22 Paramecium tetrauralia P450 sequences (A free-living alveolate). 

 

>CYP688A1 CYPA

MDNIYQFQLIMMLLWVPLILSFPLLWIILYPLCICYFYKFKYGNKVYVLYF

PFLGQFKYRMDGLKFQKDVIYFKRNIAYNHPEVELIXTHIFSRPYFIFIKPE

NVKQMLYNYANHKKRTDEIFRD

IIACKGLVYAEGQEWKDQKREISNFFTFEQLSSKIPVIKTLIQDTLQYKENQRVNIIKQC

ARISLRAMQICFFNQMKDEQINGQHLSEEFQDLSRYFLYVNRKYLIRLHMVVQYIS

RSFFGIKSLSTMKSYFMTANEKKFLQRVYVVRNYINNLINNHQKGSEKDVFSILLREPLTEEVR

EQIIHQYVTFVFAGMDTT

SHSAGLSIYMLGKHPQIQQRLREELTKINFDEIDQKLINPLPLLNAFLNE

CLRTQTPSDGIIPRLAVKDHYVGQYLIKKDWYVDVGLQPMMTHPQYFHNHLEFNIERWLN

QSEPEAFLPLSYGPRNCLGQHLARIEIKLTLIYIIKTYKVILDDQTDLVMDYTFLYAPSD

DRLVKFIRI*

FN0AA114CH06SP1

FN0AA133DH07SP1

FN0AA179CF11LM1.SCF

FN0AA211BA12LP1

FN0AA303AA02SP1

FN0AA309DE05LP1

FN0AA331AE02SP1

FN0AA336BH11LP1

FN0AA372AF05SP1

FN0AC111DB10GGM1.SCF

FN0AC28CB05GGM1.SCF

FN0AC80BG04RRM1.SCF

FN0AD83CD12GGM1.SCF

 

>CYP688A1-like N-term frag 73% only seq of its kind, probably = CYP688A1

poor quality sequence

NIYQFQLIIILFFFPLILSFPFLSIILYPLSISYFYKFNYXNKLYILYFPFLXQLKYR

FN0AA378BE01SP1

 

>CYP689A1 CYPE similar to CYP3

MFQFTILEIILYLVLLLVLLILKPLFLMLIM

KIKYGKKMHLMYFPLLGRIIEFSRGIKKHNDLLHFEKMIPQQHPGVEIVVSNTFLGLTHV

FFKTEHIKFILNNQDLYKKTSKVLFGEKMLYK ()

GLAFQDGEDWRLARNVLAKSFEFEQLRARIPLIKRLCEEKFSKVPEDEPIDIINISGNIV

GEVITQSFFSQSFKDLNGKTFLSELVDVMVGIISQYREAPIRSMSRT

FIFGTKDYPNWTISKVEQRLLARLQKVKDILSDSIKERQSMENKPADFLTAYINTI (1)

QQNPKLTEEHAIQQYIMLIFAGIDTTSNLFGACCYALSIHPEWQIKLREEVQKQYSTYEQLN

SDNINVSNQITNFINECMRMYTPVPYFIEREVKQDHKVGDYFLKKNSEVSLCLFPNNYDS

KNYKDPFTFNPDRWNQQGIDPFVFLPFSIGKRNCIGQHMALMELKCLLVYLLMNFEVNS

VGEKQVWTFKFVYTIQNEKFIKLKRIGK* 190

FN0AC26CE07RRM1.SCF

FN0AA321CC12SP1

FN0AA275CD02LP1

FN0AC144BB09GGM1.SCF

FN0AD88BC04GGM1.SCF

FN0AC79AD09GGM1.SCF

FN0AC140DH06GGM1.SCF

FN0AC97DC02RRM1.SCF

FN0AA203CH05SP1

FN0AC238BC12GGM1.SCF

FN0AC123BF12GGM1.SCF

FN0AC103BH08GGM1.SCF

FN0AD230CH07GGM1.SCF

FN0AA180BB07LM1.SCF

FN0AD225CB03RRM1.SCF

FN0AD6AB09GGP1

FN0AC5DA09RRM1.SCF

 

