKRAESWASVREEVDKMVRTVVANTGKTVNVGELIF

SLTRNIIYRAAFGACSEDGQDEFIKIMQEFSKLFGAFNIADFVPYLGWVDPQGLNIRLVK

ARQSLDGFIDSVIDEHIQKKKNGSNLSDDDADTDMVDELLAFYSEEAKVNQSDDLPNAIR

FTRDNIKAIIMDVMFGGTETVASAIEWALSELMRCPEELKRVQQELADVVGLDRRVEEKD

MEKLTYLKCVIKETLRLHPPIPLLLHETAEDAEIGGYVIPKKSRVMINAWAINRDAKSWE

NPDSFKPSRFLNQGMPDFKGSNFEFIPFGSGRRSCPGMQLGLYALELGVAHLLHCFTWSL

ADGMKPSELDMNDVFGLTAPRATRLMAVPSSRLICPLH*

 

>CYP84A27 old d

78% to 84A1

GS_ORF_208_from_supercontig_6

supercontig_6:1663480,1665117

MAFFFVVPLLLVLGLISRIRRKFPFPPGPKGLPLIGNMMMMDQLTHRGLAKLAKQYGGLF

GLRMGFLNMVAVSSPEVARQVLQVQDNIFSNRPATIAISYLTYDRADMAFANYGPFWRQM

RKICVMKVFSRKRAESWASVREEVDKMVRTVVANTGKTVNVGELIFSLTRNIIYRAAFGS

CSEDGQDEFIKIMQEFSKLFGAFNIADFIPYLGWVDPQGLNTRLVNARRSLDGFIDSVID

DHIQKRKNVNNLPSDDADNDMVDELLAFYSEEPKGNQSDDVQNVIKFTRDNIKAIIMDVM

FGGTETVASAIEWALAELMHCPEELKRVQQELADVVGLDRRLEEKDIEKLTYLKCVIKET

LRLHPPIPLLLHETAEDTDVAGYLIPKKSRVMINAWAIGRDPTSWDEPDSFKPSRFLNQG

MPDFKGSNFEFIPFGSGRRSCPGMQLGLYALELGVAHLLHCFSWSLPDGMKPSELDMSDV

FGLTAPKATRLMAVPSSRLICPLY*

 

>CYP84A28 old b

72% to CYP84A1

supercontig_150:256696,262865

GLHM_ORF_33_from_supercontig_150

MVSERSREPGCRARSARRLKLPYPPGPRGLPIIGNMAMIDQLTHRGLAQLGKKYGGLFHL

RMGLLHIIGVSTPEMAREVLQAQDIVFSNRPANVAISYLTYDRADMAFANYGPFWRQMRK

ICVVKVFSRKRTESWASVREEVDSMVRAVKEKTGSAVNLGEMIFALTRSITYRAAFGSVS

KEGQDEFMKILQEFSKLLGALDISDFVPWLGWVHSQEFNKRLVRARSLLDGFIDNIIDEH

IEKKKMMVAKGFDEEEGDTDMVDELVAFYSEDAQKGQFDESQFAIKLTRDNIKGIIMDVM

FGGTETVASAIEWTLSELIKSPEDLKRVQRELADVVGLNRAVQESDMEKLTFLKCVLKET

LRLHPPIPLLLHETSKDSVVSGYKIPSGSRIMINVWAIGRDGSAWVDPDVFRPSRFLEEG

APDFKGSNFQFIPFGSGRRSCPGMQLGLYALDLTVAHLLHCFNWELPDGQKPSELNMDDV

FGLTAPRASQLVAVPSYRLSCP*

 

>CYP84A29 old a

71% to 84A1

supercontig_150:253674,256641

GS_ORF_25_from_supercontig_150

MESWQQSLQTSPMIFFLLPLLGLIVIFLLKSSRKLPYPPGPKGYPIIGNMTMMNQLTHHG

LTELGKKYGGLVHLRMGRLHIVGVSTPEMVREVLQVQDIVFCNRPANVAINYLSYDRADM

AFANYGPFWRQMRKICVMKLFSRKRAESWASVREEVDSIVRALEKKTGSPVNLGEMVFAL

TRSITYRAAFGSFSNEGQDEFMKILQEFSKLFGAFNIADFVPWLGWIHSQEFNKRLVRAR

GSLDGFIDKIIDEHVEKKKKIDDEGDADTDMVDELMAFYSEDASKEDFDESQSVIKLTRD

HIKAIIMDVMFGGTETVASAIEWALAELMKSPEDLKRVQQELADVVGLNRVVQESDFEKL

TFLKCVIKETLRLHPPIPLFLHETAQDTVVSGYRIPSGSRVMINAWAVGRDRSSWVDPDD

FRPTRFLEEGAPDFKGTNFEFIPFGSGRRSCPGMQLGLYAVDLTVAHLLHCFNWELPDGM

EADGSTRRSAELSTELSVNIGGVRMECVNGARERTAFCLGL*

 

>CYP85A6 AM431608 Vitis vinifera 71% to CYP85Aa, 70% to 85Ab

join(3836..4023,4976..5297,5434..5583,5667..5912,

6003..6089,6156..6234,6315..6421,6524..6648,6838..6925)

MAVLVVIFVLVVALSVCFALLKWNEIRYSRRGLPPGTMGWPLFG

XTTDFIKQGPDFMKKQRARYGSFFKTHILGCPTIISMDPELNRYVLLNEGKGLVPGYP

QSMLDILGEHNIAAVQGSTHKYIRGSMLSLIAPPMIKDQLLRKIDQGMRFHLSNWDGR

TIDIQEKTNEMALFIPFKLIMETESASIYETFKREFDKLVEGTLSLPINIPGTSYHHG

FQGRKNVIRMLKGVMEKRRASSMTQDDMLGYLLRNEGSKYNLSDEEILDQVITILYSG

YETVSTTSMMAVKYLLDNPRALQQLREEHLAIRQRKNPEDPIDWNDYKSMNFTRAVIF

ETSRLATVVNGVLRKTTKEMELNGFVIPRGWRIYVYTREINYDPFLYPEPYTFNPWRW

LDNSLESHNYCFTFGGGTRLCPGKELGIVQISTFLHYFLTSYRWEEVGSNKIVKFPRV

EAPNGLHIRVSKY

 

>CYP85A7 DQ235273.1 Vitis vinifera brassinosteroid-6-oxidase (BR6OX1)

71% to AM431608 Vitis vinifera

MAVFGVVLIGLCICTALLRWNEVRYRKKGLPPGTMGWPVFGETT

EFLKQGPSFMKNQRARYGKFFKSHLLGCPTTVSMDPELNRYILMNEAKGLVPGYPQSM

LDILGKCNIAAVHGSTHKYMRGALLALISPTMIRGQLLPKIDEFMRSHLNKWDTKIIN

IQEKTKEMALLSSLKQIAGIESGTISKEFMPEFFKLVLGTISLPIDLPGTNYRRGFQA

RKNIVGMLRQLIEERKASQETHNDMLGCLMRTNENRYKLSDEEIIDLIITILYSGYET

VSTTSMMAVKYLHDHPRVLDELRKEHLAIRERKRPEDPIDWNDYKLMRFTRAVIFETS

RLATIVNGVLRKTTKDMELNGFVIPKGWRIYVYTREINYDPLLYPDPLAFNPWRWLDK

SLESQNYFLLFGGGTRQCPGKELGIAEISTFLHYFVTRYRWEEVGGDKLMKFPRVEAP

NGLHIRVSAY

 

>CYP85A8

61% to CYP85A2

supercontig_1:2245115,2247841

GLHM_ORF_267_from_supercontig_1

MAVLLVVVCGLIALSFCVCFVFFLLRWNEITYNTTGLPSGTMGWPVFGETTEFLSEGPNF

IKNQRARYGSLFKTHILGCPTVICTDPKLNRYILMNEEKGFVPGYPQSMLDILGKSNIAA

LHGSAHKVIRGSLLSLIAPSAIKDHLLLKTDSFIRSFLDNWEARTIDIQQKTTEMALLMA

LKQIVEGESSLFYERFKTEFDKLVLGTLSLPINIPGTNYHRGVQARKRVIKILREIMEKR

RNSSYTILHNDMLDQLMREENSKYNLSDEEILDQVITILNSGYETVSTTSMMAIKYLHDN

PQVLQELREEHLAIQKRKKAGDAIDWDDYKSMTFTRAVIFETSRLATVVNGVLRKTTQDV

ELNGFVIRKGWRIYVYTREINYDPYIYPEPFRFNPWRWLENNMQSHKYCLIFGAGSRLCP

GKEIGIAQISTFLHYFVTKYRWEEVGGEKIVQFPRVEAPNGLHITLSNFTNLKSLRI*

 

>CYP85A9

70% to 85A2, 86% TO DQ235273.1 Vitis vinifera, TOP GENBANK HIT

GLHM_ORF_257_from_supercontig_14 :2298666,2301477

original model missing  N-term

MAVFMVVLVLFFLVLCTCASLLRWNEVRYMKKGLPPGTMGWPIFGETTEFLKHGPNFMKNKRAR

YGSFFKSHILGCPTIVS

MDPEVNRYILMNEAKGLVPGYPQSMLDILGKSNIAAVHGSTHKQMRGALLALISPSIIRD

QLLPKIDDFMRTHLADWDKKIINIQDKTKEMALLSSLKQIAGVESSPKANEFMAEFFKLV

LGTLSLPIDLPGTNYRRGFQARKNIISMLRELIEERRASPETHQDMLHYLMGNEESRYRL

SDEQIIDQIITILYSGYETVSTTSMMAVKYLHDHPRVLQELRKEHIAIRQRKRPEDPIEW

SDLKSMRFTRAVIFETSRLATIVNGVLRKTTQEMEVNGFVIPKGWRIYVYTREINYDPYL

YPDPLAFNPWRWLDKGLESQSYFLIFGGGSRQCPGKELGIAEISTFLHYFVTRYRWEEVG

GDKLMKFPRVEAPNGLHIRVYSSY*

 

>CYP86A25 old a

$supercontig_11:315019,316954

GLHM_ORF_25_from_supercontig_11 CYP86A 81% to 86A2

MEISTALLLLAAVTAYLLWFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWICDNLRAC

GGTYQTCICAIPFLARKQGLVTVTCDPRNVEHILKVRFDNYPKGPTWQGVFHDLLGQGIF

NSDGDTWRFQRKTAALEFTTRTLRQAMARWVSRAIKLRFCPILETAQRKAEPVDLQDLLL

RLTFDNICGLAFGKDPQTCAPGLPENGFATAFDRATEASLQRFILPEVLWKIKKWLGLGM

EVSLSRSLAHIDEYLSDVISTRKEELLSQQKDGNPHDDLLSRFMKKKKEYSDSFLQHVAL

NFILAGRDTSSVALSWFFWLITQHPRVDNKILHEICAVLIETRGRDTSAWVDEPLGFEEI

DRLVYLKAALSETLRLYPSVPQDSKHVVKDDVLPDGTFVPAGSSITYSIYATGRMRSTWG

DDYLEFRPERWLSSDGGKFINHDQYRFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRL

TLAPGYRVEQKMSLTLFMKYGLMVNVEKRDLEXXXXXXXXXXXXXGRERVRDILYS

 

>CYP86A26 old b

$supercontig_112:417257,418792

GLHM_ORF_58_from_supercontig_112 CYP86A 78% to 86A1

METTLFLLCLLAAISAYAFWFYLLTQKLTGPKVWPLVGSLPALFKNRTRMHDWIASNLNG

AGGSATYQTCTIALPFFAHKQGFYTVTCHPKNMEHILRTRFDNYPKGPTWQKAFHDLLGQ

GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWVILDKAAKEKQSVDLQD

LLLRLTFDNICGLTFGKDPETLSPEFPENPFAVAFDTATEATLQRLLYPGFLWRLKKLFD

FGGEKRLRESLLVVEDYMNQAISARKNSPSDDLLSRFMKKRDIDGNAFPTPVLQRIALNF

VLAGRDTSSVALSWFLWLLMNHPEIEKKVVHEISTVLRETRGENPGKWVEEPLTFDEADK

LVYLKAALAESLRLYPSVPQDFKYVVNDDVLPDGTPVPAGSTVTYSIYSVGRMKAIWGED

CAEFRPNRWLSTEGDRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAILLRYRLS

LVPGHRVEQKMSLTLFMKNGLRVYLQPRILA*

 

>CYP86A27 old c

72% to 86A2

GS_ORF_26_from_ supercontig_214:277338..282851 (+ strand)

MDLSTAVMVLAAIAAYVIWFKLAFGSTNGPRVWPLLGSLPGLIQNANRLHD

WIAENLRACNGTYQTCICAIPIIGRREGLVTVTCDPKNIEHILKLRFDNYPKGPTWHSVF

HDLLGDGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRSIENRLCPILDAAQLEAK

PIDLQDILLRLTFDNICGLAFGKDPQTLSPGLPENGFATAFDRATEATLQRMILPEIIWK

LKKWLRLGMEVSLSQSLQFIDEYLSHIINTRKVELVSQQQGDSFHDDLLSRFMKKKESYT

YEFLQHVALNFILAGRDTSSVALSWFFWLVSENPEVEEKILMELCSILMETRGSDTTNWF

KEPLAFEEVDRLIYLKAALSETLRLYPSVPQDSKHVIANDVLPSGTFVPKGSNVTYSIYA

VGRMKSIWGEDCLQFMPERWLSSDGKKIQLQDQFRFVAFNAGPRICLGKDLAYLQMKTVA

AAVLLRHRLSLVPGHRVEQKMSLTLFMKYGLKMNVQNRDLKPIMEKICEIRNDECGKIDF

LNGVEMS*

 

>CYP86B7 AM486428.2 Vitis vinifera

join(7453..7557,12117..13259,13900..14304)

MTLDEVIRRSKISAAEEEEFIEPGKEVEMEMDEEEIQVMEVLVA

LIVFVAIHSLRQRKRHGLPVWPFLGMLPSLVGGLRTDMYEWISGVLCRRNGTFVFKGP

WFSSLNCVVTSDPRNIEHLLKGKFSNFPKGAYFRNTVRDLLGDGIFSADDETWQRQRK

TASIEFHSAKFRKLTIESLLVLVHSRLLPVLEDSVKNSASIDLQDVLLRLTFDNVCMI

AFGVDPGCLRLGLPEIPFARAFEDATEATVLRFVTPTCIWKAMRHLNIGTEKNLKISI

MGVDKFANEVITTRKKELSLQCDDKNQRSDLLSIFMGLKDENGQPFSDKFLRDICVNF

ILAGRDTSSVALSWFFWLLDRNPAVEERIMAEICRMVGERKGEEEGDGLIFKAEEVKK

MEYLQAALSEALRLYPSVPVDHKEVIEDDVFPDGTVLKKGTKVVYAIYAMGRMEGIWG

KDCREFKPERWLRDGRFMSESAYKFTAFNGGPRLCLGKDFAYYQMKFAAASIIYRYHV

KVVENHPVEPKLALTMYMKHGLKVNLIRRHESELQKYLKIRN

 

>CYP86B8

73% to 86B1, 79% to Vitis CYP86B (best blast hit)

supercontig_0:3934897,3937111 CYP86B

GLHM_ORF_293_from_supercontig_0 longer  487 aa

missing N-term in a seq gap

LQVLEIVLSVFVFVIIHALRQKKRFGLPIWPFLG

MLPSLVCGLRSNMYEWITDVLRHQNGTFRFRGPWFSNLNCVVTSDPRNLEHLLKTNFSNF

PKGNYFHDTVSDLLGNGIFSADDEIWQRQRKTASIEFHSTKFRKLTVESLLQLVHHRLLP

ILENSSSNSISLDLQDVLLRLTFDNVCMIAFGVDPGCLRLGLPHIPFARAFEDATEATVI

RFVTPTCIWKAMRYFNLGTEKKLKRSIKGVDEFAEQVIRTRSKELLEENSNENQRSDLLT

VFMRMKDEEGRPYSDKFLRDICVNFILAGRDTSSVALSWFFWLLDKNPAVEDKILGEICR

IVREREDVKNGESIENPLIIRPEEIKKMESLHAALSEALRLYPSVPVDHKEVVKDDVFPD

GTVLKKGTKVIYAIYAMGRMEGIWGSDCREFKPERWLRDGRFMSESAYKFTAFNGGPRLC

LGKDFAYYQMKFAAASIIYRYRVKVVEHHPVEPKLALTMYMKHGLKVNLLKREASELQKH

FVNNIKN*

 

>CYP86C8 AM462286.2 Vitis vinifera

MAGKLVMSVVEWLCHHIWFSDIAVALSIVFILSCILNRLTNKGP

MLWPVLGILPSLFFHMNDIYDWGTRALIKAGGTFHYRGMLMGGNYGIMTVDPSNIEFM

LKTRFKNFPKGNYYRERFHDLLGGGIFNVDHESWKEQRRIASSEMHSTQFVAYSFQTI

QDLVNQKLLELTDKLAKSGDCIDLQEVLLRFTFDNICTAAFGIDPGCLALELPEVSFA

KAFEEATELTLFRFMVPPFIWKSMKFFGVGTEKRLQEAVRVVHDFAEKTVADRRIELS

KTGNLNKQTDLLSRIMAIGEHEEGKDNHFSDKFLKDFCISFILAGRDTSSVALAWFFW

LINKNPEVENKILGEINEVLGHRESNTALTMKDLKKMVYLQAALSETLRLYPSVPVDF

KEVVEDDVLPDGTRVKKGSRVLYSIFSMARMESIWGKDCMEFKPERWIKDGQFVSENQ

FKYPVFNAGPRLCIGKKFAFTQMKMVAASILMRYTVKVVEGHSVVPKMTTTLYMRNGL

LVTLEPRLSLVIN

 

>CYP86C9

59% to 86C1 Arab., 64% to Vitis CYP86C (best blast hit)

supercontig_33:656880..658433 (- strand)

GLHM_ORF_101_from_supercontig_33

MAWLYVHFCFWDVGIALLGLFIFSCILERRRTKGPIMWPVLGITPWLFLYGDQLHDWASR

TLTTAGGTYRYRGIWLGGAFGVTTADPSNIEYMLKTNFNNFPKGDSYRERFHDLLGDGIF

NVDGDSWKEQRRMVKAEMHSNRFMQHSFQTTQDLVNKKLIGLTEKFFKSGESFDLQDVLL

RFTFDSICSVAFGVDPGSLAIDLPQVPFAKAFEEATELSLLRFMIPSLFWKPMKYFCLGY

EKRLKKAIKIVHDFADKTVRDRRSQMNSNSANLNHQSDLLSKLMQIENNVKANGNPLPDK

FFRDFCVSFIIAGRDTTSVALSWFFWLLHENPDVESKILSEMKEILGQRKAKTEISNTVF

TEEELKQMVYLQATLSETLRLYPSVPSEMKQVVEDDVLPDGNMVKKGARIFFSVFSMGRM

EFIWGKDCREFKPERWIKDGQFVNENQFKYVVFNAGPRLCLGKRFAYMQMKMVAASILLR

YSVKAIEGHNVAPKVTTTLYMKNGLMVTLNRRPLATE*

 

>CYP87A10 old a

76% to CYP87A2

GLHM_ORF_112_from_supercontig_74:792423..794514 (- strand)

MWGVCTGTVIIIIITHWVYRWRNPRCNGKLPPGSMGWPLLGETLQFFTPNKSSDIPPFVK

ERMEK (2)

YGPIFRTSLVGRPVIVSTDPDLNHYIFQQEGHCFQSWYPDTFTEIFGKQNVGSLH

GFMYKYLKNMVLNLFGPEGLKKMLPEVEQAACRKLLLWSSQETVELKEATAN (0)

MIFDLTAK

KLISYDQEKSSENLRENFVAFIQGLISFPFDIPGTAYHKCLR (0)

GRKRAMRMLKNMLHERRA

KPQKNQSDFFDYVLQELQKEGTILTEAIALDLMFVLLFASFETTSLAITLAIKFLSNHPL

VLQQLS (0)

EEHETILRKRGNADSGLTWLEYKSMKFTLQ (0)

FIMETVRLANIVPGIFRKALRETHFK (1)

GYTIPADWAVMVCPPAVHLNPEKYEDPLAFNPWRWE (0)

GVEINGASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYR (20

RWKTIKGGDILRTPGLQFPNGFHIQLMEKDTTNRTI*

 

>CYP87A11 old b

50% to 87A2, 56% to 87A7 Populus

supercontig_18: 2454585-2456443, C-term  in a seq gap

2456443 IFGWVWDWVNPKCNGKLPPGNMGFPIIGETIQFFSPYGFYDIPPFIKSRITR 2456288

2456069 RFGAIFKTSIVGNKVVVSTDAEVNYKIFQQENKSFLIWYMESFIEIFGQQSLLAYHGMIH 2455890

2455889 KYLKNLILHLVGPENLKANVIHEMDHATRCHLNLWASHHTIDVKEAASD (0)

        MIFEYFSKKLIGYDEKKTSRKLRQNYIDFIEGLVSFP 2455530

2455529 LNIPGTAYHSCLQVK 2455485

2455386 KNAIKVIKEMLKERRSSKAVHNDFLDYLLKEVDKDNTILSEGIAVDLIFALLFATYETT 2455210

2455209 SASITLLMKFISEKPQVLLELX 2455147

2455028 KEHRGIVEKRENENSQITWEEYKSMTFTHM 2454939

        VINETVRLANIVPGVFRKVLEDVE

2454704 VGFAGYTIPAGWIVMVVPSVLHLDPDKYENPLTFNPWRW 2454585

 

>CYP88A16 old a

~80% to CYP88Ab

supercontig_189:278130,280900  with two seq gaps

DMGWPLIGTMWTFLRAFKSSNPDSFTSDLVK (2)

RYGPTGIYKTFMFGSPSVIVTKPETMKRVMTDDDAFMPGWPKSTVELMGKKSFVSISYEE

HKRLRKLTAAPINGYDALCVYLKYIEEIVVIELEKWSKMGKIEFLTRLRKLTFKIIMHIF

LGEESEPVMEALENEYTALNYGVRAMTINIPGFAYHKA

 

GYLIPKGWKALAWFRSVHMDPEIYPNPKEFNPSRWE

GHTPKPCSFVPFGAGTMLCPGNDLAKLEIAIFLHYFVPGYE

MERLNPKSPLRYLPHTRPIDNCLAIIKKLN *

 

>CYP88A17 old b

GLHM_ORF_43_from_supercontig_189   63% to 88A4

supercontig_189:283465..287054

MASISAKIDEVSSIWMTALCIVVGLICLQWLMKRANWWLYESKLGDKQYALPPGDMGWPL

IGTMWTFLRDMKSSNPDSFINNLVQRYGRTGLYKTFMFGQPSVIATTPETLKRVLTDDDA

FTSGWPKATVELMGKKSFVSISYEDHKRLRKLTTAPINGHDALCLYLEYIEEIAVNALEE

LSKMGEVQLLTQLRKLTFRIIMRIFLSEVSEAVMDVLEKEYTALNYGIRAMAINIPGFTF

HRSLKARKTLVAILKSVVNDRRNKMRNNIASKRKDMMDHLLDIKDEKGNKLDDEDIIDIL

LMYLNAGHESSGHTMMWAVILMQEHPEIFKKAKEEAELIVKRRPPTQKGLNLKEIREMKY

LDQVIDETLRYVSFSLVVFRVAKKDVDINGYLVPKGWKALAWLRNVHMDSEIYLNPKEFN

PSRWEGYTPKPCSFVPFGAGSRLCPGNDLAKLEIAITLHYFVLGYEVERINPKSPLVHLP

HPRPVDNCLAIVRKQNP*

 

>CYP88A18 old c

74% to CYP88Ab

GLHM_ORF_44_from_supercontig_189 :288437..291784 (+ strand)

MEFASTSKAEMGSILMAALCMVVGLVSLRWLLKSVNEWMHESKLGHKRCSLPPGDMGWPL

IGTILTFLRDMKSSDPDAFINNNFVKRCGPTGLYKTFMFGHPSVIVTTPEAMKRVLTDDE

AFVSAWPKATLELTGKKSFVGISYDEHKRLCKLTSAPINGHDALSGYLKFIEEDAVSTLE

KLSNMGEIKFLTELRKLSFKIIMGIFLSEESEPIMEVFEKEYCALNYGLRSLAINIPGFT

YHRALKARKRLVALLQSIVTARRDKRKNNIASKAKDMMDHFLDIEDENGDKLGDDYIIDI

LLMYLNAGHESSGHTMMWAAILMQENPEVFKKAKEEQENIVKRRPPTQKGLSLKETREMI

YLNQIIDETLRWTSFALMVFRVARKDVNINGYFIPKGWKALAWFRSVHMDPEVYPDPKEF

NPSRWDGFTPKPCSFVPFSAGARLCPGKDLAKLEISVFLHYFVLSYEVERLNPSAPLIFL

PHPRPVDNCSAIVIKHNP*

 

>CYP88A19 old d

GLHM_ORF_45_from_supercontig_189 61% to 88A4

supercontig_189:293331..296295

52% to GLHM_ORF_37_from_supercontig_133

71% to GLHM_ORF_43_from_supercontig_189

MDEFGSVWSTMICMVVGLVGLKWLLTRANWWLYVSKLGDKQYSLPPGDMGLPLIGSMWTF

LRYFKTRRPDSFIGSFIKRYGRTGLYKTVLFGHPCVLATAPETLKKVLTDDDAFQSGWPK

ATIELMGKKSFAAISYEDHKRLRKLTATPIKGHDALSVYLEYIEEITKTNLEKWIDMGPI

EFLTELRKLTFKIIVHICLSEESEPIMNALEKEYTTLNAGLRAMAIDIPGFAYHKARKAR

KNIVAILQSVVNNRRNRRKNNIPSKGKDMMDRLLDVEDEKGDKLGDDDLIDIMLMYLNAG

HESSGHTLMWAVILMQNHPEVLKKATEEQKLIVERRPSTQKGVNLKEIREMVYLNQIINE

TSRYVSFSLMAFRETKKDVNINGYFIPKGWKVLAWFRGVHMDPQIYPNPKEFNPSRFEDY

IPKPCSFIPFGAGTRFCPGYDLAKLEISIFLHYYLLGYEIKRLNPKSSLVYLPHSRPADN

CLAIVKKQNPWSSSG*

 

>CYP88A20 old e

62% to 88A14 Medicago truncatula
supercontig_133:503093,505519

GLHM_ORF_37_from_supercontig_133 50% to 88A4

MDLVFLIFGVIVCAYVLVFGIVKRANEWYYVGRLGKKKQLLPPGDMGWPLLGNLRAFIKA

FKSQTPDNFIYELVKRYGRTGIYKTYLFGSPSIIVSIPETCRKVLGDDQHFALGYPASTK

QLTGKRSFHSVSHAEHKRLRKLTSSPISGHTALSTYIPCMEDIAMTSLDEWASMQRPIEF

LNEMRKAAFKVITHIWLGSHDDSTRKLMEKYYIDFSCGLKAVAINIPGFAFHKALKARKK

LVEILQGVLDERKRLKNEDWEDRKRGMVDLLLEVEDENSVKLEDEDIIDLLLVFLLAGHE

SSAHAAMWALIYLHQHPDMLQKAKEEQEEVVKKRPSTQRGLNFDEIRQMRYTSKVIDETL

RRTNVSFSNFRQAKEDVTINGYLIPKGWKVLVWNRGVHMDPEVHKNPTEFDPFRWEDYKP

KPSSFIPFGGGSRICPGAELAKVEVYIFLHYFLLNYRLDRVNPASPVVYLPIPRPADYCL

ARIIKLSNNST*

 

>CYP88A21 old f
84% to CYP88Ae

GLHM_ORF_53_from_supercontig_133:713936,711313

MQYLNLLLLIFGGIVCGYVVVFGLVRRVNEWYYVRRLGKKKQLLPPGDMGWPLLGNMPSF

IKTFKSQTPDNFIYDLVTRYGRTGIYKTYVFGSPSIIVSIPETCRKVLADDEHFALGYPA

STKQLTGKRSFHSISHAEHKRLRKLTTSPINGHNALGMYVPYIEDIVVSSLDEWASMHCP

IEFLSEMRKVAFKVITYIFLGSHNDSIRKLMEKYYVDFNYGLKAAAINIPGFAFHKALKA

REKLVEILQGVLEERKGLKNEDWENRKRGMIDLLLEVEDENGVKLEDEDIIDLLLVFLLA

GHESSAHAAMWAIIYLNQHPDLLQKAHEEQEEVVKGRASTEKGLNLNEIRQMRYTSKVID

ETLRRTSLSFSNFRQAKKDVTINGYLIPKGWKVLVWNRGVHMDPEIHKNPTEFSPSRWDD

YKPKPTSFIPFGGGSRICPGADLAKLEVSIILHYFLLNYRLERLNPASPIVYLPIPRPAD

NCLARIIKLSNN*

 

>CYP88A22P old g pseudogene
supercontig_2914 :8615,9333 (minus strand)

87% to 88Ae

FVVIVCV*VLLFGLIKSANKWYYVGRLGKKKHLPPGDMGWPLLGNLHSFIKAFKFQIPD

YGRTDIYKIYLFGSPSIIVSIPETCRKVLRDDQHFALGYPASTKQLTGKRSFHSVSHAEH

KRLRKLTSSPISGHTALSTYIPCMEDIAMTSLDEWASMQRPIEFLNEMRKAAFKVITHIW

LGSHDDSIRKLMEKYYIDFSCGLKAVAINIPG

 

>CYP89A38 old a AM423953.2  Vitis vinifera 64% to papaya

      MDFDLQKMEIWVFLFVVSLCIASLLKSLHDFFFPKLNLPPGPAAFPLI

6418  GNLHWLGPSFADLEPILRNLHAKYGPILTLRIGSRPAIFISENSLAHQALVQNGAVFADR  6239

6238  PAALPASRVMSSNQRNINSSPYGPTWRLLRRNLTAEILHSSRVRSYSHARKWVLEILVSR  6059

6058  LRXHSDGFVPVRIMDHFQYAMFCLLVLMCFGDKLEEKQIQEIEMIQRKLLLAFRGLNRL  5882

5881  NLWPRMGKILFRKRWXEWLNLRKDQEAILLPHIRARQRLKQETQNKQEDDSSSSSKDYVL  5702

5701  SYVDTLLDLQLPEEKRKLNEGEMVTMCSEFLSAGTDTTSTALQWIMANLVKAPHIQARL  5525

5524  FEEISGVVGEGEEEVKEEDLQKMPYLKAVVLEGLRRHPPGHFVLPHSVTQDVSFEGYDIP  5345

5344  KNATVNFSVSDMNWNPRIWEDPMEFKPERFLNSNGDGDHADAGKEFDITGSKEIKMMPFG  5165

5164  AGRRICPGYGLAMLHLEYFVGNLVWNFEWKAVEGDEVDLSEKLEFTVVMKNPLQAHLSPR  4985

4984  LK*  4976

 

>CYP89A39 old b AM423953.2  Vitis vinifera 66% to papaya (best blast hit)

      METWVYNIVISLCVAALLKSLYDFIFPKLNLPPGPTTVPFV

3475  GNLLWLLKSFSELEPILRNLHAKYGPIVTLQIGSRPAIFXSANSLAHRTLVQBGAVFADR  3296

3295  PKALPTNRIFSSNQHNISSAVYGPTWRRLRRNLTAEILHPSRVRSYSQARRWVLEILIS  3119

3118  RLQARSESGEAVRVVDHFQYTMFCLLVLMCFGDKLEEKQIQEIETIQRILLLGFPRFNIL  2939

2938  NFWPRVGKVLFRHRWEELFQLXKKQEDILLPYIRARQQLKQEIQSKQQQDGLESDSSPSS  2759

2758  KNYVLSYVDTLLDLQLPEENRKLNDGEMVSLCSEFLNGGTDTTSTALQWIMANLVKHPH  2582

2581  IQAKLLEEISGVMGERKEEVEEEDLQKMPYLKAVILEGLRRHPPGHFVLPHSVTQDITFE  2402

2401  GYVIPKNASLNFMVSEMNWNPKIWEDPMEFKPERFLNSKGNGDEVFDITGSREIKMMPFG  2222

2221  AGRRICPGHGLAMLHLEYFVANLVWSFEWKAVEGDEVDLSEKQEFTVVMKNPLQVHLSPR*  2039

 

>CYP89A40 old c AM437626.2  Vitis vinifera 64% to papaya

      MDFDRQKMEIWVFFFIASLCIASLLKSLHDFFFPKLNLPPGPAAFPLI

6582  GSLLWLGTSFADLEPTLRNLHAKYGPILTLRIGSRPAIFISENSLAHQALVQNGAVFADR  6403

6402  PAALPASRVMSSNQRNINSSPYGPTWRLLRRNLTAEILHSSRVRSYSHARKWVLEILVSR  6223

6222  LRGHPDGFVPVRIMDHFQYAMFCLLVLMCFGDKLEEKQIQEIEMIQRKLLLAFHGLNRL  6046

6045  NLWPRMGKILFRKRWEEWLNLRKDQEAILLPHIRARQRLKQETPNKQEDDSSSSSKDYVL  5866

5865  SYVDTLMDLQLPEEKRKLNEEEIVTLCSEFLSAGTDTTSTALQWIMANLVKSPHIQARL  5689

5688  FEEISGVVGEGEEEVKEEDLQKMPYLKAVVLEGLRRHPPGHFVLPHSVTQDVSFEGYDIP  5509

5508  KNATVNFIVSELNWNPKIWENPMEFKPERFLDINGDGDHGDEGEAFDITGSREIKMMPFG  5329

5328  AGRRICPGYGLAMLHLEYFVANLVWNFDWKAVEGDEVDLSEKLEFTVVMKNPLQAHLSPR  5149

5148  LK*  5140

 

>CYP89A41 old d AM433215.2  Vitis vinifera 63% to papaya

      MDFDRQKMEIWVFFFIASLCIASLLKSLHDFFFPKLKLPPGPAAFPLI

2689  GSLLWLGTSFADLEPTLRNLHAKYGPILTLRIGSRPAIFISENSLAHQALVQNGAVFSDR  2510

2509  PEARPAGRVMNSNQRNISSCPYGPTWRLFRRNLMAEILHPSRVRSYSHARKWVLEILVSR  2330

2329  LRSHSDGFVPVRVMDHVQYAMFCLLVFMCFGDKLEEKQIQEIEMMQRRCLLEFRRFNRL  2153

2152  DLLPRIGKVLFRKTWDELLNLRKDQEEILLPHIRARQPLKQETQSKREEDNSDPGSSSSS  1973

1972  KDYVLSYVDTLLDLQLPEEKRKLNEGEIVTLCSEFLSAGTDTTSTALQWIMANLVKSPH  1796

1795  IQARLFEEISGVVGEGEEEVKEEDLQKMPYLKAVVLEGLRRHPPGHFVLPHSVTEDVSFE  1616

1615  GYDIPKNATVNFIVSELNWNPKIWENPMEFKPERFLDINGDGDHGDEGEAFDITGSREIK  1436

1435  MMPFGAGRRICPGYGLAMLHLEYFVANLVWNFDWKAVEGDEVDLSEKLEFTVVMKNPLQA  1256

1255  HLSPRLK*  1232

 

>CYP89A42

64% to 89A5, 66% to CYP89Ab AM423953.2  Vitis vinifera

supercontig_43:1821155,1826527

FGPP_ORF_250_from_supercontig_43

METWFIILISISFALLLKSIFSLLLSSTTKKPSSPSIPPGPFTFPIIGNILWLRRTVTEI

EPILRSLYARFGPMITLRIGSRPAIFIADRELAHQALIQNGAVFADRPPALPTSKIVGSN

QHNVSSAAYGPTWRLLRRNLTAEILHPSRVKTYGHARRWVLRILLERIGSEREESGRCVR

VVDHFQYAMFCLLVLMCFGDKLSQEQIQEIEHVQRRQLLGFAKFNVLNFWPRVTKFLLRK

RWEEFLQLRRDQETVLIPLIRARKKMKEENLETVNEDNKEHVLSYVDTLIDLELPEEGRR

KLEEGELVSLCSEFLNAGTDTTSTALQWIMANLVKYPYIQERLLKEMKAVVGEGEEEVKE

EDLQRMPYLKAIVLEGLRRHPPGHFVLPHRVTDEIMLGGFLVPKNGSVNFAVAEMGWDPK

VWDDPMAFKPERFLNSDDKLQSFDITGSRDIKMMPFGAGRRICPGLYLAMLHLEYFVANL

IWKFQWNPIDDVDLSEKQEFTTVMKNPLQAHISPRINNINN*

 

>CYP90A16 AM463180 Vitis vinifera

     MDWSLAVTIGAALLA

6272 IFFLFLRLTRPRGHRLPPGNLGLPLVGETLQLISAYKSANPEPFIDERVTRYGPLFTTHV 6451

6452 FGEPTVFSADPETNRYILQNEGKLFECSYPGSISNLLGRHSLLLMKGNLHKKMHSLTMSF 6631

6632 GNSSIIKDHLLLDIDRLIRFNMDSWTSRILLMEEAKK

6941 ITFDLTVKQLMSFDPGEWTESLRKEYVLVIEGFFTVPFPLFSATYRRAIQ

     KARTKVAEALNLVVRERRKAKEEGEEEKKNDMLAALLDSGDNF 7573

7574 SDEQIVDFILALLVAGYETTSTIMTLAIKFLTETPLALAQLR 7699

8529 EEHDEIRARISDPNVLEWSDYKSMPFTQC

8765 VVNETLRVANIIGGIFRRVTTDIHVK 8842

8931 GYTIPKGWKVFASFRAVHLDHEYFKDARTFNPWRWQ 9038

9133 NNSGPTVPGSGVNVFTPFGGGPRLCPGYELARVVLSVFLHRM VTRYS  (2) 9273

9370 WAPAEEDKLVFFPTTRTQKRYPINVERRKVSSAAEKGEG* 9489

 

>CYP90A17

82% to 90A1 Arab., 83% to CYP90A16 AM463180 Vitis vinifera,

83% to CYP90A8 DQ001728.1  Citrus sinensis

GLHM_ORF_224_from_supercontig_19

supercontig_19:1304719..1308549

MAAFTVYLYLLLALSTVIFFVLRNISRRRRHILPPGSLGLPFIGETLQLISAYKTENPEPFI

DERVRRFGPIFTTHVFGEPTVFSAEPETNRFILQNEGKLFECSYPGSISNLLGKHSLLLM

KGSLHKRMHSLTMSFANSSIIKDHLLLDIDRLVRLNLDSWTGRVLLMEEAKK (0)

ITFELTVKQLMSFDPGEWSESLRKEYVLVIEGFFTLPFPLFSTTYRKAIK

ARTKVAEALSLIVRERRKEVEEGGKKKDDMLGALLAGDDNFSDEQIVDFLVALL

VAGYETTSTIMTLAVKFLTETPLALAQLK

EEHDGIRERKSKSETLEWSDYKSMPFTQCVVNETLRV

ANIISGIFRRAMTDVHIKGYTIPKGWKVFASFRAVHLDHDHFKDARTFNPWRWQNNSGTT

SPGNVFTPFGGGPRLCPGYELARVELSVFLHHLVTCFSWVPAEEDKLVFFPTTRTQKRYP

IIVRRRDVC*

 

>CYP90B12 AM441474.1 Vitis vinifera

3968  MSDLEFFLLLLASISVPLVILNLI

4040  KRKQSGLNLPPGNTGWPFLGETIGYLKPYSATSIGDFMEQHISR  4171

4258  FGEIYKSNLFGEPTIVSADSGLNRFILQNEGKLFECSYPRSIGGILGKWSMLVLVGD  4428

4429  MHRDMRTISLNFLSHGRLRTHLLPEVVKHTLLVLSSWKENCTFSAQDEAKK  4581

4701  FTFNLMAKHIMSLDPGKPETEQLKKEYVTFMKGVVSAPLNFPGTAYRKALQ  4855

4991  SRSTILKFIELKMEERIQKLRGGGFENMEDDDLLGWVLKHSNLSTEQILDLVLSLLF  5161

5162  AGHETSSVAIALAIYFLEGCPNAVQQLR  5245

5350  EEHLEISRAKKQSGELELSWEDYKKMEFTQC  5442

5543  VISETLRLGNVVRFLHRKALKDVRYK  5620

5737  GYDIPCGWKVLPVIAAVHLDPSLFDQPQHFNPWRWQ 5844

      QNNGNRGNSTSWSTATNQN

7515  FMPFGGGPRLCAGSELAKLEMAVFIHHLVLNYNWELVDKDQAFAFPFVDFPKGLPIKVRHHNFT*  7709

 

>CYP90B13

74% to CYP90B1 with a small deletion before the I-helix

82% to Vitis CYP90B, 82% to Gossypium hirsutum steroid 22-alpha-hydroxylase (DWF4)

supercontig_6:791125,793880

GLHM_ORF_116_from_supercontig_6

MSNIEHILLLLPSFLVLVLVLILIKRKQRRLNLPPGNMGWPFIGETIGYLKPFSATSIGEFMSEHISR ()

YGKIYKSNLFGEPTIVSADAG

LNRFILQNEGRLFECSYPRSIGGILGKWSMLVLVGDMHRDMRIISLNFLSHARLRTHL

LKEVEKQTLLVLNLWKENSVFSAQDEAKK (0)

FTFNLMAKHIMSMDPGHPETEQLKREYVTFMKGVVSAPLNFPGTPYRKAL

QSRSTILRFIERKMEER

IRESKEEDDLLGWVLKHSDLSTEQILDLILSLLFAGHETSSVAIALAIYFLQACPRAVQQLK ()

EEHLEIVRAKKQTGEVELDWEDYKKMDFTQC (0)

VISETLRLGNVVRFLHRKALKDVRYKG ()

YDIPCGWKVLPVISAVHLDPSLFEEPQQFNPWRWQQ ()