>CYP690A1 CYPF + CYPT 86% to CYPB

MNLLILSYLGYLILALIAXFVIAPIPKLLYYKIKYGSAVEIYYFPFIGLIGQILIDLVFRSDVFYSQK

RLVLKNNKVKLHISNDLKGGVHFTLIDPKLKKLVFFDQESYKKMEGMPFADTFADQGLLF

QNGKSWHKSRQMLTKHFTNQDLLVMVETLKQECKKLQLKDGPIDILTVLKQLTSTTITKT

FFGSENNEIADLGVQVNKNMEKIMLFLLNPLIVLRCFALKLNKSTTPSFLLS

SGEKAFLRELQAQKQRIISEIEQGIKKIKENQTLQDNILTTMCKEIINNNITKEEAVHQYFTLL

IAGIDTTSHIVKNFCYALGLHPEVQERLRKEINSHIQ*FDDLRPQQLSE

FKLLDNFINEAYRQYTAAPSLFNRIA

LKDIQLGEFTILKGQSMDLNMMMSHFDPSIFENPLKFDIDRWNSPVLDPYS

FTPFSAGPRNCIGQHLATLELKTLLIFLIMNFNLELNNGKIQLGLSNLYGPTRRDFLVLKNINKQL*

FN0AD191AA01RRM1.SCF

FN0AA9DG10LP1

FN0AA168CC04LP1

FN0AA14AH02SP1

FN0AA14BF03SP1

FN0AD262DA10RRM1.SCF

FN0AA249DB11SP1

FN0AD200BH03GGM1.SCF 3 diifs

FN0AA217AC03SM1.SCF  86% to CYPB

FN0AD109CE02GGM1.SCF

FN0AD161DD10RRM1.SCF

FN0AA9DG10SP1

FN0AC1DE07GGM1.SCF

 

>CYP690A2 CYPB A second possible intact P450 of Paramecium 27% identical to CYPA

MNLIILSYLGYAILALIAYLVIAPIP

KLLYYKIKFGSAVDIYYFPIIGLIGQIIIDLIFRKDAFYSQKRYVLKNNKLKLHISNDLK

GGVHFSLVDPKLKKLVFFDQESFKKMEGMPFAD

TFMDQGLLFQNGKSWHTSRQMLTKHFT

YQDLLVMVETLKQECKKLQLQDGPIDILTLLKQLTSTTITKAFFGSENNDVSDLGVEVN

KNMEKMMLFFLNPLIVLRCFALKLNKTTTPSFLLSSGEKAFLRELQAQKQRISSQIDNGI

KKIKENQTLQDNILTTMCKEIINNNITKEEAIHQYFTLLIAGIDSTSHVVKNFCYALGLYP

EVQERLRKEIQSQVQQFDDLRPQQLSQFKLLDNFINESYRHYTAVPSLFNRVALKDIQLG

EFTIQKGQSMDLNMMMSHFDPSIFENPLKFDIDRWNSPLLDPYSFNPFSAGPRNCIGQHL

ATLEMKTLLVYLILNYKLELNSGKIILGLANMYGPTRRDFLVLKNINKQL*

FN0AA259BE02SP1

FN0AA276AB05LP1

FN0AA63BA02LM1.SCF

FN0AA91AG05LP1

FN0AC133DE08RRM1.SCF

FN0AC15AF02RRM1.SCF

FN0AC170BC07RRM1.SCF

FN0AC43AA02GGM1.SCF

FN0AC79AD06GGM1.SCF

FN0AC95BC11RRM1.SCF

FN0AD118BH02GGM1.SCF

FN0AD207DE01GGM1.SCF

FN0AD237CG08GGM1.SCF

 

>CYP691A1 CYPG 84% to CYPC

MIYIILGILALIYFITQPLIVVIYFKIKYGKRVIIQYAPMLGLLRTLSQSRAINGDAFQALSVL

IKNNRQADILVTNLLFRPLIVFLKPNYYKIFMQQHEAYTKFPMIVDKRLVSKGMLMEGGAKWKQQ

RKLLGAHFEYNKLINLIPMINDVAEKKLSGLPNSIFPAMNLASSITGEVVLRAFFGEDIA

KLSLNGQDPSLCVTQLITRFGQLITESRFFQIKRALLEEKVFSLFPRKIEKDLFE

LNTVMLDHMKKAIKGRMEKLKNCKDFVHQDYLDVYLDAYLNKNDQMDPPITEDEILQQ

SITLYFAGTETTANLVTTACYFLAENPHLQQEIYQEILEILNGESIITAKHLQNLQ

KVTGFLMECLRLKPVAPMLISKKALQDVYIMDIFIKK (1?)