NNNNNGDRVSNSSWPSTSA

TSSNYFMPFGGGPRLCAGSELAKLEMAVFIHHLVLNFHWDLADFDQAFA

FPFVDFPKGLPIKYHHTLK*

 

>CYP90C5 AM429218 Vitis vinifera complement(join(25517..25610,25704..25831,25899..26005,

26084..26162,26211..26345,27413..27694,27793..27942,

28045..28369,29691..29896)) revised this model

MEVIHWCWVVVGVVMGWCWYKSIKNKAKEEGSGVPRGNPGWPVI

GETLDFIASGWSSRPVSFMEKRKSRYGKVFKTNILGKPVIVSTDPEVNKVVLQNIGNX

FIPAYPQTITEILGESSILQMNGSLQKRVHALLGGFLRSPQLKARITRDIERYVKLTL

DSWKDQHIVYVQDEVRKITFDVLVRVLVSITPGEDLNFMKREFAEVIKGLICLPIKLP

GTRLYKSLKAKERLLKLVRRIVEERKAAMDRGDHETLKGPPNDAVDVLLRDTGDSSET

SRLSLDFISSNMIEMMIPGEETLPTAMTLAVKFLSDCPVALNQLMEENMELKKGKALS

GEDYAWTDYMCLPFTQN

VINETLRMANIINAVWRKAVKDVKIK

DYLIPEGWGVMASFTSIHMDEENYENPYQFNPWRWEKAASVNNNNSYTPFGGGQRLCP

GLELSKLEISIFLHHLVTTYXWVAKKDDVVYFPTVKMRKKLPITVTPLPPL

 

>CYP90C6

65% to CYP90C1, 68% to CYP90C5 Vitis vinifera AM429218

72% without the N-term seq. best GenBank hit

supercontig_6:1503524,1513523 with a short seq. gap

MKFWISACWIFLLFVGVWFIWFDRDRRHGRRRN

TTTEMKSGVSGVLPEGNLGWPFVGET

LDFIASGYTSQPVSFMDKRKSRFGKVFKTHILGTPIIV

STDPDVNKVILQNHGSTFIPAYPKSITELLGKYSILQMNGNLQKKLHALIGGFLRSPQLK

SQITDAIEDSVKLALDSWRDMSLVYVQQETRKITFKILVKVLMSIGPGEDLDFLMREFGE

FIKGLICLPIKFPGTRLYKSLKFMQAKERLLKMVRRIVEERKLAMEKSQEKGRVEDVLDL

LLRENGEGNEKQSLPLDFITDSIIEMMIPGEETVPMAMTLAVKFLSDCPVAIAQLT 1511782

XXXXXXXXXXXXXXX 1512454

DYGWSDYMSLPFTQN

VINETLRRANIINGVWRKALKDVEVKGYLIPRGWCVLASFISIHMDIENYENPYKFDPWRWEKI

EGAVNNSRFTPFGGGQRLCPGLELSKLEISIFLHHFVTTYRWVAEKDDIIHFPTVKMKRK

LPIRVTPVAT*

 

>CYP90D8 AM482768.1 Vitis vinifera missing last exon

17612  MHNLWIVFLTAIFLSTIILLYRNRSRIRSSPSSSLPLGTLGWPLIGETLEFISCAYSDRPE  17794

17795  SFMERRRRM  17821

18012  YGKVFKSHIFGSPTIVSIDAEVSRFVLQSDSKAFVPSYPKSLTELMGQSSILLINGSLQR  18191

18192  RVHGLIGAFFKSPHLKAQITQEMESYIQKSMGSWRDDHPIFIQDEAKN  18335

18634  IAFQVLVKALISLNPGEEMEFLRKQFQEFISGLMSLPVNIPGTRLYRSLQA  18786

18866  AKKKMVQLVGKIIQERRNINQPSKVPKDVLDVLLNDSSQLLTDTLISDNMIDLMIP  19033

19034  GEDSVPVLVTLAIKYLSDCPAALQQLT  19114

19188  EENMRLKRLKAERGETMTWSDYLSLPFTQT 19274

19383  VITETLRLGNVIIGVMRKAMKDVEIKGHRIPKGWCVFAYFRSVHLDESQYDWPYQF  19548

19549  NPWRWQ

       DKNISSCSFTPFGG  19728

19729  GQRLCPGLDLARLEASIFLHHFVTQFR  19809

 

>CYP90D9

69% to CYP90D1, 73% to Vitis vinifera CYP90D8

GLHM_ORF_101_from_supercontig_25

supercontig_25:785326,787771

GLHM_ORF_101_from_supercontig_25

Frameshift after PHLK

MSTTMESHVLVIICMAPIVLSIIYKCMRLLSSSSPSHGAALPSGNLGWPLVGETIDFISS

ACSDRPETFVDKRRRM (2)

YGKVFKSHIFGAPMIVSTDAEVSRVVLQSDSKAFIPSYPKSLTE

LMGKSSILLINGSLQRRIHGLVGAFFKSPHLK

AQITKQMYTYLHQSMQTWTPDKPIYIQDETKN (0)

LAFQVLVKALISLEPGEEMELLKKNFQQFISGLMSLPINIPGTQLYRSLQA (1)

KKKMVKLVKVIIQSKRGNSNVGGGVAIKDVVDVLMNEEFSDDLIADNMIDMMIPGEDSV

PVLITLAIKYLSDSPAALQHLT (0)

EENMKMKRLKAELGQEMNWNDYLSLPFTQK (0)

VITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGWCFFAYFRSVHLDDTHYDCPYNFNPWRWQ (0)

EKDTSSCNFTPFGGGQRLCPGLDLARLEASVFLHNFVTR (2)

WVAEDDTIVNFPTVRMRRRLPIWVKRRED*

 

>CYP92A32 AM446822.2  Vitis vinifera

      MEAPSWVVLALAWLAAAALLSKLFSFRRPQEQNRPSGPKPWPIIGN

3556  LNLIGHLPHQSLHKLSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPQTAA  3735

3736  GKYTTYNYSNITWAPYGPYWRQGRKIYLTELFSSKRLASYEYIRVEERQAFISRLYALSG  3915

3916  KPVMLKEHLSRVTLSIISRIVLGEKYFSESQSGSSIVTLEEFQEMLDELFLLNGVLNIGD  4095

4096  WIPWIAFLDLQGYVKRMKVLRDKFDRFHDHVLEKHRARREAGDFVVKDMVDMLLRLADD  4272

4273  PDLQVKLTTDAVKGFTQ  4323

4424  DLIAGGTDTSATTVEWAMSEILRQPSIAKKATEELDRVIGRDRWVDEKDIPQLPYIDAI  4600

4601  VKETMRLHPVAVLLAPHLALHDCNVAGYDIRKGTRVLINTWSIGRDPNLWDAPEGFRPER  4780

4781  FLGKAIDVKGQNFELLPFGSGRRMCPGYSLGLKMIRSSLANMLHGFHWKLPGDMKAEELN  4960

4961  MEEVFGLATPRKVPLVAVMEPRLPSHLY*  5047

 

>CYP92A33

72% to 92A9 rice, 67% to Vitis CYP92A, 82% to CYP92A28 DQ122176.1 Gossypium hirsutum

GS_ORF_149_from_ supercontig_25:1311563..1314346 (- strand)

MENLLPYIAVWVATLAIILLSRRLLRHKPNLPPGPKPWPIIGNLNLIGSLPHRSIHFLSQ

KYGPIMQIQFGSFPVVVASSVEIAKAVLKTHDATFAGRPKTAAGKYTTYNYSDITWSPYG

PYWRQARKMCLMELFSARRLESLEYIRKEEMKLLLRGLYDSAGSCITLKDHLSNISLNVI

SRMVLGKKYTEESEEGEEIVSPKEFKEMLDELFFLNGVLDIGDSIPWLSFLDLQGYIKRM

KALSKKFDRFLEHVLDEHNERRKRVENYVAKDMVDVLLQLAEDSALDVKLERHGVKAFTQ

(0)

DLIAGGTESSAVTVEWAISELLKKPDIFKKATEELDRVIGKDRWV

DEKDIVNLPFIDAIAKETMRLHPVAPMLVPRMAREDCQVAGYDILKGTRALVNVWTIGRD

PSLWDKPEEFCPERFIGKTIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQSSLANLLHGF

TWKLPGEMKVEELSMEEIFGLSTPKKIPLITVVEPRLPTHLYNI*

 

>CYP93A9 AM429328.2 Vitis vinifera

25410  MADVQDHVILFLXWLI

25362  SFILARALFTKYRTRVRRPPGPLALPIIGHFHLLGSKPYQSLHKLSLRYGPLFQFYFGSI  25183

25182  PSVVVSSGEMAKEFLQTHDISFANRPKLSNIDYLFYGSNDIAFASYGPYWKFMKKLSMTK  25003

25002  LLGVQTLDKFVPVMREERHLFLQTLLGKAEAGEAVDVKKEIMRLTNNLITKMIMRHRCSD  24823

24822  SEDDATEVKELMTEMMKLIGSFNLSDFVWFCKNLDLQGFKKRVKEARARFDAIMERVMKA  24643

24642  REEERRKKRDMNDAGVAMNDFLDILLDIMENEKEEMRLTRENVKGIIL  24499

24395  DIFGGGTETSGTAAIWAVAELINHPNIMEKARQEIDSVVGKDRLVEESDIANLPYLQ  24225

24224  AIVKEILRLHPPGALIARESTEDCTIGGYHIPAKTQLFVNRWAIGRDPNYWENPLQFLPE  24045

24044  RFLTEDGSLKSHLDVRGQHFHLLPFGSGRRICPGVSLALQVIQTSLAAMIQCFEWRVG  23871

23870  DGGNGNVDMEEGPNAVLVHPLICVPVARVNPFPKYTM*   23757

 

>CYP93A10 old a

GS_ORF_98_from_supercontig_85:675511,676311

 short at N-term (in a seq gap)

Exon 2 in a seq gap

81% to CYP93Ab, 52% to 93A8, 48% to CYP93D1

SSLSTGPRPLPIIGNQHLLRPIPHQALHKLSLTYGPL

MCVFFGSKLCVVVSSPEIAQEVLKTNEFLFLNRPKNASIDYLTYGSSDLTRAPYGPLWKF

MKKICMSELLNGQTVEQFQPIRQEEVNHFLQLVFNKAKAGETFDVRTGILRLTSNIISRM

ACSNDKTYEMRKLIGEMNELVGTGSLLDLIWFVKNLDLQGMRKRLKNARDRYNIVMEDII

KECEEVKGKRKESFKGNNPTKVILQSLLDIYEDPSSEIKLTRENVKALMM (0)

 

>CYP93A11 old b

GS_ORF_99_from_supercontig_85:679372,682703

51% to 93D1, 55% to Vitis vinifera 93A9 AM429328.2

59% to 93A4, 59% to 93A6 Poplar, 57% to 93A8 Medicago

MHEIEVANSQEVLTWSSIALFRTIWTKLKARAQLPPGPRPLPIIGNQHLLRPIAHQALHK

LSLNYGPLMCLFFGSKPCVVVSSPEMAQEVLKTHETLFLNRPNIANIDYLTYGSSDLTRA

PYGPYWKFMKKICMSELLNGQTVEQFRPIRQEEVNRFLQQILSKAKAGETFDVRTGIVRL

TSNVISRMALTHRSWFGNYKTDEMRQLVGEMNDLVGKGSLLDLIWFLKNLDLQGLRKRLK

NARDQYNNVMEGIIKECEEVKRKRKESSNGNNPRKDVLESLLDIYEDSSSEIKLTRENVK

ALIMNLLGAGTDSIAFAIEWAFSELINNPEVMEKARKEIDSVVGKTRIVEETDIPNLPYI

QAIVKESLRLHPTGPLFSRESSEECTIKCYKIPAKTKLIVNIWSINRDPNHWENPLEFRP

ERFINEEWNEKKQFMDVRGQCFSLLPFGAGRRSCPGSFLALQVMMTTLGAMVQCFEWKVN

GDGENETVDMEEAPGLSLKRVHPLICVPVARLSPIPLVCSQANPM*

 

>CYP93A12P pseudogene 1

GS_ORF_100_from_supercontig_85:684060,686239

 first part

48% to 93D1

MVDVQNCIILFLVWLTSIALFQTIWTKLQARAHLPPGP

RTLPIIGNLHLLHPIAH*ALHE

LSLTYGSLMSVFFGSEPCVVVSSPEMG*ELLKTHETCFLNGQRTANIDYLTYDSSDLTMAPYGPYCKFMK

KLCMTELLNGRIVDQFRPIRRVEMNQFLRLILNKAKAGEAFDVGAVIARLTNNIISRMA 633

STQRCSCTDDKADKIRKLVGELTDLVGKCSLLDLIWFVKNLDLQGLKNARDRYD 795

NMMEEIIKEHEEVKRKSKESGDGNRPTKDIHESLLDIYEEESSEIKLTRENIKALIM 966

NIFGAGTDSTSITIERAFSELINNPKVMEKARKDIDSVVGKSRVVEETDIPNLPYIQ

AIVKESLRLHPPGPLINKVSSEECIIKCY*

IPAKTKLILNVWSLGRDPNHWENPLEFRPERFINEGWNEKKQFMDVRGQHFGLLPFGTGR

RSCPGSLLALQVIMTTLATMIHCFERKVNGGGENETVDMEEAPGLSLKRIRPLVCAPVAR

LYPIPSVLSRPNPL*

 

>CYP93A13 old c

GS_ORF_100_from_supercontig_85:688120,689864

 second part

73% to 93A4, 54% to 93D1, 56% to ORF100 first part pseudogene

MPDFQGYFVLFLIWLVSMIAMRAILTKTRKA

SCRPPSPLALPIIGHLHLIGPIPHQGLHKLSTRYGPLIHIFLGSVPCVVASSAEMAKEFL

KTHEASFSDRPRTIAVDYLTYGSADFSFANYGPYWKFMKKICMSELLGGRTLDQFIPVKQ

EEIRWFLSLMLKKAKAVEALDVGKELIRLTNNVISRMTMGQTCTNDDNETEEVKKLVQAV

AELTGKFNLSDYIWFCKNLDLQGFKKKLKEVHYRFDTMMERIMREHEEARKTKKPMNAGS

HKVKDLLDILLQISEDESSEIKLTRENIKAFIL (0)

DVFAAGTDTAAITVEWALAELINHPNI

MEKAQAEIDNVVGRNRLVNESDIANLPYLQALVKETLRLHPTGPMIVRESTEECIINGYE

IPARTQLFVNVWAIGRDPNHWETPLEFRPERFVISEGEREKGKAVDVRGQHFHMLPFGSG

RRQCPGISLALQLVHTTLGAMIQCFEWRVNGGNGSVDMEEGPGITLPRANPLICVPVPRF

DPLPFS*

 

>CYP93A14 old d

GS_ORF_101_from_supercontig_85:693744,698673

 with sequence gap in mid region

67% to 93A4, about 52% to 93D1

MADLQGYIVLFLIFLVSIVAIKTILTKTRNASCLPPSPLALPIIGHLHLLGS

IPHQGLHKLSTRYGPLVRIFLGSVPCLVASSPDMAKELL

KTHEASFSARPHTIAVDYLTYGGADFAFANYGPYWKFMKKICMTELLGGPTLDQFRPVKQ

EEIRRFLSLMLENAKASDAIDVGRELNRLINNVISRMTMGQACCNGDNEAEEVRKLVQGLTKLI

 

DIFAAGTD

TSPITIEWALAELINHPNIMEKARAEIDNVVGRSRLVEEADIVNLPYLQAVVKESLRLHP

TGPLIVRESTEECTINGYQIPAGTRLFVNVWAIGRDPNHWEMPLEFSPERFVISEEREKG

KAVDVRGQHFQMLPFGSGRRRCPGTSLALQLVHTTLAAMIQCFEWRVNGGNGTVNMEEGQ

GITLPRANPLICVPVVRLNPLPLY*

 

>CYP94A15P pseudogene

58% to 94A5 tobacco

GS_ORF_8_from_ supercontig_483:31534..35953 (- strand)

SNPNLPKLYSFIGSHLAVLSSWHRQAEWITEMLQNSPNSTFVIHGPL

GIRQLFTANPANVHHILKSHFPYYTKGRVFRGNLHDFLGNGIF

FGVDGDTWKFQRQISSHEFYTKSLRKFIETVVDTEIFNRLIPILSDNKERVLDFQDIL

QRFAFNNICEIAFGFDPECLAPSLPQAEFAEAFDKL

VKLSSERFKVLPI

VWKTKRLLTIGSGKDLNFSLSQIRKLASTIVREKKQEFINNPSLESADLLSRFLISNIS

DKNLS*TLSLVSSLQAVTWFFWLISKNPDVENQILNEIKGIQPNLPVFDQVKNM

VYTHASLCESMRLYPLVPMDTKVA*EGD

IMPDGTRVKKGMAVTYHPYAMGRMKEIWGADWAEFKPERWLEREATSGKWRFIGKDPYM

YPVFQAGPRVCLGKDMAFLQMKRVMAVVLSRFKVVPSMVDSGEPEFLIHLTAKMIGGFPV

RIQERWSNF*

 

>CYP94B8 old a

supercontig_13:1115857,1141040 62% to CYP94B3

GLHM_ORF_130_from_supercontig_13

MILLAFLVFSLVFSFLYFFFIFITKVYSFLSLPPSTNGPPSYPFIGCLLSFSQNCHRLLD

WYTELLSQSPTNTIVVNRLGARRTIVTANPENVEYILKTNFCNFPKGKPFTELLGDLLGR

GIFNVDGELWSTQRKLASHEFSTRSLREFVVKTLQEEVEERLIPVLDEAMERQTVVDLQE

ILRRFAFDVVCKVSLGTDPCCLDLSRPLPALVIAFDSASEISAMRAMEPMYAVWKIKRTL

GLGTEKKLKEAIKVVHGSVLEIVQNKKKILGSDQENQNDAVANHSEDLLSRLLSAGHDEE

IVRDMVISFIMAGRDTTSAGMTWLFWLLSKNHKAEEMIVHEVNSVIQKKGGDDKTKTTSL

DFEALKELHFTKACLCESMRLYPPVAWDSKHAADDDVLPDGTRLDKGDRVTYFPYGMGRM

ETIWGKNRLEFRPDRWLEEGDQGVNPYKFPVFQAGPRVCLGKEMAFIQMKYVVTSVLRQF

EIKPFRKDRPVFVPLLTAHMSGGFKVLIKKRNQ*

 

>CYP94B9 old b

GS_ORF_26_from_supercontig_171 frame3_ORF7

supercontig_171:276853..277464

62% to 94B2 two frameshifts around LGVDRYRLD

MEIAMSLFGALQPLTLVFFSFFLSLLQVIILREIFRAGRLLPSTGHTPA

TYPIIGCLISFYKNRNRLLDWYTELLVESSTNTIVVRRFGAPRTIVTANPENVEHMLKTN

FNNYPKGKPFTEILGDFLGFGIFNVDGELWRTQRKLASHEFTARSLKEFVVNTLEDEVEN

QLLPLLESLAKASKVIDLQELLRRLSFNMICKTL

LGVDRYRLD

PSEPVSPFDKAFDIASEVCAKRGAAPLFIVWKIKKWLGVGSERRLKLAVDEVHAYVTE

MIRDKKRKIEKEGKERHSEDLLSRLILAKHEEMVIRDMVISFIMAGRDTTSAAMTWLFWL

LSHNPGIEQELVKETRLVKPKLLDYESLKELKLLKACLCESMRLYPPVAWDSKHAIADDL

LPDGIPVRAGDRVTYFPYGMGRMEALWGEDWLEFKPQRWFTESNYSERVLKKVSPYKFPV

FQAGPRICLGKQMAFLHMKYVVASILQQYEIRPVGSDKPVFVPLLTAHMAGGLKVLIHRR

D*

 

>CYP94C11 old a

58% to 94C1

GS_ORF_45_from_ supercontig_5:318624..321662 (+ strand)

MIMILTIILPSTMEEYQREIEAASWLLQLLGPLLSSLICFIMLYLLAVSLYIVMIKRKLW

CNCEVCDAYLTFSWSKRFDNLCDWYADLLKNSATKTIHIHVLGNTITANPNNVEYMLKTR

FDNFPKGKPFSVILGDFLGRGIFNVDGDSWRFQKKMASLELARVSIRSYGFEIVNYEIHH

RLIPLLSSVAGKDELNGGVSDLQDVFRRFSFDSICRFSFGLDPRCLELTLPISEFALAFD

LASKLSAERAMTALPAIWKIKRMLNIGSEKQLKEAIKTISILAREVIKQRRKMGFSTRED

LLSRFMISITDETYLRDIVISFLLAGRDTVASGLTSLFWLLSNHPEVTKAIRVEAERVLG

ANEELKSFQQMKQLHYLHAVVYESMRLYPPIQFDSKFCVQDDVLPDGSFVKKGTRVTYHP

YAMGRMEDIWGSDCLQFKPERWLKNDGVFLPENPFKYPIFQAGFRVCLGKEMAVMELKSV

VLSLVRRFEFDLLTPSGSTPRFSPGLTATFNGGLRVLVRERESQLPS*

 

>CYP94C12 old b

65% to 94C1

FGPP_ORF_220_from_supercontig_32 small seq gap in mid region

supercontig_32:1579337,1594915

MHTTFCFLFFSFTALFSLFALFLFVLRVKLWCNCEICHAYLKSTWTKEFDNLCDWYTHLL

RKSPTGTIHIHVLGNTITANPENIEYILKTRFDNYPKGKPFSTILGDLLGRGIFNVDGDS

WKFQRKMASLELGSVSTRTFAFDVVTTEIRHRLIPLLSS

 

LSAERALTPSPIIWKIKRFFNLGSEKQLKEAIKMVNELAEEVINQRRKIGFSNK

NDLLSRFMNTIDDDKYLRDIVISFLLAGRDTVASGLTSFFWLLSQHPEVETAIQEELDRV

MIPGQEIASYDQMREMHYLHATLYESMRLFPPVQFDSKFSQEDDVLADGTCVRKGTRVTY

HPYAIGRMERVWGSECLNFNPRRWLKNGKFVPISPYRYPVFQAGLRVCLGKELALVEMKC

VALAIVRQFKIRVSDPGQTPRFAPGLTATVRGGLPVTVQVRKIADNEGKRHC*

 

>CYP94C13 old c

57% to 94C1

supercontig_765:20135,25824

GS_ORF_4_from_supercontig_765 with a seq. gap near C-term

Two frameshifts

MAVVILLSATLIYAAVRSLHKFWCSCEICRSYVSSSWSKSFTNLSDWYTYLLQNSPTQTI

HLHVLSNTIITANPSNVEHILKTKFHNYPKGKPFSTILGDLLGKGIFNVDGDSWLFQRKM

ASLELARISITRYAFEIVSQEIKSRLLPLLSSSVSQQVVFDLQEAFRRFSFDNICRFSFG

LDPKCLDYSFQVSHFADSFDLASKISAERAMATLPFLWKMKRFFKIGNEKKLKEAIEVIN

MIAMEVILQKRKLASFSSNQDLLTRFMACVNDDSYLRDIVIRFILAGRDTMASALTTLFY

LLS

KHPQVIVKIQQESSQVLSRNQELPRYDQIRNMHYLHAAIYESLRLYP

 

GVRTCLATELALMEMKMVGVCIASKLRLKL

EPKGALRFDPGLTATLKGGLKVLLRERRDTTY*

 

>CYP94C14P pseudogene

50% to CYP94Ca

supercontig_1823:63,230

63 RM*KIWGFDCMEFKRERWVDKDNVLCL*SLFKHQVFQGRFRTCLGKELTLVEMKMV 230

 

>CYP96A20 old a

59% to 96A10

supercontig_919:7798,9120

GS_ORF_1_from_supercontig_919

MIGLIEILLAVVCFLLLRFFFKENNGKVNNGMPRNFPVLG

MLPDLIINLHRLQDWAAEILEKSGCTFLFKGPWFANMDLPVT

VDPANIHYIMSSNFPNFPKGSEFKKIFDVLGDGIFNADNELWKNQRKVAQSFMSHRGFYK

FLVMTSRDKVENGLIHVLEHVAEHGLMMDLQDLFQRFTFDSTCKLVTGYDPGCLSLDFPE

IEFARALDEAEEVIFYRHIKPKILWELQRLLGMGEEKKMIKAYQTVDRVISSYLSLKKEE

LSQNPESEAMDLLTCYMKVEDNEIKNNDKFFRDTILSMLLAGRDTTSSALTWFFWLISQN

PKVEAKIREELNSTTQVSSSSSSTRVFHVNEVEKLVYLHSALCESLRLYPPVPFQHKEPV

KPDVLPSGHHVDPKMKILFSLYAMGRMQSVWGEDCHEYKPERWISEQGRVKHEPSYKFLA

FNAGPRTCLGKEVALTQLKLVAAAIIYNK*

 

>CYP96A21 old b

89% to 96Ab, 64% to 96A17 Populus

supercontig_1479:2733..4124         

2733 MIGLIEILLAVACFLILGFFLKENNGMPRNFPVLGTLPDIIINLPRLQDWATEFL 2897

2898 DKSGCTFLLKGPWFANMDLLVTVDPANIHYIMSSNFSNFPKGSEFKKIFDVLGDGIFNAD 3077

3078 NELWKNQRKTAQSFMSHRGFYKFLVKTSRDKVENGLIPVLEHVAEHGLMVDLQDLFQRFT 3257

3258 FDSTCKLVTGYDPGCLSLDFPEIEFAKALDDAEEVIFYRHIKPQILWKLQKLLGIGEEKK 3437

3438 MIKAYQTFDRVISSYLSLKKEELSQNPESEAMDLLTCYMRLEDNQIKNDDKLLRDTFLSL 3617

3618 LLAGRDTTSSALSWFFWLISQNPKVEAKIREELNSNIKPSTQTSYLVFHINEVDKLVYL 3794

3795 HSALCESLRLYPPVPFQHKEPLKPDVLPSGHYVDPKMKILFSLYAMGRMRSIWGEDCYEY 3974

3975 KPERWISEQGRIKHEPSYKFLAFNAGPRTCLGKEVAFTQLKLVAAAIIYN 4124

 

>CYP96A22P pseudogene 1

59% to 96A10, 97% to 96Aa

supercontig_72:7362,17657

GS_ORF_1_from_supercontig_72

N-term not complete, possible pseudogene

MYFPAAIIINLHRLQDWAAEILEKSGCTFLFKGQWFANMDLLVTVDPANIHYIMS*NFPNFPK

EGSEFKKIFDVLGDGIFNADNELWKNQRKVAQSFM

SHRGFYKFLVMTSRDKVENGLIHVLEHVAEHGLMVDLQDLFQRFTFDSTCKLVTGYDPGC

LSLDFPKIEFARALDEAEEVIFYRHIKPKILWKLQRLLGMGEEKKMIKAYQTFDRVISSY

LSLKKEELSQNPESEAMDLLTCYMKVEDNEIKNNDKFFRDTILSMLLAGRDTTSSALTWF

FWLISQNPKVEAKIREELNSTTQVSSSSSSTRVFHVNEVEKLVYLHSALCESLRLYPPVP

FQHKEPLKPDVLPSGHHVDPKMKILFSLYAMGRMQSVWGEDCHEYKPERWISEQGRVKHE

PSYKFLAFNAGPRTCLGKEVALTQLKLVAAAIIYNYNQVVDGQCIKPRISILLHMRHGLK

VKVSRRFGDDHES*

 

>CYP96A23P pseudogene 2

77% to CYP96A pseudogene 1

supercontig_984:2212,2663

LYSAFCELLRLYPPLPFQHKKPLKLYILSSDHYIDPKMKILFS

LYAIGRMRSIWGEDCYEYKPEIWISEQGRVKHEPSYKFLAFSAGPRTCLGKEMAFTQ

LKLVAASIIYNYNLEVVEEQCVEPGISILLHMKHGVIPGPKIWYGINFKI*

 

>CYP97A11 AM476239.2 Vitis vinifera missing N-term and C-term

1793  VIVCASSNGRGPESLEDGVKKVERILEEKRRAELSARIASGEFTVEKPG  1939

3292  NSLAKVGIPSEILDFLFKWMEVSEDYPKVPEAKGSIRAVRSEAFFIPLYELYLTYGGIFR  3471

3472  LTFGPK

      SFLIVSDPSIAKHVLRDNSKAYSK  3645

      GILAEILEFVMGKGLIPADGELWRVR  3831

3832  RRAIVPALHQK  3864

4105  YVAAMISLFGQATDRLCKKLHAAASDGEDVEMESLFSHLTLDIIGKAVFNYDFDSLTNDT  4284

4285  GIVE

      AVYAVLREAEDRSVAPIPFWEIPIWKDI  4464

4465  SPRQRKVNEALKLINSTLDDLIAICK  4542

8211  RMVEEEELQFHEEYMNEKDPSILHFLLASGDD

8388  VSSKQLRDDLMTLLIAGHETSAAVLTWAFYLLSK  8489

      EPSVMSKLQNE

8941  VDSVLGDRFPTIEDMKKLKYTTRVINE  9021

9191  ALRLYPQPPVLIRRSLENDVLGGYPIKR  9274

 

>CYP97A12

$supercontig_123:219372,247386

80% to 97A3 (212-463) (506-574) frameshift in exon 14

AA intron boundary before YLPFGGG (exon 13)

83% to Vitis vinifera CYP97A11

MKDKIEIEEGPTGNCQFAVISCSSSNGRETDSVASAVKKVEQRIEEKRRAELSARIASGEFTVRQSG (2)

NGLSKLGIPEEVLEFLFKLTGTLEDYPEIPTAKGTISAIRSEAFFLPLYELYLTYGGIFRLTFGPK (0)

SFLIVSDPSICKHILKDNSKAYSK (0)

GILAEILEFVMGKGLIPADGEVWRVRRRAIVPALHQK (0)

YVTAMINLFGEATDRLCMKLNAAAFNGEDVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGIVE (0)

AVYTVLREAEDRSVAPIPLWEIPIWKDISPRQKKVTAALKLINETLNDLIMICK (0)

RMVDEEELQFGEEYMNEQDPSILHFLLASGDD (0)

VSSKQLRDDLMTLLIAGHETSAAVLTWTFYLLSK (0)

EPSVMAKLQDE (0)

VDTIIGDRFPTVEDLKKLKYTTRVINE (0)

SLRLYPQPPVLIRRSIQDDVLAQYPIRR (2)

RGEDIFISVWNLHRSPHLWDDANKFNPERWPLDGPNPNETNQNFC (2)

YLPFGGGPRKCIGDMFASFE (0)

TVVAVAMLVQR

IDFQMAVGAPP (0)

VKMTTGATIHTTEGLKMTVSRRMKPPIVPTLELPALEMDTSGGIPQETSNSI*

 

>CYP97B15 AM472981.1 Vitis vinifera partial

14913  AVYGTLFEAEHRSTFYIPYWKVPLARWIVPRQRKFHSDLKVINDCLDGLIK  14761

14760  NAKETRQ  14740

13239  ETDVEKLQQRDYQNLK  13192

13063  DASLLRFLVDMRGADVDD X 13010

12687  QLRDDLMTMLIAGHETTAAVLTWAVFLLAQ  12598

11797  NPSKMKKAQAEIDSVLGQGRISFESLKKLE  11708

 9956  YIRLIVAESLRLYPQPPLLIRRSLKSDSLP  9867

       GYKGKKDGHSIPAGTDIFLS

 9156  VYNLHRSPYFWDRPHEFEPERFQVPRNSDIEGWSGFDPSRSPGALYPNE  9010

 8920  IVADFAFLPFGGGPRKCVGDQFALMESTIALTMLLQKFDVELKGGPESVELVTGATIHT  8744

 8743  KNGLWCRMMKRSXLH  8699

 

>CYP97B16

79% to CYP97B3 Arab., 85% to Vitis CYP97B partial seq (best hit in GenBank)

84% to AF022457 Glycine max 97B2

GS_ORF_282_from_supercontig_8

supercontig_8:2049746,2058632

MYNLDFHRRNFADDRCQSTKTKEPKTRNLLDNASNLLTNLLSGGNLGSMPIAEGAVTDLF

DRPLFFSLYDWFIQHGSVYKLAFGPKSFVVVSDPIVARHIFRENLFSYDKGVLADILEPI

MGKGLIPADIDTWKQRRRVIAPGFHALYLEAMVKVFTDCSERTMLKFEKLLVAQSLRGGK

EIELDLEAEFSSLALDIIGLGVFNYDFGSVTKESPVIKAVYGTLFEAEHRSTFYIPYWKF

PLARWIVPRQRKFQNDLKVINNCLDGLIRNAKETRQETDVEKLQQRDYSNLKDASLLRFL

VDMRGADVDDSQLRDDLMTMLIAGHETTAAVLTWAVFLLAQS

NPSKIRKAQAEIDSLLGKGRPSFESIKKLEY

IRLIVVEALRLYPQPPLLIRRSLKADVLP

GGYTGDRDGYTIPAGTDIFISVYNLHRSPYFWDQP

HKFEPERFLVPKESEGIEGWAGFDPTRSPGALYPNEIMSDFAFLPFGGGPRKCVGDQFAL

MESTVALAMILQKFDVQLKGTPESVELVTGATIHTKNGMWCKLRKRSDAH*

 

>CYP97C12 AM463116.2 Vitis vinifera

34523  MPSLMSLSSF

34853  ALLTPPTFNFKPTTLPPNPSLPYLSITCSSDNNPKPTRSSSWVSPDWLTSLSR  35011

35012  SLTMGQDDSGIPMATAKLDDVSELLGGALFLPLFRWMNMYGPIYRLAAGPRNFVVVSDPA  35191

35192  IAKHVLRNYGKYAKGLVAEVSEFLFGSGFAIAEGELWT  35305

35873  RRRAVVPSLHKRYLSIIVDRVFCKCAERLVENLRTDALNGSAVNMEEKFSQLTLDVIGLS  36052

36053  VFNYNFDSLTADSPVIDAVYTALKEAEARSTDLLPYWK  36166

36250  VKALCKIIPRQIKAEESVTVIRKTVEELIAKCKEIVEREGERIDEDEYVNDSDPSILRF  36426

36427  LLASREE  36447

36932  VSSVQLRDDLLSMLVAGHETTGSVLTWTLYLLSK  37033

38295  NSSSLMKAQEEVDRVLQGRSPSYEDIKDLKFLTRCINESMRLYPHPP  38438

38537  VLIRRAKVADVLPGNYKVNAGQDIMISVYNIHHSSQ  38644

       VWERAEDFLPERFDLEGPVPNETNTDFR  39114

39282  FIPFSGGPRKCVGDQFALLEAIVALAIFVQHMNFELVPDQNISMTTGATIHTTN  39449

       GLYMKLTQRQIPSAFVPTSSR*

 

>CYP97C13

77% to 97C1, 84% to CYP97C12 Vitis vinifera

supercontig_5:976907,981943

GLHM_ORF_163_from_supercontig_5

GC boundary at PYWK

Last exon revised

MHSLYVATFSPVSTFRKPTTLLSSNYDSVRHSLSTKASIEKPKPTSNNTSKSASWVSPDW

LTSLARSLTAQNDDSGIPIASAKLEDVSDLLGGALFLPLYKWMNEYGPVYRLAAGPRNFV

VVSDPAIAKHVLRNYGKYAKGLVAEVSEFLFGSGFAIAEGPLWTARRRAVVPSLHKRYLS

VIVDRVFCKCAERLVEKLQPYALNGTAVNMEESFSQLTLDVIGLSVFNYNFDALTADSPV

IDAVYTALKEAEARSTDLLPYWK (0)

IKPLCKIIPRQIKAEEAVTVIRKTVEELIAKC

KEIVENEGERVDDDEYVNDSDPSILRFLLASREEVSSVQLRDDLLSMLVAGHETTGSALT

WTLYLLSKDSSSLIKAQEEVDRVLQGRLPSYEDVKELKFLTRCIMESLRLYPHPPVLIRR

AQVDDVFPGGYKVNAGQDIMISVYNIHHSSQVWERADDFIPERFHLESPVPNETNTDFRF

IPFSGGPRKCVGDQFALLEAIVGLAVFVQRLNFELVPDQNIGMTTGATIHTTN (0)

GLYMKLSQRQKKMS*

 

>CYP98A43 AM435080.1 Vitis vinifera

       MALLLXLIXITAIFLAYKLYQRLR

       FKLPPGPHPWPIVGNLYDIKPVRFRCFAEWSQAYGPIISVWFGSTL

14405  NVIVSNSELAKEALKEKDQQLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLEL  14584

14585  FSPKRLEALRPIREDEVTAMVESIFKDVTNP  (1) 14677

15936  ENLGKSILLKKYLGAVAFNNITRLAFGKRFMNSEGVIDEQGLEFKAIVANGLKLGASLAM  16115

16116  AEHIPWLRWMFPLEEEAFAKHGARRDRLTRAIMEEHTLAREKSGGAKQHFVDALLTLQDK  16295

16296  YDLSEDTIIGLLW  (0 16334

16420  DMITAGMDTTAISVEWAMAELIKNPRVQQKVQAELDHVIGLDRVMSESDFSNLPYLQ  16590

16591  SVAKEALRLHPPTPLMLPHRANANVKIGGYDIPKGSNVHVNVWAVARDPAVWKDPEEFRP  16770

16771  ERFLEEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFNWAPPEGVNPED  16950

16951  LDMSENPGLVSYMRTPLQAIPTSRLPASLYKRMAVDI*  17064

 

>CYP98A45

85% to 98A3 Arab., 88% to AY082612.1  Ocimum basilicum p-coumaroyl

shikimate 3'-hydroxylase, 87% to Vitis CYP98A43

supercontig_92:531066,532751

GS_ORF_51_from_supercontig_92 N-term is in a seq gap

P3K-30711-F17.R (this read contains the N-term)

MVLSAIAVSIFTLLLAYKLYQRLRFKRPPGPRPLPIVGNLYDIKPVRFRCFAEWAQEYGPIISVWFGSTL

NVIVSNSELAREVLKEEDQQLADRHRSRSAAKFSRDGQDLIWADYGPHYVKVRKMCNLEL

FTPKRLEALRPIREDEVTAMVESIFVDCTRP

ENAGKSLLVKKYLGAVAFNNITRLAFGKRFVNAEGI

MDEQGLEFKTIVANGLKLGASLAMAEHIPWLRWMFPLEEEAFAKHGARRDRLTRAIMEEH

TLARQKSGGAKQHFVDALLTMKDKYDLSEDTIIGLLW (0)

DMITAGMDTTAISVEWAMAELIK

NPRVQQKAQEELDRVIGFERVMTETDFSSLPYLQCVAKEALRMHPPTPLMLPHRANADVK

IGGYDIPKGSNVHVNVWAVARDPAVWKNPLEFRPERFLEEDVDMKGHDFRLLPFGAGRRV

CPGAQLGINLVTSMLGHLLHHFVWSPAEGLSADEIDMAENPGLVTYMRTPIQAVATPRLP

SHLYKRVPADI*

 

>CYP701A19 AM434546.2 Vitis vinifera

       MDMMGIEAVPFATAVVLGGISLVVLIFIRRFVSNRKRSVEGLPPVP (1)

48357  DIPGLPLIGNLLQLKEKKPHKTFARWAETYGPIFSIRTGASTMIVLNSSEVAKEVGFS  48184

47085  RFSSISTRKLSNALKILTFDKCMVATSDYNDFHKMVKGFILRNVLGAPAQ  46936

46840  KRHRCHRDTLIENISKYLHAHVKTSPLEPVVLKKIFESEIFGLALKQ  46700

46586  ALGKDIESIYVEELGTTLSREEIFAVLVVDPMAGAIEVDWRDFFPYLSWIPNKSMEMKI  46410

46409  QRMDFRRGALMKALIGEQKKRIGSGE  46332

46255  EKNXYIDFLLSEATTLTEKQIAMLIWETIIEISDTTLVTSEWAMYELAKDPNRQ  46094

46011  QEILYREIRKFCGSNKVTEENLSKLPYLNSVFHETLRKYSPAPIVPVRYAHEDTQLGGYH  45832

45831  IPAGSQ (0)  45814

45740  IAINIYGCNMNKKQWENPEEWKPERFLDEKYDLMDLHKTMAFGGGKRVCAGALQAMLIA  45564

45563  CTSIGRFVQEFEWKLMGGEEENVDTVALTSQKLHPMQAIIKARE*  45429

 

>CYP701A20 old c

60% TO 701A3, Arab, 58% to Vitis CYP701A19

GS_ORF_4_from_supercontig_357:25673..28245

two genes on GS_ORF_4

MTSIVERLKSTMSFSLFSILLGILSLAFFLFSLRRWRFSTKRTQLSRLPTVP (1)

GVPLLGNLLQLKERKPYVVFTKWAEIYGPIYSIKRGSRKLVVISSSDIAKE (0)

AMETRFASISTRKLPSGLKVVTNNKGTVATSDYDNFHKMVKRFAISNVLGANAQ (0)

KRSSWNRDLLIGNLLTQLHAHDKSFPGQPINFKKLFQSELFRFAMRQ (0)

ALGRDVESVFVDELGKTLSTEEIYKIIVLDMIEGVTRVDWRDF

FPYLKWVPNKSFEIDIQEKNFRRFAVMNALIREHKKWVDSGE  (0)

NATGRYLDFLLSEEGKSL

TNEQLLILLWETIVAASDTTLVTTEWAMYELSKDKTRQ (0)

ELLYKELQSVCGIEKIKEEQLT

QLPYLNGVFHETLRKHSPAPLVPIRYVHEDTQLRGYYIPSGIE (0)

IMINIYGCHMNKNQWER

PEQWMPERFLDEKYNISDLQKTLAFGAGRRICAGALQANLISCVAI

GKFVQEFEWSLKDGEKEEVNTHSISSHKLHPLHAIIKPRG*

 