GWYVNYMVLSNAQNQNYFPNPKQIDITRWKSDGTLKDSTIDPFAFVPFSAGGRNCIGQ

YLALIESKIVISKILMKYKLKLNEKLIKTEWIAKITYGLSNQDYITWEAR

FN0AA365AD08SP1 

FN0AD146BA04GGM1.SCF

FN0AD156BA09RRM1.SCF

FN0AC120DC02RRM1.SCF

FN0AA229DA03LP1

FN0AC116AE02RRM1.SCF

FN0AC167AG03GGM1.SCF

FN0AD220DC04RRM1.SCF

FN0AA46DH08LM1.SCF

FN0AA47CA09LM1.SCF

FN0AC156AE04GGM1.SCF

FN0AA68AG08LM1.SCF

 

>CYP691A2 CYPC

MIYIIFGILALSYLITQPLLVVIYFKIRYGKRVIIQYAPMLGLLRTLSQSRAI

NGDAFEALSKRIGDNRQADILVTGLLFRPMIVFLKPKYYRIFMQQHQDYTKFP

MIVDKRLMTKGMIMEGGAKWLQQRRLLGTHFEYNKLINLIPMINDVAQRKLANLPNEVFP

AMNLASSITGEIVLKAFFGEDIAQLSLNGQDPSQCVTQLITRFGQLTTESRFFQIKRALLEEKV

FSLFPRKIEQDLYELNTVMLDHMKKAIKNRMEKLKNCKNIEHQDYLDVYLDVYLNK

NDSMDPPITEDEILQQSITLYFAGTETTANLVTTACYFLAENQLLQEEIYQEILEVLNGE

LIITAKHLQNLQRVAGFLMECLRLKPVAPMLISKQALKDLYIKDIFIKK (1)

GWYVNYMVLSNAQDQKYFSNPTQIDITRWKADGTLKDSTIDPFAFVPFSAGGRNCIGQYLAI

IESKIVISKILLNYKLXLNQKIAKAEWIAKFTYGLSNQDYITWEAR*

FN0AA368AF02SP1

FN0AA278AD11SP1

FN0AD78CC01GGM1.SCF

FN0AD108DA12GGM1.SCF

FN0AA219CB03LM1.SCF

FN0AD193DH08RRM1.SCF

FN0AC87CA07RRM1.SCF

FN0AD217AH01GGM1.SCF

FN0AD22CA02FFP1

FN0AA226AA08SP1

FN0AA211CF03LP1

FN0AD164DE09RRM1.SCF

 

>CYP692A1 CYPW 42% TO CYPR ONLY 27BP BETWEEN GENES CYPR AND CYPW

MLLYIFIGLLILFIYFTCLRTYIKLILLK

LTLGNKAIIRFYPLTGDFAQIPKSNRIYGDGLKHFQKRVFDNPNVKFVLSNLMHE

PLIEIYDPEYYKEVFINHELYQRADVLYHE (2)

KFTSRGILYSEGQ

RFRQQRQILGNHFTYDKLKERMPKVNQVVIEKIKNQDINQLHQFLVDLTTEIVMRSFFGS

EALEFKLNGQSVPAEILELDEEMAAQNLFNPYVVLK

RLIFGRKGDKILPSPAQKHLNDRVDRLIDFIISQINKK

LSNQQNKGDYFLDIYVDAYLKQEKEFQIEILEICSMFITMFAAGSGT

SVALTMTLYFLGLEQEAQQEIRQQIVQV

LNGQTEVLDIHLQQLTKLTAFIQEMFRFKAPLFAPFIRKAKKTHYIKNLKIEKGTNVLVL

FAAPGWSNKHYDNPEKFDYKRWLNANPIKEDNGFVYMPFSAGMRNCIGQHMAQLNMKIIL

SHILMNYKITLDPKQQVRFPINFQIDVEPGNIIQFERIK*

FN0AC35DF03RRM1.SCF

FN0AD148DA07RRM1.SCF

FN0AC14BG01RRM1.SCF

FN0AC2AF11RRM1.SCF

FN0AA149CC07SP1

FN0AD190BG11RRM1.SCF HAS END OF CYPR and start of CYPW

FN0AA172AA12SP1 HAS END OF CYPR and start of CYPW

FN0AD55CE11RRM1.SCF

 

>CYP692B1 CYPR 36% to CYPH

MICYFCLAGLAI

FLYVFVIHIFVKLMLLKLKHGKDVYISFIPLFGDYFFLQQSFKKYGXATEIFKQRCQKNP

NIKFVASNILNKIFLFVHDPEYYKQVLVNHENYTKVEILYHP (2)  

KLSSTSILFGEPQKVKQQRSLLGEAFTFEKLKQRTPIINQVLLEKLQKEDKTNVLDF

LTKTSSEIIIKXFFCKELQEIIVQGNDITTEMIDLITQLGDMQMNDLYVSIKLALLGRRS

FGLFPSKNEKQLDARIDRLIDGTLMPIIKNKIANYXPNQNSDFLDIYIHAYLNQKPNEPK

ITELELCXLFVSIVSAGTDTTSHQIAITLYYLGVERQAQEEIRQEILNVVGNEVDIQPQH

LGKLVLLNAFIQEAFRIKNTVIQPLTRIAKETHYIKNLKVEK (1)