>CYP701A21 old b

64% TO 701A3, 61% to Vitis CYP701A19

GS_ORF_4_from_supercontig_357:20757..24261

two genes on GS_ORF_4

GC BOUNDARY AT FAMRQA

MSFFIFSIVLGVLSSAFFLFSLKRWKFFVRKSEFLQLPTVP (1)

GIPLIGNLLQLKERKPHKTFTKWAEIYGPIYSIKTGASKLIVISSSDIAKE (0)

AMVTRFASISTRKLPRAMKIVSNDKGTLATSDYDDFHRMAKRFMMSTLLSANAQ (0)

KRSRWNRDTLVENLSTQLHAHAKSFPDQPINFKKLFQSELFGFAMRQA (0)

AFGRDVESVYVEELGRSLSR

KEILKVLVLDMMEAGIEVDWRDFFPYLKWLPNKSFEIDIQEKNFRRFAVMNALIRE  HKELTGSGE (0)

DVVGCYLDVLLSEGRSLTNEQIVILLWETIAEASDTTLVTTEWAMYEISKDNTRQ (0)

EVLYEELQSVCGIEKIKEEQLSQLPYLNGVFHETLRKHNPAPLVPLRYVHEDTQLGGYYIPSGCE (0)

IAINIYGCNMNKRQWESPEKWIPERFLDEKFNIIDLQKTMAFGAGRRVCAGALQA

SLIASTAIGRLVQEFEWSLKDEEKEDVNTLGLTSQKLHPLHAIIKPRD*

 

>CYP701A22 old a

72% to 701A3, 70% to CYP701A19 Vitis

GS_ORF_3_from_supercontig_357:17000,19708region

EXON 2 IN A SEQ GAP

MSFAVVSIFLGGLSLLFFLFFLRRSSVSSTKKMECYQLPTVP (1)

 

AMVTRYASISTR

KLSNALKVLTYDKCMVATSDYDDFHKMVKRFIMSSLLGANAQKRVRSNRDTLLENSATQL

HAHYKSFPDEPVNFRKIFVSELFGLAMKQALGRDVESVYVDELGKTLSRQEIFKVLVLDM

MEGAIEVDWRDFFPYLKWVPNKSFEVKIREKHFRRLAVMNALIKEHKKWLDSGEETVSCY

LDFLLSEGKSLTKEQIAILLWETIIETADTTLVTTEWAMYELAKDKTRQDLLYEELRNLC

GAEKIKEEQLSKLPYLNSVFHETLRKYSPAPLVPVRYVHEDTQLGGYYIPSGTEIAINIY

GCNMDKNQWESPEQWMPERFLNDKFDALELHKTMAFGAGRRACAGALQANLIGSTAIGRL

VQEFEWSLSYGEKEDVDTLGLTSQKLHPLHAIIKPRD*

 

>CYP703A9 AM475919.1  Vitis vinifera

6566  MDLSTFVSTLFSLALVALIIRQWLIGVSXRRSRILPPGPPRWPIVGNLFQLGQLPHRDLA  6745

6746  SFCNKYGPLVYLRLGTVDAITTNDPDIIREILVRKDDIFASRPRTLAAIHLAYGCGDVAL  6925

6926  APLGPHWKRMRRICMEHLLTTKRLESFVNHRAHEAQYLVQDVWTRARTRNPINLREVLGA  7105

7106  FSMNNVTRMLLGKQYFGVESAGPQEAHEFMHITHELFWLLGFIYLGDYLPIWRWVDLFYG  7285

7286  CEKKMREVEKRVDEFHMKIIEEHRRMREEKKKNGVGGNEDGGEMDFVDVLLSLPGENGKR  7465

7466  HMDDVEIKALMQ  7501

7845  DMIAAATDTSAVTNEWAMAEVIKHPRVLRKIQDELDSVVGPHRMVSESDLPHLNYLRCVV  8024

8025  RETFRMHPAGPFLIPHESTRATTINGYYIPAKTRVFINTHGLGRNTSLWADVEEFRPERH  8204

8205  WPADGSRVEISHGADFXILPFSAGKRKCPGAPLGVTLVLMALARLLHCFDWAPPXGLRPX  8384

8385  DIXTREVYGMTMPKAQPLMAIASPRLAAHMYQ*  8483

 

>CYP703A10

75% to 703A2, 78% to Vitis vinifera, 79% to AC145330.19 Medicago truncatula

supercontig_96:448931,462008

GS_ORF_33_from_supercontig_96

MDLTRLAQSLVLAALILKLLWTWFNKRSLQKTRRLPPGPPQWPIVGNLLQLSQLPHRDLASLCD

KYGPLVYLRLGSVDAITTNDPDIIREILVRQDDVFASRPRTLAAVHLAYGCSDIALAPLG

PHWKRMRRICMEHLLTTKRLEGFAKQRAEEAKHLVKDVWAQAQSGKAVNLREVLGAFSMN

NVTRMLLGKQYFGCGSAGPEEAKEFMHITHELFWLLGLIYLGDYLPILRWVDPYGCEKK

MREVEKRVDNFHSRIIQEHRKERERKRKENAGDGEIDFVDVLLALPGEDGKQHMDDLEIKALIQ

DMIAAATDTSAVTNEWAMAEVIKHPRVLHKIQEELDSVVGPNRMVTESDLPHLNYLRCVVR

ETFRMHPAGPFLIPHESLQPTIINGYYIPAKTRVFINTHGLGRNTKIWSDVEEFRPERHW

LGNGSRVEISHGTDFKILPFSAGKRKCPGAPLGVSLVLMALAQLFHCFDWAPPEGLRSED

IDTTEVYGMTMPKIKPLIVVAKPRLATYIYN*

 

>CYP704A18 old a

63% to 704A2 Arab.

supercontig_18:1309106..1312139 (+ strand)

GLHM_ORF_179_from_supercontig_18 remove one intron seq

MNMVCSIIVTIIASSLLLFFIVFLYLLLRIFTGKSITSPDYPPVNGTVFSQLFYFNRLYD

YQTQIAKKQPTYRLLTPTHSEIYTADIRNIEHVLKSRFEKYSKGISNLDVVSDLLGEGIF

AADGEKWKQQRKLASFEFSTRVVRDYSCSVFRSNAAELVRTIMEFAVAGRDFDAQDILMR

FTLNSIFKVGFGVELNCMDGSSEDGIEFMKAFDDSNALVYWRYVDPFWRLKRFMNIGFEA

TLKKKIKVLDDFLYKLITYKRKLLALRGDHLVKEDILSRFLIESEKNPKIINDKYLRDII

LNFMFAGKDTSAGTLSWFFYLLCKNPLVQEKIAQEVERIGGNKEDETDIDDFVGSITDQT

LEQMHYLHAALTETLRLYPAVPVDGRSAKVDDILPDGYRLKKGDGVYYTAYAMGRMPYIW

GEDAVEFRPERWLNNGIFQPESPFKFVSFH

AGPRICLGKDFAYRQMKIVSMALIRFFRFKLADEDRRVTYKTMFTLHINGGLNLCAFPRR

NT*

 

>CYP704B20

78% to 704B1

supercontig_350:201440,203574

GLHM_ORF_10_from_supercontig_350, remove small intron

MGGDHNEKKQILSLFCSEDGDKMRIWWVIFCMIISWVFIHRWSQKKKKGPKTWPLVGAAI

EQLINYDRMHDWLVNYLSHSTSVVVPMPFTTYTYIAHPANVEHVLKTNFANYPKGTTYHS

YMEVLLGDGIFNVDGELWRKQRKTASFEFASKNLRDFSTIVFGDYSFKLCQILIQASFQD

QQVDMQELLMRMTLDSICKVGFGVEIGTLAPNLPENSFAQAFDTANIVVTLRFIDPLWKL

KKFLNVGSEALLEKSIKVIDDFTYSVIKRRKAEIQEARDTCNDKVFNY

IKHDILSRFIELSQRPENNLGEKSLRDIVLNFVIAGRDTTATTLTWAIYMI

IMHDHVAEKLYSELIALEQEQINEGQVPLVDYDKEDIESFTQRATQFAGLLNYDSLGKLQ

YLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMGRMEYNWGPDAA

SFNPDRWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMTLAILCRFFKFNLVPGH

TVKYRMMTILSMAHGLKLTITRRG*

 

>CYP704G11 old a

supercontig_18:1345811,1348242

GS_ORF_139_from_supercontig_18,  50% to 704A2, 63% to CYP704G7 Medicago

MEFLQNSFFFYVFTALAVVLAIFAVRSLTSKLALNQGKKKRKYHPIGGTVFNQLVNFNRL

HHYMTDLASKHRTYRLLGPFRNEVYTADPVNVEHILKTNFQNYGKGWYNYNILTDLLGDG

IFAVDADKWQQQRKLASYDFSTRVLRHFSSVIFQKKAAKLANLISEAANSGQIFDMQDLF

MKSTLDSICKVVFGIELDSICGTNEEGIRFSNAFDDSNALTLWRYADIFWKVKKFLNIGS

EAELKKNLKVVDAFVYKLIHNKKERMHNAEDDSSVQMKKDDILSRFLQVNDADPKYIRDT

MLNFIIAGKDTTATTLAWFMYMLCKHPEIQEKVSQDVKEAMKRREVTNLTELAAEMREET

LENMHYLHAAITETLRLYPAVPVDAKFCLSDDTFPDGFDVRKGDMVAYQPYAMGRMKFIW

GDDAEEFRPERWLNEEGKFQQESPFKFTAFQAGPRICLGREFAYRQMKIFSAVLLGCFRF

RLSNENKTVTYRTMINLHIDGGLHVRAFHRC*

 

>CYP706A14 previously 706Fd

supercontig_29:924837..927001 (- strand)

59% to 706A4 Arab. 60% to 706A5

GLHM_ORF_135_from_supercontig_29

MTPISTNFLQTLGNSFIWFSPAFILFWCSWMFVKSKTARTSPSPPGPRGIPLLGSIPFLD

PDLHTYFADMARTYGPIFKLRLGLKVGIVITSPDLAREVLKDHDITFANRDVPATGRAAT

YGGSDIVWTPYGAEWRMLRKVCVIKMLSNTTLDSVYTLRRREVRETTRYIYSRAGSEINI

GEQMFLTVWNVITSMLWGGTVEGKEREEVSGEFREVVSEMTGLLGQPNVSDFFSGLGRFD

LQGLEKRMYGCAKQFDGIFEMLINQRLRIEREGGSKADDKDFLQFLLRLKDDGDAKPPLS

TTHIKALLMDMIVGGTETSSNTVEFAMAEIINKPEILRKAQQELDTVVGRENTVEESHIH

NLPYLLAIMKETLRLHPTLPLLVPHSPSQTCTVGGYTIPTGSRVFVNVWAIQRDPSIWEN

PLEFKPERFLNEKWDFSGKDFNYFPFGSGRRICAGIAMAERMVLYSLATLLHSFDWKLPD

EQQSADLTEKFGIVMKLKTPLALIPTPRLSVDPLYQQ*

 

>CYP706F1P pseudogene 1

39% to 706A3

GS_ORF_254_from_ supercontig_3:1988741..1992148 (+ strand)

ILVTTVATFVGCKWLIKIAMRRNLALPPGPRGLPLVGNLPFVESNLHIYFFKLSKKFGLI

FKIQMGI*IYIVVNSASLVRQVLKEDDVIFANHDPPAAVDLTYDGLDILWRSNGPEWRN

LLKVFVHDMMNKTCFDASYDLRRREV*EMVKEIYAKVGSPIKVRNHMFLISLNIATSM

LWGASLDKDEKNNIGLEFKEIIKEMIDLLGKPSIFYFFSILALLNL*GIV*KMLKLRLWL

HRIFE*VIVVKMKVNGESTKTNNKNKDFLQILLDLMQQEDEK

DVITGATYTSSTTVEGVMTELLKNPITMKKVHEELERFVGNEKIIEEF

NINQLCYLHKVVKE

KRTMRLHSIVPLLVPHNPNVSTTIADYTIPKGSSVFINIWLIMRDLNI

 

>CYP706F2 old a

46% to 706A3

supercontig_3:1994163,1995780

GLHM_ORF_312_from_supercontig_3

MMLEGWSLWMEAEHTTIMVSILVATVTIFVGYKWLMKIAMRGKPPLPPGPRGLPLLGNLP

FVEPDLHIYFSKLSKKFGPIFKIQMGTKIYVVINSASLARKVLKEDDEIFANRDPPAAAI

AETYGGGNILWRPNGPEWRNLRKVLIREMMSKTYFDASYGLRRREVREMVKEIYAKVGSP

IKVRNHMFLISLNVVMGMLWGAPLDEDKKHNVGLELVPFIEEAVDLLGKPNISDFFPILA

PLDLQGIVSKMLKIRLRFDNIFESVIAIKKSTKTSNQSKDFLQILLELMQQEDEKMLFSM

TNIKALLL (0)

DIISATTETSSTTVEWVMTELLKNSDIMKKVHEELERVVGNEKIVEECDINQ

LHYLQSVVKETMRLHPVGPLLIPHSPSVSTTIAGYTIPKGSSVFINVWSIMRDHETWKNP

LKFQPERFFEHPEIGDYRGNNFNYLPFGSGRRICAGINLAEKMVMNVLATLLHSFDWKVE

NATNLNSSEKFGIVVRKLDPLMAIPTIRLPTLEQYY*

 

>CYP706F3 old c

82% to CYP706Aa, one stop codon

supercontig_3:2007426..2009058

MMLEGWSLWMEAEHTTIMVSILVATVTIFVGYKWLMKIAMRGKPPLPPG

PRGLPLLGNLPFVEPDLHIYFSKLSKKFGPIVKIQMGTKIYIVINSASLARQVLKEDDVI

FANRDPPAAGLALTFGGLDILWRPNGPEFRYLRKILVREIMSKAFFDASYGLRQREVREM

VKEIYAKVGSPIKVGDQLFVTSLNVAMSMLWGASLDEEKKISVGLEFKQVIEEIVDLLGK

PNISDFFPVLAPLDLQGIVSKMLKLRSWLDRIFESVIAIKTKVDGESTGTSNENKDFLQI

LLELMQQEDEKMLLSKADIKALFV (0)

NVITGTTDTSSSTIEWALAELLKNSDIMKKVHEELERVVGNEKIVEECDINQ

LHYLQSVVKETMRLHPVVPLLVPHSPSISTTIAGYNIPKGSNVFINVWSIMRDSKAWKNS

LEFQPERFLEHPEIGDYR*NNFNYLPFGSGRRICAGINLGEKMVMYVLATLLHSFDWKVE

DVTNFNLSEKFGIVLRKMDPLVAIPTTRLPNLEQYF*

 

>CYP706F4P aa pseudogene

85% to 706Aa

supercontig_3: 2023260,2024482

2023260 NLLPYGPESQTCKVFIREMMSKTCFDASYGLRRREL*E

MVQEIYAEVG*RIKVRNHMFLISLNVVMSMLWGASLDADKKHNVGLELMQVIEEAIDLLG

KPNISD

FFPILSP*DLQGIVSKMLKLILRFDNIFESVIAIKKSTKTSNESKDFLQILLELMQ*EDE

KMIFSIIDIRTLLV

2023862 DIVSATTDTSSTRIEWVMIDLLKNSDKMKKVHEELERVVGNEMIVEEFDINQLHFLQSLVK*TMR 2024056

2024057 LHPVGPLLIPHSPSVSTTIAGYTILKRSSIFINVWSIMRDHETWKNPLEF*LERFLEH*E 2024236

2024237 IGDYRGNNFNYLPFGSMGRICTGINLAEKMVMYVLATLLYSFDWKVKNSTNLNSSEKFGI 2024416

2024417 VVRKIDPLMAIATIKLTTLEQY 2024482

 

>CYP706F5 old b

78% to 706Aa

GLHM_ORF_320_from_supercontig_3:2029157..2030774 (+ strand)

MMLESWSRWMEEEHTKIMINIFFATAAVFVGCKWLVKIAMRGKPPLPPGPRGLPLVGNLL

FVEPDLHIYFSKLSKRFGPIFKIQMGTKIYIVINSAPLARQILKEDDAIFANHDPPLAAL

AETYGGRNLVWRPYGPEWRNLRKVFVREMMSKTFFDASNGLRRREVREMVKEIYAKVGSP

IKVGDQVFLTSLNVVMNMLWGASLDTDKKISVGLEFRQVIDGIVDLLGTPNISDFFPILA

PLDLQGIVSKILKLRSWLDRIFESVIAIKQTTKTNNEDKDFLQILLELMEHEDEKMPFSM

TDIKALLLDIIIGGTDTSSTTVEWAMTELLRNPDIMKKVRKELERTVGNQKIVEEFHINE

LHYLQSVVKETMRLHPVLPLLVPHSPSVSTTIAGYAIPRGSNVFINIWLIMRDCKTWKNS

LDFQPERFLEHPEIGDFRGNNFNYLPFGSGRRICPGINLGEKIIMYVLATLLHSFDWKVE

EDTNLDLSERYGIITKKKDPLVAIPSARLSTFEQYC*

 

>CYP706F6  old bb

78% to 706Ac

supercontig_3: 2032828,2033988

GS_ORF_262_from_supercontig_3 modified

End of seq in a seq gap

MMLEGSSWWMEVSILVAVVTIFVGCKWLMMIAMRGK

PLPPGPRGLPLVGNLLFVEPDLHIYFSKLSKKFGPIFKIQMGTKIYIIVNSASLARQVL

KEYDAIFSNHDPPAAAAALTYGGLDIVWRPNGPEWRNLRKVFVREMMSKTCFDASYDLRR

REVREMVKEIYAKVGSPIKVGDIMFLTSLNVTMSMLWGASLDKDKKNSVGLEFRQ

VINAIIDLIGKPNISDFFPILGPLDLQGIVSKIMKLRLWFDEIFESVIAM

KPKVDGESTKMSNENKDFLQILLELRQQKDERTPLSMTDIKALFL

DIITGATDTSSTT

IEWAMTDLLKNSDIMKKVHKELERVVGDGKIVEESDLNQL

HYLEAV

 

>CYP706F7P pseudogene 2

supercontig_34:1312360,1311354

50% to 706Fc contains a near repeat seq

1312360 LRSWRWDGIAEHTTMTAIFLAATLIFTWYIMLIILR

R*KSPWPPSSRCLPLLGNLPFVVSSVHVYLAKLSQIYSPRVKIQLGT

ISDFLPVLALFDLQGIIWKMKKL

DRALEGVIAE*LKLVDQVTDTGEGKDLLESLLELT

*QGDHVKIFLSMTDIKAIFM

GATDTSSTTAEWAMTELLQTPEKMRKID*ELDKVTGDEDIVEESHL

SKTQYLQAVVKETLGLHPPFGLLISWSPSDSKAVGGYTILKGLEAFCNVWLVIKDHEKW

MGGYTILKGSQALCNVWLIIRDPEKWQNLLHFQAETLLKD  1311354

 

>CYP707A30 old b

73% to 707A4

supercontig_62:71264,73838

GLHM_ORF_11_from_supercontig_62

MVRGCICMENNISIGLYAILLLCIFLSYFFIRKRREEHRGGAKLPPGSMGWPYVGETLQL

YSQDPNVFFVTKQNRYGEIFKTHILGCPCIMLASPEAAKFVLVTHAHLFKPTYPKSKEKM

IGPSALFFHQGDYHTRLRKLVQSSLSPERIRKLIPDIEAIAISALDSLAGGLVISTFHEM

KKFSFDVGILSIFGHLDSTYREKLKENYQIVDKGYNSFPTNIPGTSYHKALLARRRLNQI

LTEIIRGRKEKRLVESDLLDHLLSFQDEGGKILSDDQIADNIIGVLFAAQDTTASVLTWI

IKYLNDDQKLLEAVKAEQKAIYESNDRGRKPLSWAQTRNMPLTNKVIMESLRMASIISFT

FREAVVDVEYKGYLIPKGWKVMPLFRNIHHSPEFFSDPQKFDPSRFKVPPKPNTFMPFGN

GVHACPGNELAKLEMLILIHHLFTKFRWEMVGSQYGIQYGPFPVPQQGLLAQFWKESSCL

IQDFVSSN*

 

>CYP707A31 old c

68% to 707A2

supercontig_81:546666,550769

GLHM_ORF_132_from_supercontig_81

MSPTLQLSSLPSSPSSSFSASKVSQSRSLLLMYPSLFPLSMLVLLLFLY

CVFLQRRHSRHKRLPPGS

MGWPYIGETLKLYTENPNSFFAVRQKRYGDIFKTHILGCPCVMISNPDAARSVLVSMAHL

FKPTYPPSKEKMIGPEAIFFHQGAYHSRLKKLVQASFLPSSIRDSVSEIEQIVLRFLPTW

EGTTINTLQEMKRYAFDVAMISAFGDKQGLEMEEIKQLYQCLEKGYNSMPLDLPGTPFRR

AMKARELLNEMLKKMIEKRRESGEEGGGLLGVLLGAKDDHNQKLNNYEHLLSDSQIADNI

IGVIFAAHDTTASALTWLLKYLHDNQDLLEAVVREQESTRRKIAEADRVLAWDDTRRMPL

TTRVIQETLRRASILSFTFREAVQDVEFEGYFIPKGWKVLPLFRIIHHSADFFPHPDKFD

PSRFEVPVRPNTYMPFGNGVHSCPGSELAKLEMLVLLHHLTTTYR

QVVGKEDGIQYGPFPVPKRGLPIKVGHDYAFRVL*

 

>CYP707A32 old a

62% TO 707A4

supercontig_55:959696,968158

MEIVVITLLMLLFPLILLTSIVVGKSEKKRMKNLPPGSMGWPYIGESLKLYSQNPDVFFQSRLQR (2)

YGEIFKTHLLGCPCV

MVASPEAVKFVLVTQSRLFKPTYPPSKEKLIGSSAIFFQQAGAYHTRIRKLVQASLNLDI

IRTLIPDIEAIALLALNSCCAGGRVINTFRQMKK (0)

FTFDVATLIIFGQLETSYKAMLEKNYRTLDKGYNSFPINLPGTPYKKSLL (0)

ARKRIGQILREIIRSRKLEERGLLGSLMKFECENGE

RLSDDEIGDNVIGVLFAAQDTTASVLTWILKYIHDDSNLLESIK (0)

AEQKAFYESNDGGKRPLTWTQARNMPLTSR (0)

VIMESLRMASIISFTFREAVQDVEYK (1)

GFLIPKGWKVLPLFRNLHHDPDFFTHPNIFDPSRFE (0)

VGLKASTYMPFGTGVHACPGNEVAKLEMLILIHHLVNKFR (2)

WEVVGSGNRVEYAPFPMPKGGLPARFWKDESCSQG*

 

>CYP707A33 old d

62% to 707A6

supercontig_49:96283,99392

FGPP_ORF_23_from_supercontig_49

MEEIKEGEMNTALVYLIIIIIIIIIFSSLLLIKKLVKTHRGHAVAKLPPGSMGWPYLGET

LQLYSQHPNLFFTTKHKRYGEIFKTNILGYPCVMLGSPDAARFVLVTHAHLFKPTYPKSK

ERLIGPSALFFHQGHYHMRLRKLIHSSFSLHHIKNFVPTIDALAVSILHSWDAAPIINTF

HEMKKFSFEVGIAAIFGHLDIGYREELKKNYRILDKGYNCFPTNIPGTPFKRALMARKRL

NKILSEIIKERKEKRLVEKDVLRCLVNYKDEKGEVLSDDQIADNIIGVLFAAKDTTASVM

TWIVKYLHDNPQLLEAVKAEQLAIRRFNDEHNEPLSWSQTRNMPITHKVVLETLRIASII

SFTFREAVTDVEYKGYLIPKGWKVMPIFRNIHHNPDFFPDPEKFDPWRFEVAPKPYTFMP

FGSGVHSCPGNELAKLEMLIITHHLVSNFRWKLIGSEGGIQYGPFPVPLHGLPARFWKES

TTPS*

 

>CYP707A34 old e

supercontig_1525 :65,1865

63% TO CYP707Ab

N-term is in a seq gap upstream of supercontig 1525

  65 RYGSVFKTHILGCPCVMISSPEAAKFVLVTRAHLFKPTFPASKERMLGKQAIFFSQGDYH 244

 245 NKLRKLVLRAFMPEAIKYIVSDIESIAKDSLKSWEGKLITTYQEMKT (0)  385

 493 YTFNVALLSIFGKDEVQYREDLKRCYYILEKGYNSMPINVPGTLFHKAMKARKELAQIL 669

 670 TKILSTRRQMKLDHNDLLGSFTGDKEGLTDEQIADNIIGVIFAARDTTASVLTWIL 837

 838 KYLGEKPSVLQAVT (0) 879

 1002 EEQEGIKKSKDKDGVEKELSWADTKNMPITCRVIQETLRVASILSFTFREAVE 1160

1161 DLEYQ (1) 1175

1310 GYLIPKGWKVLPLFRNIHHNPEIFPDPEKFDPSRFE (0) 1417

1531 SAPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTNYR (2) 1650

1770 WCMVGKQSGIQYGPFALPQNGLPIILTPKSS* 1865

 

>CYP707A35P old f pseudogene

supercontig_1525 :2576,2720 (minus strand)

2720 IKKTKDNDGEKKELSWADTKKMPISC  2647

2635 VIQETLRVASILSFTFREAV 2576

 

>CYP707A36P old g pseudogene

supercontig_1525 :7568,9380

86% to 707Ae

partial duplication of heme signature exon

missing first exon, multiple frameshifts

RYGPIFKTHRLGCPCVIISSPEAAKFVLVTKAHLFKPIFPASKERMLGKQAIFF

SQGEHHSTLKKLVLRAFMPEAIKKIVSDIESIAEDCLKSWEGKLINTYQEMKT  (0)

YTFDVAFLSIFGKDEVLYRDDLKRCYYILEKGYNSMPINVSGILFHKAMKARKELAQILT

KIPPSRRQMKLEHNDLLGSFMGDKGLTDKQIADNIIGVIFAARDTTASVLTWIVKHLGE

NPTVLQAVT (0)

EEQEGIRKTKDKDGVEKEQSWADTKKMPISCMVIQEIMRVASILSFTFRAAVEDVEYQ  (1)

GYLIPKGWKVLPLFRNIHHNPEIFPDPEKFDPSRFE  (0)

SASKPNTFMPFGNGTHSCPGNELAKLEILVFLHHLTTNYR (2) 

            GNGTHSCPGNELAKLEILVFLHHLTTNYR

WCMVGTEGGIQ

NAPFALPQNGFSMLLS

 

>CYP710A18 AM446467.2 Vitis vinifera

6308  MESSSTLVFSFASVAPYLLSL

6371  IALLVFLEQISYLKRKRLIPGPPFVFPFIGNAVSLIRNPTKFWDIQSSLARSSDLGISAN  6550

6551  YIVGKFIVFIRSTDLSHKIFANVRPDAFHLVGHPFGKKLFGEHNLIYTMGQQHKDIRRRI  6730

6731  APNFTPRALAAYTSLQQVIILKHLMAWEALASKASPTPISLRLLCREMNLDTSQTVFVGP  6910

6911  YLSQEARERFNRDYNLFNVGLMKLPFDLPGFAFREARLAVDRLIKTLAGCTDESKATMEA  7090

7091  GEEPRCLIDFWMQETLREIAXATDSGEPLPPHSGNAEIGGHLFDFLFAAQDASTSSLLWA  7270

7271  VTLLDSHPEVLAKVREEVAGIWSPESDTLITAEQLREMKYTEAVAREVVRIRAPATMVPH  7450

7451  IAGEDFQLTESYTIPKGTIVFPSVFESSFQGFPDPERFEPERFMEHRQEDRLYKKNFLAF  7630

7631  GAGAHQCVGQRYAINHLVLFIAMFTSLVDFKRHRTDGCDDIAYVPTICPKDDCKVYLSRR  7810

7811  CARYPSFS*  7837

 

>CYP710A19

70% to 710A1 Arab., 68% to Vitis CYP710

supercontig_166:148065,149585

GLHM_ORF_20_from_supercontig_166

METISSILYSISPYLFTALLFLFLIEQISYLRKKRHAPGPILVFPFLGNALSLVRDPTTF

WFKEAATAATTGYCANYIAGKFTVFLRNTELSHLVFANVRPDGFHLVGHPFGKKLFGEHN

LIYMFGQDHKDIRRRIAPNFTPKALSTYTHLQQIIILRHLKNWESVSSQSPSQPIPLRLL

VRDLNLETSQTVFVGPYLTKEARDRFRVDYNLFNVGSMKLPIDFPGFAFGNARRAVTRLV

KTLAVCAGASKARMAAGEEATCLVDFWMQGTVEEIANAKAAGESPPSNSGDEETGGFLFD

FLFAAQDASTSSLLWAVALLDSHPEVLKRVREDAGRVWSPESDELITTDQLREMTYTQAV

AREVLRYRPPATLVPHIAMEDFPLTESYTIPKGAVVFPSVYESSFQGFSDPDRFDPDRFF

GDRREDQLYKKNFLTFGAGSHQCVGQRYALNHLVLFIAMFCTLLDFKRHRTDGCDEIMYC

PTICPKDGCSVFLSKRRARYPNLSSK*

 

>CYP711A14 Vitis vinifera AM474585.2 73% to CYP711A7v1 Populus trichocarpa

       MDAALQGLIQIGVSFIRTPMAPAFFTVLA

       MLGGLLGYLYEPYWRVRRVPGPPVFPLVGHLPLMAKYGHDVFSVLAKKYGPIF

24988  RFHVGRQPLVIVADAELCREVGIKKFKDIPNRSIPSAISAS

       ALHQKGLFFTR (2)

25351  DARWSTMRNTIISVYQQSHLANLXXTMQAFIEPAFRN

       XXXXXXXXXXXXXXKLXTDVIXQAAFXGSDFGLXKPPSSNE

       XXXXXXXXXXXXXXXXXXXXXXQHIXSTTNLKMDLSGSF  25698

25699  SIILGLLVPILQKPVQHILKRIPGTMDWKIDQTNKKLSSRLDEIVAKRMKDKDRGSKDF  25875

25876  LSLILNARESEKAMKNIFTSDYLNAVTYEHLLAGSATTSFTLSSTIYLIAEHPEVEKKLL  26055

26056  AEIDGFSPPDQMPTAHDLQHKFPYLDQAKSL

26248  VVKEAMRFYTVSPLIARETSAEVEIGGYALPK  26343

26968  GTWIWLAPGVLAKDPKNFPEPDKFKPERFDPNCEEEKQRHPYAHIPFGIGPRACLG  27135

27136  QKFSLQEVKLSLIHLYQRYVFRHSPNMEKPLELEYGIILNFKHAVKLRAIKR  27291

 

>CYP711A15

71% to CYP711A1 Arab., 71% to Vitis with some gaps in the Vitis seq.

74% to DQ335803.1 Medicago truncatula

GLHM_ORF_236_from_supercontig_7:1596579,1603796

MGLVEMLMGVRWFNTTLPPAVSTFFTILAVAAGILVYLYGPYWGVRRVPGPPIIPLVGHL

PLMAKYGPDVFSVLAKRHGPIFRFHMGRQPLIIVADPELCREVGIKKFKDIPNRSIPSPI

SASPLHQKGLFFTRDARWSTMRNTIVSVYQPSHLASLVPTMQEFIESATQNLESQQDVNF

SNMSLKLATDVIGRAAFGVNFGLSKPQSIDESINKKTNQDDNVDDHEVSSFINQHIYSTT

QLKMDLSGSFSIILGLLIPILQEPFRQILKRIPGAMDRKVDQTNRKISRKLDEIVTKRMK

DIDKRSNVDFLSLILRARESGTAAKNVFSPDYISAVTYEHLLAGSATTSFTLSSVLYLVA

GHPEVEKKLLAEIDSFGPHKKLPTFHHLQYNFPYLDQVIKESMRFYLVSPLIARETSKDV

EIGGYFLPKGTWVWLAPGVLAKDPKNFPEPDKFKPERFDPNCEEEKQRHPYAFIPFGIGP

RACIGQKFSIQEIKLLLIHLYRNYVFRHSPNMENPIELEYGIVLNFKYGVKLRVIKRT*

 

>CYP712A8 old a

GS_ORF_96_from_supercontig_85:659837,661174

69% to CYP712A1

first part of ORF_96

N-term is in a seq gap

VAETNNEAKEMKELVKTCLVLGGKLSVGDVLGPLKVLDFSGTKKRLVEVMNKYDQLMERIIGEHEEKALK

GFDEDQRKDILDILLEIYRDPTAEIKLSKNDIKSFLL (0)

DIFLAGTDTSASAMEWAMAELIN

HPQVFKKLREEINSVVGSNRLVKESDIPNLPYLRAVIRETLRLHSP

GPLIVRQCTEDSEVNGFMVKAKTR

SVINAYAIMKDPDEWSEPEKFVPERFLENTEEIVGEHHMEFKGQNFRYVPFGSGRRGCPGASLAMLVMHAT

VGSLVQCFDWKLKEGEKVDKSEGSGFAAEMARPLMAYPVQHLNPCS*

 

>CYP712A9 old b

GS_ORF_96_from_supercontig_85:662872,664506

 68% to CYP712A1

second part of ORF_96

MATTNITGSLYYLPFFIFAFIIHSLFRNLLKPGGNQTKLPP

MPPALPFIGHLHLLGSVLPKSFQTLARRYGPLMRLRLGASSCVIVSNTAVAKEIFKTHDL

SFASRPEFGSSEYFKYRGSRFLLAPYGDYWRFMKKLCMARLLGVPQLEKFTEVREQEKEK

LVESLMRICREGKMCDLGSELIKLTNNTICRMAMSTRVSESNSEAKEVKELVKTCLALGA

KLSVGDVLGPLKILDFSGTGKKLAEAIDKYDQLMEKIIREHEEKASKGFDEYQRKDILDI

LLEIYRDPTAEIKLSKNDIKSFMLDIFLAGTDSSVSAMEWAMAELINHPQVFNKLREEIN

SVVGSNRLVKESDIPNLPYLQAVIRETLRLHPPGPLIIRECTEDSEVKGFMVKAKTRVLI

NVYAIMKDPEEWSEPEEFVPERFLENPEERIGEHQMEFKGQNFRYIPFGSGRRGCPGASL

AMLVMHTTVGSLVQCFDWKLEEGDKVDMSEGSGFSAEMARPLLVYPVQHLNPFS*

 

>CYP712A10P pseudogene with N-term inverted

GS_ORF_8_from_ supercontig_234:168237..173712 (- strand)

44% to 712Ab, 44% to 705A27

This could be a pseudogene of either CYP705 or CYP712,

But so far there are no CYP705 genes found.  CYP705 may be

Derived from CYP712 in Arabidopsis and Brassica only.

MTSMTDVQFYFTIFFLCLISTLLLHFISIKPISHLPSSP

LPPSPLAIPVIGHLHYFFHLFTPLHKLF*NLSSSHGPLHYLRLGINPCVLVSSASFATQV

FKTNDLALAAR

YMPYGTTSFVIAPYGDYWRFMKKLYMTELLGAKQVDRFACIRREEICRILRKMITSAARN

ESVDVGLELMKLSNNAMCR

MVMSTNYSEEDGEAERLRELLKKSFELAPKLCFGDMLGPFKKLAFWMYGK

 

GS_ORF_8_from_ supercontig_234:168237..173712 (+ strand)

48% to 705A25

VELTMEVDELLEKILKEHEEIRKKK

RDLMDILLDFYEDNDKSEFRITRTQIKAFI

LFMAGTSTSAETMQWTMAELINHPDLLKKVRDEIDSVITTNYRWLVEESDICKLPYLQAAVK

EESLRLHPSAPLITRECRTKSCRIKEFDIPEKTTVALNLYAIMRDRDEWDRPDEFLPERFL

YDQSIGSDDYNKGSKVLDFVPLGGGRRV

CPGSALALSMINIAVASLVQCFGWHQVGEVKMEEGSGMKLAMVHPLVCIPVLHFNPFLVL

KMKETKCDLMGF*

 

>CYP714A7

63% to714A1 Arab.

GS_ORF_30_from_supercontig_23:265908,269521

MYKSEREGVVELEGGVGRSLWWVVIGVWGWLVVHYVWVKLQRAKRELQTQGIRGPPPSLF

YGNLPEMHRLQRLNSRPNHSTTLTHDYTSTLFPYFNLWTKQYGLVFTYSTGSRQHLLINE

PELVKELNQTKTLDLGKPSYLTKRFRPMLGNGIIRSNSHEWARQRKIIAPEFFIDKVKVN

PRVDVCGMVDLMVESAQPLLESWSNSIECQGGMPIDVSVDEDLRSVSADVIARTCFGSSY

CKGKQIFSKLRSLQKAIVEQSINLFDVASFRERLFPGKKHDKISNLESEIESLIWETVKE

RRQENFACHEKDLMQSILEAAVKDTTGDTVSSKQFIVDNCKNIYFAGHETTAVAASWCLM

LLALHPEWQSRIRQEVAKFCKNGLPDTDSIPHLKTLSMVIQETLRLYPPATFVSREALAD

TRIGNIVVPKGVCIWTLIPTLHRDPDIWGADANEFRPERFSDGVSKACRHHQAYVPFGLG

TRVCLGKNFAMVQLKVLLSLIVSKFNFSLSPHYRHSPIFRMIVEPEHGVLIRIQKI*

 

>CYP715A6 AM468263 Vitis vinifera

MAFLHMLPQVFFSAMGLFLLFVLWRVVFSCWISPNRVYRRIRMN

GLEGPPPSFPLGNIDEMKKDKRSSSSGYSGISHDIHSTVFPYFSRWTKSYGKVFIYWL

GTEPFLYVADPEFLKRMSAGVLGKSWGKPSVFKHDREPMFGNGLIMVEGDEWVRHRHV

ISPAFSPANLKAMASLMVESTTKMLDXWSSLVGTGMPEIDVESEISHAAGEIIAKTSF

GISFESGRKVFDKLRAMQITLFKSNRYVGVPFSKLMCPIQSLKAKRLGKEIDGLLLSI

IADRKKSNSTATQQDLLGLLLADNLVGGRLGKMLTARELVDECKTFFFGGHETTALAL

TWTMLLLATHPEWQTQLREEIKEVIGEGDQLDFTKLGGLKKMSWVMNEVLRLYSPAPN

VQRQVREDIRVGDVTVLNGTNMWIDVVAMHHDPTLWGDDVYEFKPERFKDDPLYGGCK

HKMGFLPFGFGGRMCVGRNLTTMEYKVVLTLILTRFSFSLSPTYTHAPATLLSLRTSF

GLPVLLQPL

 

>CYP715A7

61% to 715A1

supercontig_107:312333,315002

Note: the browser shows NNNNNN in this region, but a blast search finds this seq.