GTYVAALTTAPSWNDKYFDDPNKFDYKRWLS

QRPIKEDNGYVFVPFSAGGRNCIGQHMAMMTMKIMIGQILRQYDVVVDPSVKVTFPLVLF

IQYSPQNLVQLKKRKE*

FN0AA136DB09LP1

FN0AA248AD09LP1

FN0AA44BC09SM1.SCF

FN0AD190BG11RRM1.SCF HAS END OF CYPR and start of CYPW

FN0AD210DF06GGM1.SCF

FN0AD45BD04GGM1.SCF

 

>CYP692B2P pseudogene of CYPR 50% identical

YFKKLSSTSIFFGEPQKVKQQRNLIVKTFGIEKLK (fs)

LKSRIPVINQ (fs)

VFEKLEQEDKSNVLKFLKKSSEIIIKLK (fs) no fs in FN0AA118AB07LP1

LQYIITTEIMIDLISFCNIVLR

MKMNKFYVNIKLAYFGVREFG

XXXXXXXXXXXXXXXXXXXX

YMDISLDDHSKQQKEFQVLIFKICFIFITMFAAGS

SKSDIVLTMALYLLGSEKEAQQEIRKQILLVFNGQTEELE

IHLQQLTAFIKEIFRFKAPLFAPFIRAAKKTHY

FN0AA118AB07LP1

FN0AA212AG01LP1

FN0AA299DF01SP1

FN0AA333DD12SP1

FN0AA275CB01LP1

FN0AA135BF02LP1

FN0AD230DF10GGM1.SCF

FN0AA106CB12LM1.SCF

FN0AA106DB02LM1.SCF

 

>CYP693A1 CYPP 60% TO CYPD

MLNWILLLISVVAVYLLVNPLVTMMKLKMQFG

NAVYCKYFPIFGIIQVYRKSFKLTGNVHQWIMDIVAKHPEVKFVVANSINKPVIFIIDPE

YYKQIYLDHHLVTKHDQSGIKD (2)

FLLSGGLLFTEGPKWKQQRNLVGDHFLFQKLKARIPMINQVV

KEKINGMPVAEKMFEFICTITGEVVIRSFFGVEAEGWKINGKEA

QIELGSIFAAFIKLRVTNFFVYFKQKILGVKSWQYXFKKEKEIMDRVTKIKQDIREVIFK

RRDKIKQQGNYQGSGDFLDVYLKIFMEQNVYSSDRIETDEIVSQFITLFLAGTDTTGALV

ANSLLFISENKQYLQELRNEVNNVIGNGEITPENINQLVFVESFLKEVMRLKP

SVVYPIARKAKQNLQIKDLHIKEGTILLLGNFLANLNSQNYDNPLEFNPRRWLQQ

QPIKQDNGFINIPFAAGGRNCIGQHMAMIEARIILAYLIRNYDIVRNPQVPKVQWPSRGT

QTYIPDNAVHLVKI*

FN0AA148AF10LP1

FN0AA163BH04LP1

FN0AA208DA02LM1.SCF

FN0AA213AH11LP1

FN0AA299BG12SP1

FN0AA35DF05SP1

FN0AA370CH11LP1

FN0AA49CH09LM1.SCF

FN0AC101AH03RRM1.SCF

FN0AC122AC07RRM1.SCF

FN0AC243AD01GGM1.SCF

FN0AC81CD11RRM1.SCF

FN0AD153AA03GGM1.SCF

FN0AD160AB12GGM1.SCF

FN0AD167BG09GGM1.SCF

FN0AD97AC04GGM1.SCF

 