N-term not recovered in blast

70% to Vitis 715A1 best hit in GenBank

312333 FKGPTPTFPLGNITEMKKNTKDSSSSFRSSTVSHDIHSTALPYFSRWQKSY (1) 312503

312728 GKVFVYWLGTEPFLCIADPEFLKKISEGVMGKSWGKPDVFKQDREPMFGNGLNMVEGDEW 312907

312908 VRHRHVITPAFTPANLX  312955

313371 NMSNMMVESTTKMLDKWTAMINSGNPLIDVEKEMIETAGEIIARTSF 313535

313536 GTNHEVGTKVLEKLRAMQMLLFKSNRYVGVPLNKYLISPRQTRETKRLGKEIDELLLTI 313712

313713 INDRKNDRRSPQKDLLGLLSEAENNVDGRDGKTLTPRELVDECKTFFFGGQETTALAVTW 313892

313893 TLLVLAMHPEWQEQLREEIRQVVGEKEVDATMLARL314009

314547 MGWVMNEVLRLYSPAPNAQRQVREEIRVSHDDNRTVIPSGTNIWIDVVSMHHDPE 314723

314724 LWGEDVYEFKPERFKEDILYGGCKHKMGFLPFGFGGRMCIGKNLSAMEYKIVLTLILSRF 314903

314904 SFSLSPTYTHAPSLLLSLRPSYGLPLVLQTL*T 315002

 

>CYP716A15 AM471070.1  Vitis vinifera

      MEVFFLSLLLIFVLSVSIGLH

4753  LLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSL  4574

4573  LGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFF  4394

4393  KPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVAKF  4214

4213  EKPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAEGKASQXQDIL  4034

4033  SHMLLATDEDGCHMNEMXIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEKVYE  3863

2948  EQMEIANSKAPGE

2901  NWDDVQXMRYSWNVACEVMRLAPPLQGAF  2815

      FREAITDFVFNGFSIPKGWK  2757

2632  LYWSANSTHKSPECFPQPENFDPTRFEGBGPAPYTFVPFGGGPRMCPGKEYARLEILVF  2456

2455  MHNVVKRFKWDKLLPDEKIIVDPMPMPAKGLPVRLHPRKP*  2333

 

>CYP716A16

62% to 716A2, 78% to Medicago DQ335781.1, 79% to Vitis AM471070

GS_ORF_62_from_supercontig_91

supercontig_91:719869,722712

MEHLYLTLLLAFVSFVSLSLFIIFYKHRSPYAYPNLPPGKIGLPFVGESLEFLSTGWKGH

PEKFIFDRIARYSSVIFKTNLLGEPAAVFCGAACNKFLFSNENKLVTAWWPNSVNKIFPT

SLQTSSIEESKKMRKLLPQFLKPEALQRYIGIMDGIAQRHFESGWENKEEVKVFPLAKSY

TFWIACRLFMSIEDPNHVERFAEPFHHLASGVISIPIDLPGTAFNRGIKASNFIRKELLK

IIKQRKIDLGNGSASPTQDILSHMLLTSDESGQFMSELDIADKILGLLIGGHDTASAACT

FIVKYLAELPHIYQKVYEEQMEIAKSKAAGEMLNWDDIQKMKYSWNVACEVLRLAPPLQG

AFRQALYDFIFDGFSIPKGWKLYWSANSTHKDPECFPEPEKFDPTRFEGNGPAPYTFVPF

GGGPRMCPGKEYARLEILVFMHNVIKRFKWEKVLPDEKIIVDPMPVPAKGLPVRLYPHAH

AL*

 

>CYP718A4 AM448959.2 Vitis vinifera

       MAMEMTFVFALAV

25955  LLAAVPSLMFLQRRNNNXSKKKLPPGEMGLPWIGETVEFYKAQRRYRLYEEFIQPRIAKY  26134

26135  GKIFKTSLMGSPTVVVNGEEANRFFLSNEFKLVISSWTSASVQLMGKDSIMEKQGEZHRC  26314

26315  LRRIIATSLSFAGLETLVPKICNSVQYHLDTK*HGQDTISLYHSTKVLTFTI

26475  FECLLGINVEPEMIQVF*RVLEGVFSPPVKFPGSRFSRAKRARQEIEKMLVEIVRKKRQE  26654

26655  XXKRVEEGEEGGILLSRLVAGLIRGEIKEEEVVDNVVLLVFAAHDTISFTIAMT  26816

26817  FRMLAHHPTCYALLYQ

       EHAALMNNKGPGQNLALED  26996

26997  XEKMKYTWQ  27023

27028  VARESMRLFPPIFGSFRKAIVDIEYEGYTIPRGWK (0)

       VLWTAYGTHYNPKYFGDPSTFDPSRFEDAVPPYVFVPFEGGPRVCAGYQLAKLNILI

       FLHFVVTHYDWSLRYLDEPITMDPLPFPFQEMPIKISPK

 

>CYP7185

64% to CYP718A1 Arab. 70% to 718A1 Populus, 67% to Vitis

supercontig_50:788919..790179 missing the C-term in a seq gap

788919 METENSFVLPSWILFCLAAMVTTILFKHKKNYCIRKSKLPPGEMGLPWIGETM 789077

789078 DFYRAQRNNRLFDEFIQPRIMKHGNIFKTRLMGSPTVVVNGAEANGFILSNEFKLVISSW 789257

789258 PSSSVQLMGKESIMEKQGEQHRCVRGLIATSLSFSGLESIVPKICNSVKLHLQRNWDGHE 789437

789438 TISLYRSAKSLTFEVVFECLLGIKVEAGMLQTFERVLEGVFAPPVKFPGSSFARAKKARQ 789617

789618 EIEKMLVGVVRDKKKEIMERGKHGYERSNGGKGGMLLSRMVVGLIQGELSEAEVIDNVVL 789797

789798 LVFAAHDTTSFAIAMTFKLLAKHPSCYNLLLQ (1) 789893

790021 EHIEIKENRGQQENLTMEDIKKMKYTWQVARESMRLFPPIFGSFRKAVADIEY 790179

 

>CYP720A1

supercontig_628:9405,24215 with  a sequence gap

GS_ORF_1_from_ supercontig_628:71..9392 (- strand)

GS_ORF_2_from_ supercontig_628:9405..24215 (- strand) C-term

GC boundary at TYR

MGEKNCLLLGVWSMITGMIIIVCIFIINISNSEYRGRRRSAFPPGRLGWPILGDT

FSWYNAVASSHPPSFVQQQAQRY

GKIFSCNLLGKRAVVSVDPGFNRFVMQNEGKLFQSSYPKSFRDLVGKNGVITVQGEQQ

RKLHAIASNLMRLNNHFLNDIQMILVKTFANLRDSQVILLQDVCRKASI

NLMVNQLLGVYSESEINEMAQLFSDFVDGCLSVPVNIPGFAYHAAMK

 

 

EEHDNLKVDSSTDKMLTWQDYKSMIFTQC

VIDETLRLGGIAIWLMREAKEDVAYQ

DYVIPKGCFVVPFLSAVHMDESLYKGSLSFNPWRW

KRNWRSSPFYSPFGGGARFCPGAELARLQIALFLHYFVLTYR (2)

WTQLKEDQMSFFPSARLVNGFQIFLSKRSDK*

 

>CYP721A12

59% to CYP721

supercontig_64:400335,403236

GLHM_ORF_54_from_supercontig_64

MYFQLLAIFSLLPLLCLLKFLHSVIWIPWKIQKHFKNQGITGPAYCPITGNTVEIRRLYA

EAQSKPISVDLHSILHRIAPFYHVWSRKYGKMFLYWFGCKPRLAVSDPDMIKEIATRTGG

SFNKIRFNPLSRQLFAQGLVGLEGEKWAFHRRIANQAFTMDRVKGWVPEIVGSTVKMMEK

WEEIRGGRDEFEMEIHKQLHELSADVISRTAFGSSFEEGKRIFLLQEQHARLVSLALRSV

YIPGFRFLPTKNNRERWRLEKETRQSIRTLIEMISRDKARENSRNLLSLLMCWYKNEDGE

EERLDVEEIIDECKTFYFAGKETTANLMTWALVLLALYPDWQSKLREEVTNVCGPNKFPT

ADKLNELKLVSTVINETLRLYPPAVMLTRETSEKVKLGNIDIPAKTQLYLAIAAVHHDTE

IWGEDANEFNPLRFKEPRKQTAAFLPFGLGPRTCVGQNLALVEAKIMLAIILQRYSFVLS

PSYIHAPMLFMTVQPQYGTHVLFRRISNS*

 

>CYP722A1    Vitis vinifera

            DX437085.1

RYGNCFRTSIFGQTHVFVSSTESAKVVLNNEVGKFTKRYIKSIAELVGNESLLCASHQHH

KLIRGRLINLFSTASISSFIKQFDQLIVTTLSGWEHKPTVVVLHEALEV

KAMCKMLMSLESGDEVEMLQKDVAHVCEAMIAFPLRLPCTRFYKGLE

 

>CYP722A1 old a

supercontig_99:626932,629354

56% to 722A1 Arab., 40% to 722Ab

63% to CO081670.1 Gossypium raimondii (in Malvales) EST N-term half

SEQ GAP AFTER NQKAL

MHAIRFPNW

LCLFLVGGLTLLVIQLWRRPRRHSTKGIPPGSLGLPLIGETLQFMAAIRGGEGFYQFVQARR  (2)

YGKCFKTNIFGETQVFISSTKSAKVILNNETGLFTKRYIRSIAKLVGDESLLCASHHHH

KKLRARLLNLLSTNSIVSLIQYLDPLIVHSLRNWERAGTVVVLEETLK (0)

ITFKAMCKMLIDLENEKEVDALLEQVTHVCKAMLGFPLKFPGTRFYRGLQ

AREKIMQTLDKLIVERRSSMGSHDDFLQQLLMENDAISSSRHTLKLRDAEIKD

NILTMIIA (1)

GQDTTASALTWMVKYLSENQKAL

 

>CYP722A3 old b

45% to 722A1 Populus, 40% to 722A1 Arab.

supercontig_6:1380789,1378359  C-term is in a seq gap

1380789 MLNLSKENLYIIEFRYLDMITVAMLSIGVTILLSKAWTKIKTRKGGIPGRLGLPLLGETF 1380610

1380609 AFLSATNSTTGCYEFVRLRRXX 1380550

1380110 RHGNWFKTRIFGKIHVFVPNTEGAKIIFANDFVHFNKGYVKSMADVVGKKSLLCVPHESH 1379931

1379930 KRIRHLLSEPFSIYSLSNFLKKFDTMLCQRLKKVEENGKSFSVLEFSMK 1379781

1379598 VIFDAMCDMLMSVTEDSWLRQLEKDCADVSHAMLSIPVMIPGTRYYKGIK 1379440

1379266 ARRRLIKSISEMIARRRRGIEFHQDVLQSILQRDSYPSTEKLDDSEIIDNLLTLIIAGQI 1379087

1379086 TTAAAMMWSVKFLDENEEAQDRLR  (0) 1379015

        EEQLLIAKNKANDGSLTLEDLNSMSYGLK

        VFKETLRMSNVLLWFPRVAINNCILEG 1378359

 

>CYP724B11 old a

supercontig_136:755096,762980

GLHM_ORF_86_from_supercontig_136 52% to CYP724A1

52% to CYP724A1

74% to 724B2 Lycopersicon esculentum

MVLCVWLILVSGLVGFVVVVILNHFLPLFWKPVLAPKGTFGWPILGETLGFLTPHPSNSL

GSFLQDHCSRYGKVFKSHLFFSPTVVSCDPELNYFILQNEGKLFQCSYPKPIHGILGKVS

MLVAVGETHKRLRNVALSLVTITKSNPDFLHDIERFAIQILHSWKDKPQVIFCEEARKFT

FNVIVKQVLGLTPDDPETSKILEDFLTFMRGLISLPLYIPGTPYARAVQARSRISSTVKA

IIEERRKSNGGKSSSSDFLGILLGVDTLSEDEKVSFVLDSLLGGYETTSLLMAMLVHFLA

HSPNALRQLKVEHETIRNMKQKDEFLNWEDYRRMDFTQHVINEALRYGNVVKFVHRKALK

EVKFRDYVIPCGWKVLPVFTAVHLDPSLHASAPQFYPWRWEPVHSPHSQDQTCKKFTPFG

GGSRCCPGSELAKVEVAFFLHHLVRNFR (2)

WRTEENEQPIAYPYVEFQRGLMLNLEKFSI*

 

>CYP724B12  old b

55% to CYP724a, 56% to 724A1 Arab.

supercontig_130:711328,714779 (+ strand)

GLHM_ORF_81_from_supercontig_130

MAGLLFLLLLVGLAFLLTFTRTIYAKKQESEPKNLPHGSMGWPLLGETLAFLKPHKSNSV

GHFLQDHCLSSDTSASKIPRRKYGKIFKSHLFGSPTIVSCDHEFNMFILQNEEKLFQVSY

PKPIHGILGKFSLLTISGELHKKLRNIAVSFIATAKSTQDFLLYVEKLSISMMNSWKGCT

EIAFHKEIKRFTLNLMVKLLLSIEPEDPLALNILEDFLTYMNGFVSLPINIPGTAYSNAV

KARRRLSSIVRGVMREREGKMDLMELRRKEDFLDVLMSKRKLSDEETVSIVLDILLGGYE

TTATLLALIVYFLAQSPNAFQTLKEEHQAIREKKENGEPLNWEDYQQMEFTSYVICEAMR

CGNVVKFVHRKALDQDINFKGFVIPSGWKVLPVFTAAHFNPFLHENPSEFNPWRWTDKGM

SKRVTPFGGGPRLCPGAELAKVEIAFFLHHLVLTYRWKTKSDDFPLAYPYVEFRQGLLLE

IEPSRNLN*

 

>CYP727A7 AM439016.2 Vitis vinifera and AM454319.2 N-term

frameshift in  exon 1

      MSSCQSPGTPLPS

      PSCHSRDNSRFLRDYAATQINAFLWISLIAVTLLLLRKLFKLFALWAKGSRISGLP

      GPSFYGHSKLISETNLT  (1)

2607  GLLSESHNKYGSVVKLWLGPTQLLVSIKDPVLIKEMLLKAEDKLPLTGRAFQLAFGPSS  2425

2424  LFSSSFDK (0)  2395

5291  VQKRRELLAAELNGYLLQRANVISTKVVDHVMEKLHAIMGKGTLDCKIVSQHMAFSIMGA  5470

5471  TLFGDAFLAWSKASVYEELLMMIAKDACFWASYGVTPFWKQGFWRYQRLCMKLKSLTQDG  5650

5651  IEQCRQNYXLFSHMDKNSNSEISNPETKNAPEAPFSSGILMPDNLSSQECNGHVNAREEP  5830

5831  CGNIMRVMFHGCLTTAGLIGNILARLATHPEIQDK  (0) 5938

8552  IYSEIIMSRKGAQKQKQQNVDKMLVLLATVYESARLMPAGPLLQRCSLKH(1)  8701

9717  DLNLKTGLTIPAGAILVVPVQLVQMDDSCWGNDARQFNPYRFLSKA (0)   9851

10402 DSCILDDPNHNAAFLPFGSGTRACVGQKFVILGVAALFASLLEHYE  (0) 10539

      IRLQPGSEDDPKPMLNDSVLQLLPSPKIVFMKRNSRE

 

>CYP727A8

65% to Vitis vinifera CYP727A7 AM439016.2 (best Blast hit), 44% to 727A1 rice

supercontig_228:25899,36292

FGPP_ORF_7_from_supercontig_228 (modify)

Last exon in a seq gap

25899 MNSCESDFLSTFLSFLFPSPESHSMTCGSRKTSFGVFVDYAKWEFNAFLWISLIAITLFL

      LRKVVRLLMLWIQAAKIPGPPSPSFFGHSQLFSRESLT  26192

26597 GLLSDSHDRYGSVVKLWLGPTQLLVSVKDPTLFKEMLLKAEDKLPLTGRAFRLAFGPCS 26773

26774 LFASSFDK (0) 26797

28709 VQKRRESLAVELNGRLLEKANVFPAKAMDCIMERVNKNMCKESVDCKMV 28855

28856 SQHMAFTLLGTILFGDAFLTWSKANIYEELLMMIAKDACLWASYGVAPFWKRGFWRYQCL 29035

29036 CTKLKCLTQDIIHQCKKNYKLFRHANQNNHDEITTAMESAFSTPSCSSNSLQEFS 29200

29201 SHLFTKEEPCGNIMVVMFHGCLTTAGLIGNILARLATHPEIQDS  ()29332

30011 IYSEIVMAQKCSVDQDKHDVDKMLLLLATIYESARLLSSGPLLQRCSLKH (1) 30160

32911 DLSFENGLTIPAGAVLVVPVQLVQVDNSKWGSDASKFNPYRFLSKE (2) 33048

36158 SFVLKDPNDNEAFLSFGFGTRACLGQKFVI 36247

36248 QGVATLFASLLERYE (0)  36292

 

>CYP728B5 AM457336.1 Vitis vinifera with 3 frameshifts

       MTLLLNINSLSTMATLFPFCLLLLPMLLLLVRRSSA

20741  KRVPPGSLGLPIIGQSISLLRAMRSNTAEEWLQERVRKYGPVSKLSLFGKPSVFINGQAA  20562

20561  NKLIFASDGSTISNQQARSNQMI  20493

20493  LGDRNLLELSGEDHKRVRNALLSFLKPESLKLYVGKMDAEVRKHLQMHWQGKQNVT (0)  20326

       VLPLMKTLTFNIICGLLFGIEQQIRREKLVVRF  20134

20133  QEVIKGIWSVPLNLPFTSYNRSLRASSEVQNMIKE

       EKREELEKGASPHQDLITCLLSIRG

19950  VNNEAVISDEEIIHNVLLVMVAGHDTSAILITFLVRALANDPDTYAA  (0)  19810

19651  ISEHEEIAKGKPPGGFLTWEDLTKMKYTWRMALETLRMVPPVFAGFRTALKNIEFGGYLI  19472

19471  PKGWK (0)  19457

19379  IFWAMSMTHMDNTIFPEPTVFDPTRFENPASIPPYCFIPFGGGPRVCPGNEFARIETLVV  19200

19199  IHHVVTGFKWKLCHTDNYFSRNPTPEPTEGLPIEIIPRT*  19080

 

>CYP728B6 AM457336.1 Vitis vinifera

       MSAFFTIFLVLLPIFLLLARRRSLP

17441  KGVPPGSLGLPLIGQSIGLLRAMRANTAEKWLEERIKKYGPISKLSLFGQSAVFIYGQAA  17262

17261  NKLVFASDGSTISNQQAKSNQMIMGDRNLLELSGEDHKRVRGAIVSFLKPESLKQYVGKM  17082

17081  DAEVRKHLEMHWQGKQRVT  (0)

16907  VMPLMKTLTFNIICGLLXGVERGIRREKLVGRFQEMIEGIWSVPVNLPFTRYNRSLQASTKI  16722

16721  QNMIKELMREKEVELEKGASPHQDLITCLLSIHGKNNEEVITEKEIVDNVMLVMVAGHDT  16542

16541  SAVLITFLVRLLANDPDVYAAVLK  16470

16312  EHEEIAKGKPSGEFLTWEDLAKMKYTWRVALETLRMVPPVFAGFRTVLKDIEFGGYLIPE  16133

16132  GWK  16124

16040  IFWATNMTHMDNSIFPEPTKFDPTRFENQASIPPYCFIPFGGGPRICPGIEFARIETLVT  15861

15860  VHHLVTRFKWKLCHTDNFFGRNPTPAPTGGLPIEITSMNLM*  15735

 

>CYP728B7 AM442348.1 Vitis vinifera 68% to papaya

      MTTLFTFFLFLLPILLLLVRRRSSA

8045  KRVPPGSLGLPIIGQSISLLRAMRANTAEQWLQERVRKYGPVSKLSLFGKPAVFIFGPAA  7866

7865  HKLIFGSDANTVSNQQAKSNQMILGDRNLLELMGEDHKRVRGALVSFLKPESLKQYVGRM  7686

7685  XAEVRNHLQLNWEGKQRVT  7629

7542  VLPLMKGLTFDIICGLLFGLEQGTRREELVSRFQQMIAGIWSVPFNLPFTRYNHSLQAS  7366

7364  SEVQTKIKELIHEKRQELERGASPNQDLITRLLSIRDENNQQVLSEDEIVHNVMLVMVAG  7185

7184  HDTSAILITFMVRLLANDPHIYAA

6826  VISEQEEIAKGKAPGEFLTWEDLAKMKYTWRVALETLRLYPPILSTFRTAMKDIEFGGY  6650

6649  TIPKGWK (0) 6629

6557  ILWVSTMTHMDENIFTEPTKFDPTRFENQASIPPYCFIPFGGGARVCPGSEFARIETLV  6381

6380  VIHHLVTRFKWKLCHNDNFFSRNPMPEPTEGLPIEIIPRA*  6258

 

>CYP728B8 AM426541.1 Vitis vinifera 56% to papaya

      MSIFNLLLIFLLPIFIILFLRERRGVS

266   QKLPPGSLGIPIIGQSFSFLHALRKNTGEKWLQSRIQKYGAVSKLSLFGTPTVLLSGAAA  445

446   NKFIFTNDGVILANQQPQPIRRILGDKSLTELRGEDHRRVRGAIGMFLKPESLKKYVGKI  625

626   DGVVRQHLDMNWKGHQT

      VYPMMKQLMFDII  805

806   CSLLFGLEQGKDREMLIHDFHLFTQGLWSVPINLPFTRFSNGLKASRRIRRVVSELIHEK  985

986   RSAMELEQASPQDDFITCMLNIQHQSSPDETSAMTEEEILDNAIVVMFAGHETSTSLLTF  1165

1166  LLWFLAKDPVAYDAIVH

      HEEIAKTKVSGELLNWDDLSKMKHTWKAAMETMRIIPPVFGGFRKVLKDF  1525

1526  EYGGYLIPKGWQ  1561

1918  VFWVASPTHMDDQIFIDQWKFNPARFDNQASIPPYNFVPFGGGMRICPGNEFVRIESLVS  2097

2098  IHYLITQFRWKLLDDEDVITRDPMPMPQQGLLVYLEPKAIP*  2223

 

>CYP728B9P  pseudogene 1

supercontig_97:134503,134588

56% to 728B3 rice

AKQEALAKSKPVRAP*TLEDLAKIKYTWRVAMESLRLFPPILGALGR 588

 

>CYP728B10P pseudogene 2

supercontig_97:135508,144872

56% to 728B3 rice, 84% to 728B

SFIIFVFSISIFFLLRRRSSKRL

135577 PPGSLGLPIIGQSLILLRAMRANTAEK*LEERIIK

YGPISKVSLFGKPTVFIYGQAANKSVFTCDSSIITNQQTKSVRMLLGDPCLLDLSGEDHK

RDRDALVSFLKSESLKQYIGKTEE  135933

143998 VVPLMKNLTFNIICSLLIGLERGIRRDQLVGYFQEMIEGMWSVPDNLPFN*YNCSLRARS

QVRKLVKDLIFEMRMELEQQGDPHKDLITCLLSIRNENNQEMLTEEEILHNVMLIMVAGH

DASSIFITFLLRLLANDPTIYAAVLK

EQEEIAKSKPAEAPLTWEDLAKMKYTWRVAMETLRTVSPVFGGFRKALKDIEYGGYLIPK GWQ 144872

 

>CYP728B11P pseudogene 3

supercontig_97:150659,151068

73% to 728Bb,51% to 728B1, 51% to 728B3

DEIAKSKPAGAFITWENLAKMKCTWRVVMETLRMFPPVFKRFRKAMEDVEYGGSLIPKGW

ILWVTNMTHMNKTLFPEPSKSDRTRF*QP

NQTSVPPYT

 

>CYP728B12

supercontig_97:173929..176915 (+ strand)

54% to 728B3 rice

GLHM_ORF_28_from_supercontig_97, 72% to Vitis CYP728b, 68% to CYP728a

68% to CYP728c, 56% to CYP728d

MKILFTIFLFFISFFFLLRRRSSKRLPPGSLGLPIIGQSLTLLRAMKANTAEKWLEERIR

KYGPISKLSLFGKPTVFIYGQAANKFVFTSDSSIIANQQTKSIRMLLGDRCLLELSGEDH

KRVRDALVSFLKPESLKQYIGKMEEEIRLHIEKHWQGKQEVTVLPLMKNLTFNIICSLLF

GLERGIRRDQLVGYFQEMIEGMWSVPINLPFTRYNRSLKASSQVRKLVKDLVFEKRMELE

QQGDPHKDLITCLLSIRNGKNQEMLTEEEIVHNVMLIMVAGHDTSSILITFLLRVLANDP

AIHAAVLKEQEGIAKSKPAGAPLTWEDLAKMKYTWRVAMETLRMVSPVFGGFRKALKDIE

YGGYLIPKDWQIFWVTNMTHMDENIFPEPSKFDPTRFENQTSVPPYSFIPFGGGPRICPG

YEFARIETLVSIHYLIIRFTWKLLLPDNSFGRDPMPVPAGGLPVKIMPRNLDSLTVY*

 

>CYP728B13P pseudogene 4

supercontig_97:178358,178483

64% to 728Bb

178358 KQEALAKSKPARAP*TSEDLAKMYTWRVVMKTLGLFPPILGA 178483

 

>CYP728B14P pseudogene 5

supercontig_97:179454,178182

57% to 728B3 rice, N-term part 88% to 728Bb

MKILFTIFLFFISIFLLRRRSSK

179523 KRLPPGSLGLPIIGQSLTLLRAMRANTAEKWLEERIRKYGSISKLSIFGKPTVFIYGQAA

NKFVFTGDSSIITNQQTKSVRMLLGDRCLLDLLGEDHKRVRDALVSFLKPESLKQFIEKM

EEFIRLHIEKHWQGKEEVT  179939

VLPLMKNLT

LITCRLSI*NENNEEMI

VMLILVAENDSSFILI

MLRAMANDHAIYAAVV

 

>CYP728G1   Vitis vinifera (grapes)

           AM454998.2

MEVLLSSLEESSFEWKLPLISTILVTLIALLAGSIKLKFSPPVD

KKLPSGSLGFPFIGETISFLRAQRQDKTVEWIESRIAKYGPVFKTSLMGSKVVVLTGQ

AGNRFLFSGSDNGILSNQPMSVAKILGKHSIFELAGTRHKLVRGAIMNFLKPESIQRS

VSRMDSVVQQQLFQELEGKDSVQMVGLMKKITFKVTCSLLFGLPDGKETEELLEDFTT

ALKGAWTVPWDLPGTVFRKALQARGRICKQLAQLVRERKAKIEEGRVDSHEDIISSLI

TLRQENGQPLSEEEIIDNLISVVIASHDTSTVLLGLLIRHLARDTEVCKKVLEEQKQV

AKAKEGKGNGKLTWGEVQMMKYTWRVAQELMRMTPPVLGNFKCAWRDTTFGGFDIPKG

WQVFWVAPGTHMDKKVFEEPEKFDPSRFENPSTSVPPYAYLAFGAGPRACPGADFSRV

EVLLMIHNLITKYHWAEMIIDEPIVREPMPYPAMGLPVKLYQRSTT

 

>CYP728G2

52% to 728F1 Populus, 53% to 728E1 Populus, 38% to 728B3,

62% to CYP728G1 AM464998.2 Vitis vinifera

supercontig_13:1915064,1918451

GS_ORF_187_from_supercontig_13 missing heme Cys

MEVVSETSSIWVSLTIVLIIAFWKYYHKKVSGGGGRRLKLPPGSFGLPLIGETMSFVKAH

KESKIGEWVDDHVAKHGSSIFKTVLMGSKTVVITGQAGNRFILSGSDNGIAANQPASVRS

VLGKHSIFELAGGRHKLVRGGMTRFLGPESIQRYVGQMDSLVNQQLSQ (0)

ELNGKISVKMVELMKKITLRVTCSLLFGLDEDKEKDELSMDFTTLLRGTTCW

KSMKARRRIVNKLSKLAARR

RIDLEEGRLNCEADVISCLVSLRDENGHPLLEEEIVDNLLSLMSASHDTITVLLSLFIRH

LAIDSTAYNKVLK (1)

EQMEVAQAVEANNGEKLGMREIQMMKYTWSVAQELMRLTPPVFGGFR

TTWRDTSFGGYDIPKGWK (0)

VLWVASGTHMDENLFQDPKKFDSSRFEGSVKSVPPYTYVAFG

AGMRFCPGADFARIEVLL

VIHHLIKNYKWTQLIRDEPIIQDPLPYPAMGLPVKLCPINTL*

 

>CYP729A13 old a

supercontig_17:2372264,2375246

GLHM_ORF_261_from_supercontig_17 32% to 88A4, 46% to 729A2

51% to 729A6 lotus

MEITAAWWVTWVLGFIPLMILILQWWNELRYVLPLKRVLASKNLKLPPGSMGFPFIGELL

TFLWYFKIVRRPDDFINSKRAKYGDGVGMYRTYLFGSPSIIAYSPAVTQFVFRSDNLFPY

RFPTNDLVGANSMLAATGEHHARVKSYVIAALAHTDSLKKIVLHVQPGIKASLHSWAEKG

IVTTFGVVKKMVFENIAQIFVGIEPGPLLDDIGRYYAGLVKGFRAQPFNIPGTTYYHAIQ

CRKKLMKIFKLELEKRKENKKLDGENKDLMDMLKQIKDEEGKKLSDEEVLDNIVSLFLGG

FDSTASVSAWAIYYLAKNPDVLQILREENMQLGAVEGELVTFDQVSQMKYTKKVVEETIR

MSNVSLIAFRSGDYDVEYEGYLLPKGWKVLQWIRYSHTNSEYFENPSYFNPDRWNQSTKP

EAYQAFGGGSMKCVGTELVHTQLAVFLHHLVLGYKWELINPNAKINYLPYPKPEDGGEIA

ITAI*

 

>CYP729A14 old b

upstream of 81F3 like seq 65% to GLHM_ORF_261_from_supercontig_17

43% to 729A2

upper part of GS_ORF_225_from_supercontig_17

supercontig_17:2375691..2386042

MTMEGYWWWVTWAIGGVPLAIWILWWWNELRYVLPLKLTNSALKHSKLPPGHMGFPFI

GEMLSFIWYYKIVSRPDDFIDAKRAK (2)

YGDGAGLYRTYLFGFPSILACTPAATKFVFHSHLLFPHR

FSTKELVGPNSMLAATGDYHARIKSHVTAGLVHTNSLKKFLLVAQPGMKASLESWAQMGT

IRSFDVVKK (0)

MVFENIAEFFVSIKPGPLLDELLGYYIDMFKGFKARPLKIPGTTYYHALQ (0)

CRKKVREIFKIELEKRKRDRKDGEYKDLIDALWQIKDGEGNVLSDEEVLDNISSLILGG

YESSSGVAAWAMIYLANNPDVLQKLR (0)

EENMEISKTLSEGELLTLDHVSKMVYTKK (0)

VFEESARLANTTGFLFRAGDQDVEYK (1)

GYLIPKGWKVIQWIRYAHESSEYFEDAMTFNPDRWD (0)

XXXXXXXXXXXXXXXXXXX

GTELVHTQLAVFLHHLVLGYK

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

 

>CYP729A15 old c

middle part of GS_ORF_225_from_supercontig_17

supercontig_17:2375691..2386042

MTMEGYWWWVTWVIGGLPLAIWILWRWNELRYVLPLKHTDS 

ALKHSKLPPGYMGFPFIGEMLSFIWYYKIVSRPDDFINAKRAK (2)

YGDRAGLYRTY

AFGFPSILVCTPAATKFVFHSHLLFPHR

FSTRELVGPNSLLAATGEYHARIKSHITSALVHTNSLKKFLLVAQPGMKVSLESWAQIGT

IRSFEVIKK (0)

MVFENIAECFVSIKPGPLLDELLGYYIDMFKGFKARPLKIPGTTYYHALQ

CRKKVREICKVELEKRKRDRKDGEYK

 

>CYP729A16 old e

45% to 729A2

GLHM_ORF_178_from_supercontig_6:1201961,1199251

GS_ORF_150_from_ supercontig_6:1183535..1213352 (- strand)

second gene 11300-14100 region this sequence

MEAWWVAGVLGAVPLMIWILWWWNELWHVLPLKRHLASKRAKLPPGHMGFPLIGELLTFI

WYFKILRRPDDFINSKRAK (2)

YGDGVGMYRTYLFRCPSIIACSPAVMKFFFHSNLFPYRLPT

NDLVGPNSMLAATGEHHARIKGYVSAAVAHTSSLRQIVLHVQPGIKASLRSWAEKGSVIA

FDVAKK (0)

MVFESIARVFVSIEPGPLLDEIGQYYALLLKGIKAQPFNIPGTTYYRGIQ (0)

CRRKLMEIFKLKLEKRKENQKRDQENKDLMDVLMQTKDGDGKQLSDEEVLDNIVSLFLGGFDST

SNVSGWAMYYLAKNPEILRRLR (0)

EENTELSSIKEGELITLDEISQMKYTKK (0)

VVDEAIRMANMTTLAFRSSDYDVEYE (1)

GYFIPKGWKVLIWIRYLHTNSEYFEDPMCFNPDRWN (0)

QSTKPEAYQVFGAGSMRCVGSKLAQTLLAVFLHHLVLGYE (2)

WELINPDSKITYLPQPKPDDGCKIAISRI*

 

>CYP729A17 old d v1

46% to 729A2

GS_ORF_150_from_ supercontig_6:1207471..1204675 (- strand)

First gene 5800-8700 region of this sequence

MEAWWLTGVLGVVPLMICILWWWNELWHVLPLKRHLASKRAKLPPGHMGFPLIGELLTFIWY

FKILRRPDDFINSKRTK (2)

YGDGVGMYRTYLFGSPSIIACSPAVTKFVFHSNLFPYRFPTN

DLVGPNSMLAASGEHHDRVKGYVSAAVAHTSSLRKIVLHIQPSIKTSLRSWADKGSVIAFDVVKK (0)

MVFESIARVFVSIEPGPFLDEIGQYYACLLKGFKAQPFNIPGTTYYRAVQ (0)

CRRKLMEIFRLKLEKRKENQKGDQENKDLMDVLMQIKDGDGKQLSDEEVLD

NIVTLFLGGFETTATVSAWAMYYLAKNPEILQRLR (0)

EENMELSSTKEGEFITLDEISQMKYTKK (0)

VVDETIRMANISCFIFRSGDYDVEYE (1)

GYLIPKGWRVLQWVRYPHANSEYFEDPMCFNPDRWN (0)

QSTKPEAYQAFGAGSMRCVGSKLAQTQLAVFLHHLVMGYK (2)

WELINPDSKITYLPHPKPNDGCKIVISRSNCLE*

 

>CYP729A17 old d v2 duplicate

supercontig_1243:8020,9357

100% to 729d

YGDGVGMYRTYLFGSPSIIACSPAVTKFVFHSNLFPYRFPTNDLVGPNSMLAASG

EHHDRVKGYVSAAVAHTSSLRKIVLHIQPSIKTSLRSWADKGSVIAFDVVKK

MVFESIARVFVSIEPGPFLDEIGQYYACLLKGFKAQPFNIPGTTYYRAVQ

8020 CRRKLMEIFRLKLEKRKENQKGDQENKDLMDVLMQIKDGDGKQLSDEEVLDNIVTLFL 8193

8194 GGFETTATVSAWAMYYLAKNPEILQRLR 8277

EENMELSSTKEGEFITLDEISQMKYTKK

VVDETIRMANVSCFIFRSGDYDVEYE

9021 GYLIPKGWRVLQWVRYPHANSEYFEDPMCFNPDRWN 9125

QSTKPEAYQAFGAGSMRCVGSKLAQTQLAVFLHHLVMGYK  9357

WELINPDSKITYLPHPKPNDGC

 

>CYP733A1

GLHM_ORF_251_from_supercontig_21 CYP733A like

supercontig_21:1759577..1762425

68% to 733A1

MELISFLLIVGFLLVSLVSVLLILQSWSSTRKA

MERIPGSLGWPIVGESFSFLAEFSSPSGIYNFMSQRQRKYGKIFKSYVLGRYTVFMTGRE

ASKILLTGKDGLVSLNLFYTGKQVLGPTSLLQTTGEPHKRLRRLIAEPLSIDGLKKYFDF

INRLAIDTLDHWSGRTVLALEEASTFTLKVIGNMIMSLEPTGEEQEKFRANFKLISSSFA

SLPFKFPGTAFYRGIEARDRMYAMLDSVISRRRNGEDFQQDFLESLIMKHSRGANINGED

NEDKLTDEQLKDNILTLLVAGHDTTTAALTWLIKFVEENPSVLEKLREEHLEIQSNRKDG

GSLTWAEVNNMPYTAKVISETLRRATILPWFSRKAVQDFEMD (1)

GCKIKKGWSVNLDVVSIHHDPEVFPDPEKFEPSRFD (0)

APVKPFSFLGFGSGPRMCPGINLAKIEISIFIHHLVCRYK (2)

WRPLSKDDTIHPTLVRMPKSKYPIVVDPL*

 

>CYP734A13 AM443674.1 Vitis vinifera 75% to Pisum

       MFSAMEEVW

40077  YWFKLLVICFMALVFVLKVVVLLWWRPRKIEHHFSKQGIRGPPYRFFIGNVKELVGLMLK  39898

39897  ASSQPMPFSHNILPRVLSFYHHWKKIY  39817

39036  GATFLVWFGPTVRLTISDPDLIREIFASKSEFYEKNEAHPL  38914

38909  KQLETVSGLLSLKGEKWAHHRKIITPTLHMENLK

       LMVPVMAKSVTEMLEKWMAMSKSGEVEIEVSEWYQTLTE  38559

38558  DVITRMAFGSSYEDGKAIFQLQAQQMVMAAEAFQKVFIPGYR

       FLPTKRNMNSWKLDKEIKKSLVKLIDRRKENRWKEN  38211

38210  PEKCPKDLLGLMIEETVKKGEMSWCPSSKITVQDIVEECKSFFFAGKQTTSNLLTWT  38040

38039  TVLLAMHPQWQVRARDEV  37986

FRVCGARDTPTKDDVVKLKT

LSMILNESLRLYPPIIAAIRRAKTDVELGGYKIPRGMELLIPILAVHHDXLIWGNDANEF

NPARFAEGVARAAKHPVAFIPFGLGVRTCIGQNLAILQAKLALAIILQRFSFTLAPSYQH

APTVLMLLYPQYGAPITFRTLSTPDQGS*

 

>CYP734A14

76% to CYP734 Arab., 79% to Vitis vinifera, 84% to Pisum AB218764               

GLHM_ORF_84_from_supercontig_75:626304,629239

with a seq. Gap near C-term

MEDDHRVLLCYWFKLVIISLVVVFFVLKVVLVLWWRPRKIEDHFSKQGIRGPPYHFFIGN

VKELVGMMLKASSQPMPNSSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPDLI

REIFTSKSEFYEKNEAPPLVRQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLVPVVA

TSVVDMLEKWSSAMSTSGEVEIEVSEWFQTLTEDVITRTAFGSSYEDGKAIFRLQAQQME

LAAEAFQKVFIPGYR (2)

RFFPTRRNIKSWKLDKEIKKSLMKLIDRRKENRGGGNSVTVKKPEGGGPKDLLGLMIDAS

NSSPNITVNDIVEECKSFFFAGKQTTSNLLTWTTVLLAMHPQWQVRAREEVL

 

TLAVILQRLSFRLAPSYQHAPTVLMLLYPQYGAPVIFQNLPDHSTLQDPLT*

 

>CYP735A11

70% to 735A1

supercontig_2226:684,3661   with seq gap after VPRL

MVVVTALLVVFISLFLRVAYDTVSCYWLN

PRRIMKMMEKQGVRGPKARPLTGNILDMASLVSQATSKDMDSI

HHDIVPRLXXXXXXXXXXX

GKRFIYWNGTEPRMCLTEIELIKELLSKYSTSSGKSWLQQQGSKHFIGRGLLM

ANGEDWYHQRHIIAPAFTGDKLK  (0)

SYAGHMVECTKQMLQSLQNAVESGQTEFEIGGYMTRLTADIISRTEFDCSYEKGKQIFDLLTVL

QRLCAQASRHLCFPGSR

FFPSKYNREIKSLKMEVETLLMEIIQSRKACVEIGRSNSHGNDLLGMLLNEMQKKRSGN

GFSLNLQLIMDECKTFFFAGHETTALLLTWTVMLLASNPDWQDKVRAEVLQFCNGGTPS

DHLPKLTL

LNMVINESLRLYPPATVLPRMAFEDIKLGDLLIPKGLSIWIPVLAIHHNKELWGKDANEF

NPERFASRTFAANRHFIPFAAGPRNCIGQSFAMMEAKIILAMLISRFSFEISDNYKHAPV

IVLTIKPKYGVQICLKPLN*

 

>CYP736A14 old b

supercontig_21:2174006,2175898

GLHM_ORF_288_from_supercontig_21 40% TO 84A1, 56% to 736A1

65% to GS_ORF_225_from_supercontig_21

MSPSTLAAILCIFLTLIYSFHRWRNGRKLPPGPRGLPIIGNLHMMGKLPHRTLTDLAKTY

GPIMSLNLGNVPSIVVSSPKAAELFLKTHDTVFASRPKTQVAALMTDGKGIAFTEYGPYW

RNARKLCTLQLLSALKVESFGPMRRREVGLMVESLKEAAEEKKVVNISRKVGELMENMTY

KMVLGRDKDDRFDLKGLVHEIMILIGTVNIADFMPALAPFDLQSLILPIMQGLSRKVKAI

NKIVDEVFNKIIDEHEQNRSKDMKKQDMDFVDMMLSLAEEQAKTTNMNLQTEHAYKIDRT

NIKALLLDMIAGAFDTSTTTIEWTLSELLRHPKIMMHVQEELDNVVGKERMVEETDLSKL

NYLDMVIKESFRLHPVASLILHESMEEITIQGYYIPRKARILVNLWAMGRDPEVWSDVEE

FKPERFVGEDDVDIRGHNFKLIPFGAGRRGCPGIQLGLTSVRLIVARLVHCFNWELPFGM

GPNELDMNEQFGLTLPRAKHLIANPTYRLLC*

 

>CYP736A15 old a

GS_ORF_225_from_supercontig_21 58% to 736A1 Pyrus

supercontig_21:2164321..2168365

MCPSTLAAVAIFLILLASLCSLLRHPKHIKQDQNLPPGPRPLPIIGNLHTLAAGKKLPHR

TLANLAKAYGPLMSIRLGLVPCVVVSSPETAELVLKTHDTVFASRPRVRTTEIISDGKGV

TFAEYGAYWRNARKLCTLQLLSASKVEMFGGMRRVEVRKMVELVKEEAAEKKVVDVSEKV

GEVGEKMTFRMVLGRDKDDRFDLKGIIHEIMALAGALNIADFLPVLAPFDLQGLRGRSKA

ISKRIEEALDKIIGEHEENKSIKRKEKMDFIDVMLSLLDNQNDDEQQQSYKMYKANMKAI

LLDMIAGAFDTSKTIIEWCLSELLRHPKTMSRLQKELDNIVGKQRMVEETDLNKLTYLDM

VIKESFRLHPVGALLLHESMEDIIINGYYIPKKSRVMINVWAIGRDPMVWSDNAEEFIPE

RFARSEGVDLRGHDFRLLPFGSGRRGCPGMQLGLTNVQLIIAQLVHCFNWELPDGMLPKD

LDMTEQMNLVLHRANHLFAKPTYRLLC*

 

>CYP736A16 old c

54% to Pyrus CYP736A1

supercontig_86:515675,517290

GLHM_ORF_51_from_supercontig_86

MDWIWSLFSFLALSIFLIKSFKCRRSKRLPPGPTGLPILGNLHMLGHQPHRDLQTLAKKY

GSIMYLRLGLIPTIVVSSPQAAELFLKTYDIVFASRPSHQAAMHMSYGQKNISFSPYGPY

WRSIRKMCTLELLSNVKINSFKELRKEELGNLIRQIRQVAATSSRAVVDLSAEVSAFAAD

LTCRMVFGKKYIDKDIDERGFKAVIQEAMEIAATFNLSDYIPPIAKLDLQGVAKRSKAIS

RVFDEFFEKIIDEHVQSQDQNKTKDFVDFMLDVMGSEQADYPIERENIKAVILL (0)

DMLAGATDTSSTAIEWTLSELMKHPRTLNKVQKELENVVGMNRMVEESDID

SLEYLYLVVKETMRLHPVAPLLLPHASMEDCIVNEFHIPKNSRILINMWAIGRDQDAWID

AEKFWPERFVGSNIDVRGRDFQLLPFGSGRRGCPGMQLGLTIVRLVVAQLVHCFDWDLPD

GKMPSELDMTEKFSLVTPRANNLCAIPSFRLKI*