>CYP693A2 CYPD + CYPS 59% TO CYPP

MIYKLMFLYFFLFLALIGTYLILRPLLIMIKLKVQFGKQVYF

YYIPILGVIQIYRSSAKKGNPQQWVIDIITKHPEVKLIVSNSVTKPVFIIVDPEYYKPLY

LDHHLLVKHDQSGIKEYIVILNISFLLSKGLLFAEGEKWKEQRSLLGDHFLFEKLKERIP

MMNQVTRDAINNKQTVDQVFQYICSITGGVVIRSFFGQEAEGWLINDKPAQIELGEILKS

FVLVRFSNFFIYFQIK

LLGMKSWDYCLKAEKEILTRVIKFKQDLNQIISKRKSKIEKEGRKWENGDFLDVYLNKLS

KSKDTQESYQYETEDIISQFITLFLAGTETTGALVSNSLLFLSENTSYLEELRNEAKSALVD

GQVTADSLKKLVQLECFLKEVMRLKPSVVHPIVRQPKSDIQIKDLFIKKGSYILLGSFLA

NINSNHYEKPLEFNPKRWLQSKPIQIDNGFVNIPFAAGGRNCIGQHMAMIEARIILAHVI

LNYDVIKNPELTKVNWLSRGIQTYLPDDAIRLKKLE*

FN0AA250BA01LP1

FN0AA375CB03LP1

FN0AC149CD12RRM1.SCF

FN0AD131DA09GGM1.SCF

FN0AD171AF02RRM1.SCF

FN0AA82DA05LP1

FN0AD268DG03RRM1.SCF

FN0AD135BF01GGM1.SCF

FN0AA162AH05SP1

FN0AD168AA12GGM1.SCF

FN0AD168AA12RRM1.SCF

FN0AD170DG10GGM1.SCF

 

>CYP694A1 CYPK 37% TO CYPH

MYIYIGIGVSLILLY

TLVIKPLISLLLIKIKFGKQAKIIFYPIVGDIMEIEGSFKKYNDHYESLRRY

FTENKDLKFILLNVFKTPLILIGDPEINKMIHQDHENYKKIDFLNNN (2)

SRLMGQGLLYQSGQKWKSQRKLLGKPFDYDKL

KARIPMMNQVVKQKLKNTYNNPLDLTRSIAGEVVIQTFFGQEAQDAQLNNREAQAEIV

ELFNDVAEAIYGSVYGFLKWMILGEKQW

KLFPNKLERDINRRIDELTQFARKVIDNRITSIKQEGFKK

NQDDFDFLDIHLQEFLGSKNESGITKDEIISQFITLFFAGTDTTSSVAAMCLFYLAQN

PDVYDALIKELENVVGDGDGDVLDQHLPKLQELNSFIWEVLRVRNPASGPLVRVAKQDL

VLKDLHIKKGWILMPANFVQQQTDKYFENFKEFDHKRFLKAQAIKEDNGYVNIPFSAGPRNCIGQ (0)

HMALMEIKIILCHILKTFKVITVPDKIKDLKWRAKFLYFYEPLDCI*

FN0AA186DA09SM1.SCF_1

FN0AA276CC07LP1

FN0AA355CC03LP1

FN0AA35CH10LP1

FN0AA370BB04SP1

FN0AA94BF01SP1

FN0AC107CH04GGM1.SCF

FN0AC139CD11RRM1.SCF

FN0AC61AC10RRM1.SCF

FN0AC80DG01RRM1.SCF

FN0AC83BH03RRM1.SCF

FN0AD106DA07RRM1.SCF

FN0AD113AE08RRM1.SCF

FN0AD129AG11GGM1.SCF

FN0AD141AD09GGM1.SCF

FN0AD212DB07RRM1.SCF 

FN0AD35CF09RRM1.SCF

FN0AD35CF09GGM1.SCF

 

>CYP694B1 CYPUa + CYPUb 45% to CYPH and CYPL

MIFYIIIIFVFYVLYRIVLKPLIPLLILKLQFGKEAYLWYAPIWGLLKYNFRS

LKQNGDFLDDLRKRMRENPQVKILLTNFLDTPFINFVDSEYIKKMYLEYQNFPKFNLLRYD (2)

NLIDKGLLMTEGEEWRFQRTLLGLAFTFEKLKSRIPMINQTVKERCILDPKT

NSFDFISWITGEVVIHSFFGEIAKGLTINGKPGQVEIVKLVADIMLQRFKNAYTQIKLMI

LGNKGWRILATKKEKDINNRVDTLRNTVKQLIETRIQQLKGETEARKEKDKDQCFLDIYLCELLKQ

QNEGSK KNIDFEPVLQQFLTLFFAGTDTT

ATMTVTCLVYLAKYPDVQNELLEEIKDLMQDSDVQDTHLPKLVKMNAFIN (0)

EVFRLKNPAFSPFVRLVQQDMQFL

XXXXXXGWMVVQXXXXXXLLNEHFSNPEVFDYKRWLTGQGAIQSDNGFVHIPFGAGGRNCI

GQHMAQMELKIILCHIIRKFQVSLNPDVQLKFGIRFLYGAEPDNCLIYKTRR*

FN0AA32DC07LP1

FN0AA341BD09SP1

FN0AA65AE09LM2.SCF

FN0AC124DB08GGM1.SCF

FN0AC168BG07GGM1.SCF

FN0AA154BF12SM1.SCF

FN0AC90DG12GGM1.SCF

 

>CYP694C1 CYPL 53% TO CYPH

MLSIYIALASLIIAIIYFLVLLPLIPLLKIKMQLGSKAALMFYPLSGLNKIFNDS

LAKERDLLKIINNQLKKNPQTVVILSNFIHKPVLVWTGAEYIKDIYLDHTSY

VKVDPFMVESIAQKGMVLSEGEAWKRQRKFLGTAFTFEKLTSRLPMINQVVEKV

SKSDPKTNLNQFTSRITGEVVIHSFFGDLAKGFQIEGKDAQIAIVEILSEIFLMPMNNPF

IQLKQMLFEYKSWSIFPTKKEKQLLKRISDFKQVIMAMIEKRIEQLKNQQIENQDKMVFL

DLYVTEYLKQQKENKQDMDAEEILHQFITLFFAGTDTTATTSGT

CLYYLAQFPEMQEEILKEVIEVVGEQGDIKEEHLNKLVRVNALIQEVLRLRNPAFSPVFR

TVRQDKQLLDVKMKKGWFSVAYHIGPGLLDKHFENAQEFDYKRWLNKGNVIKNDNGFIHI

PFAAGPRNCIGQHMAVMEVKMIVARLVRQYKITLNPEVKDITFGMKFLYCVEPDNCLLYE

ERNLQ*

FN0AA205CG06LM1.SCF

FN0AA218AF07LM1.SCF

FN0AA351DG09SP1

FN0AC61AE09RRM1.SCF

FN0AC66AA02RRM1.SCF 

FN0AC6AC12RRM1.SCF

FN0AD105DB01GGM1.SCF

FN0AD180AG09GGM1.SCF

FN0AD198AF04GGM1.SCF

FN0AD38CD04GGM1.SCF

 

>CYP694C2 CYPH 32% to CYPG

MWNIALVFLCLLIIATYIFIIRPLIPLLLLKAKLGDKAIFMFYPLFGFIGLFMKSI

KTKNDAMETVNAALRKNPKAKIILSNLLHKPCIMLTGSEYLKDALTEHQHYEKMNPFMID

SFIQTGLILSEGDRWKRQRMFLGQAFTFEKLKSRIQMMNQVVKEIVDKDP

KTNLNEFMSKITGEIVIKSXFGELAEGLRLEGKEAQVALIQLTTDINLIQFENPFVLI

KSLIFKERMWDVLPTKQEKDIVRRVNEVRTKVKEIISRRIEQLQENPIQDEDKMVFLDLY

VTEYIKQQKQQQQLINVNEILHQFITLFFAGTDTTATTCGTCLYYLAQYPEIQTEILEEI

QEVAGLDEIKEQHLNKLVKINALVQEVLRFKNPAFATIFRIVKNDMQLQDLKLKKGWAV

VEMLNASSVQENYFENATEFNYKRWLNTTNIIKNDNGFIYIPFSAGQRNCIGQHMAMMEAKV

IIALIVRKYQIILNPEVKQIKFGIKFLQCVEPDNCLLFEKRL*

FN0AA163BA11SP1 

FN0AC120AB05RRM1.SCF

FN0AA71AA01LM1.SCF

FN0AC29CH08RRM1.SCF

FN0AC142BD03GGM1.SCF

FN0AA5BA07LP1

FN0AD58CG07RRM1.SCF

FN0AC139CA11GGM1.SCF

FN0AA108BB06LM1.SCF

FN0AD80CB04RRM1.SCF

FN0AD111AF05GGM1.SCF

FN0AC63CE07GGM1.SCF

FN0AC181BB05RRM1.SCF

FN0AC120AB05RRM1.SCF

FN0AD3BB02FFP1

FN0AC125BG07RRM1.SCF

 

>CYP694C3 CYPM 61% TO CYPH 59% to CYPL

MEPILIAIFSLIMLMV

YFLIIKPLVPLLLLKLQLGDKAILMFYPIFGFLGVLTKSIQINNDLMHSINHALRKNPKA

KVILSNHLTKPFIMLTGSEYIKDSFLDHHDYEKMNPXMIPSFLQKGLVMSEGESWKRQRK

FLGTAFTFEKLKSRLPMMNKVIEYISENDDKSH

LNDFMARITGXXVIRSFFGELVEGFQLEGKDAQVALIQLTGEISIMQLQSAYYFI

KYLLFKDRMFEVFPCKKEKEILRRVENIRMKLNELILKRIQQLKENPVQDQEKMVFLDLY

VTEYLKQQKQNEQQIDLEEILHQFITLFFAGTDTTATTSGTCLYYLAKYPEIQSEILEEV

NQVVGNADINEDNLNXLTKVNALIQEVLRL

RNPAFVTLFRTVKRDKQVQDIKLKKGWALVQMQNASSIQDSHFDNATEFNYKRWFDKGNV

VKNDNGYINIPFAAGPRNCIGQHMALMEAKIIIALLVRKYKILLNPDVQEVRFGVKFLQTV

EPDNCLFFKKRIQ*

FN0AA10CE03LP1 PART IS INVERTED ON OPP STRAND

FN0AA10CE03SP1 PART IS INVERTED ON OPP STRAND

FN0AA126BB03LM1.SCF

FN0AA12CB12SP1

FN0AA186AF07LM1.SCF

FN0AD102BE05RRM1.SCF

FN0AD108AE03RRM1.SCF

FN0AD113AE04GGM1.SCF

FN0AD137BE12GGM1.SCF

FN0AD277DG09GGM1.SCF

 

>CYP694C4 CYPJ different gene 84% to CYPI

91  MQTLVMAFIIILLLALFFIIIQPLVPLLLLRVKLGDKAIMMFYPIFGFIGIFMRSIKTNQ 270

271 DVTKSINVALRNNPRAK

IILSNFLNKHCIMFAGTEYLRQSYQDHDDFEKLDPFMLPSFIQKGLVMSEG 474

ENWKRQRKFLAPAFTFEKLKSRLPMMN

QVVEDIAEKYYKTNLNDFMSRITGEIIVKSSFGKLGEGFQLEGKEAWVALTKLTGEISLI

MMDNLYAFVKSLLFGVKTWTILPTKQEKDVVRRVENVRIKLNELILNRVEQLKDSPVQDQ

DKMVFLDLYVTEYLKQKKQNEQQIDLEEILHQFITLFFAGTDSTATICGTCLYYLAKYPE

IQSEILEEVNEVIGNADINEDNLNKLIKVNALIQEVLRLRNPAFVTLFRTVKRDKQVQDI

KLKKGWALV

FN0AA216CA04SM1.SCF

FN0AA190CC10SM1.SCF

FN0AA190CH06SM1.SCF

FN0AA377AB02LP1

FN0AA377AB02SP1 very like CYP694C5 except in 1st 45aa

FN0AD130CC02GGM1.SCF

FN0AC117AF02RRM1.SCF 2 diffs to CYP694C5

FN0AD211DF09RRM1.SCF 3 diffs to CYP694C5

 

>CYP694C5 CYPI + CYPV 72% to CYPM 88% to CYPJ

MLTLFIAIVIVLSLALFFIFIQ

PLVPLLLLKLKLGNKAIIRFNPILGFI

GIFMRSIKTNQDVTKSINVALRNNPRAKIILSN

FLNKPCIMFAGTEYLKQSYQDHDDFEKLDPFMLPSFIQKGLVMSEGENWKRQRKFLAPAF

TFEKXKSRLPMMNQVVEDIAEKDDKTNLNDFMSRITGEIVVKGFFGKLAEGFQLEGKDAQ

IALTNLTGEISLIVMENLYSFVKSLLFGVKMWKILPSKQEKDLVRRVENVRIKLNDLILK

RIEQLKDNPVQDQDKMVFLDLYVTEYLKQQAQNEQQIDLE

EILHQFITLFFAGTDTTATVCGTCLYYLAKYPEIQSEILEEVNEVIGNADINEDNLNKLI

KVNALIQEVLRLXXXXFVXXFRXVKXDKQVQXIK

LKKGWALVQMQNASSIQDTHFDNATEFNYKRWLSKDSIIKNDNGYIHIPFTAGPR

NCIGQHMALMEAKIIIALLIRKYKILLNPAVQQIRFGIKFFQCVEPDNCVLFEKRI*

FN0AA133CH05SP1

FN0AC35BE02RRM1.SCF

FN0AD137BE12RRM1.SCF

FN0AA63DH11SM1.SCF

FN0AD277DG09RRM1.SCF

FN0AD211DF09GGM1.SCF

FN0AD162AE09GGM1.SCF

FN0AD162AE09RRM1.SCF

FN0AA190CH06LM1.SCF

FN0AA98DA04LP1

FN0AC155CA06RRM1.SCF

FN0AA322AH03LP1  presumed poor quality seq of CYPI = CYPIb

FN0AA314DB09SP1

FN0AC238DA05RRM1.SCF 3 diffs

FN0AA314DB09LP1

FN0AA63DH11LM1.SCF

FN0AD121BE03GGP1 3 diffs, might be CYPJ C-term

 

>CYP695A1 CYPX 37% to CYPN 35% to CYPK

MLFQILLILLGLLISWFVIK

PLVIMMKLKLQFGSTCKIQFGIFGILGLSSQSIIEKMKRKSIPKTVKFIVHNYASAVYIL

IIDPDYYQFMLNNHENYSQINDLNT (2)

SQLLDEGIMFQQGERWKQQRELLIQYFDIDKLKRNLPKLNEIIKQNFKQYDYQNDQIQT

TLLIIISDILIQSFFGQDANKLLINNKCIGLETTDLFEALSKLSRKPYSICKNILFGVQA

LKMFPSSEEQIIQTKINNIKFTIEKIIQKRIVQHELKLDEDENEISQMSEDI (fs?)

LIYIFEPIFKLKXXNNRMSFEEI

KQQYFTIFKIGSQTTNQIIQASLHYLAEQPQIQNELRQEILSICKTDIISYQE

LKSLVKLSAFLNEVLRFVNPIPIVRKVQTTHFIKDLKLKR (1)

NWVVMVDNSVT

NSSEKYYDNPKEFNYQRWLQSESIKENNNYVFIPFSNGPRNCVGQSLATMIYQIILINIL

RNFEVNVNEKSKNNKSITFVLQNSSFKLSPISQK*

FN0AD274BG04RRM1.SCF 44% to CYPN

FN0AA46AG10SM1.SCF

FN0AA9AE11SP1

FN0AA266AC10LP1

FN0AD142AG12RRM1.SCF

FN0AD49BC11RRM1.SCF

FN0AD113AF08GGM1.SCF

FN0AA334AB01LP1

FN0AD159BG08RRM1.SCF

 

>CYP696A1 CYPQ 47% TO CYPN

MIIYVLYAVLGLILYLFVMKPLTEMIKLKFQFGKECKICFTVFGKEIFDQLKETKENKNPRDIFNKQK

TAYNKYQYKFFVTNMLWIIRISIADPLYQKEALINHDLYQKVDPVCHN (2)

DLLSKGLVWSKGEQWKKQRKLLSSSFEFDALKKKVPMINEITQSKIEKFSNENV

LSSLQSITGLIVIKSFFGIQTDQIYI

NNTELQVEIANIMNEMAYMRFKSQIQSTKRLIFGTKAWKIFPTKEEKRLLQRVKDMRSIVGDLVQQRIKYFEDS

NNSKNNTINENFLNILVNEYLKITNKQQQEATFDQIIQEFITLQFAGTDTTAVLLHHCLY

FLASYPQAQDEIRGEVNRCCPSSFINENEINNLKRLSAFISEVLRLKNPAMRPIIRVATQ

DHKIKDLQIKK (1)

GWLVCIDYFLQNQSEKHFENAGQFDYTRWLQDS

PIKDDNNLIYIPFSAGPRNCIGSQMALL

EVKIILGQILKQYQITRNTNVEVSWEIHFNHQLSPTNAVILNKIK*

FN0AA177DF04SP1

FN0AA227DG02LP1

FN0AA231BF11LP1

FN0AA240BE12LP1

FN0AA346DG10SP1

FN0AA79DD07SP1

FN0AA87BF11SP1

FN0AC119BC04RRM1.SCF

FN0AC154AD07GGM1.SCF

FN0AD128BB05RRM1.SCF

FN0AD225AF01RRM1.SCF

 

>CYP696B1 CYPYa + CYPYb 47% to CYPN

MIIQIFAILIVLFFYVFVLKPLCPMIKLKMQFGQDCKMQYNFLGRDIWKRLRDLKI

FNDIFWSDKEEYKRLPYKFKVSNSFWKIQIQVADPEYYKQILHNPHYYEKANNXADK (2)

HLLQKGLVFETRDQWKAQRNILADQFQYQQLTSRLPMINKIILDGITKIGSANNLF

EQLELMTGKVVIQSPFGDSIDGLKVNNKDLQVEVTELINDMGESRFKSKYVFIKRLLLGT

WAWNIFPTQEEMMIQQRVFQLKTMIEKVIRKRLIELRQRNKQNDQKDLNLFLDILL

NDYIKNDHKKQESQAIDEVIQQFITLLFT

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

LKQLIKLSALINEALRLKNPAVNLLMRNSTQTHQVKDLTIQK (1)

NWRVIVNFQF

QLLSEKNFKNPEDFDYKRWLTPSPILNNNNFVYLPFSAGQRNCIGQHMALMEAKIILSQI

LKQYYIKPNMNVNPMWNLRFILQLQPGNCMKL

FN0AA281CB07LP1 

FN0AA367BD11SP1

FN0AD137AF02RRM1.SCF

FN0AD162AB07GGM1.SCF

FN0AA34CB12LP1

 

>CYP696C1 CYPN 37% TO CYPH

MIIHIILALFLLMFYLLVV

KPLVPMIKLKMQFGDACLMKYHLFGGELWEALKEMKTSKDLFKRHRDLYMNHPYKIFV

TNFLWKVRINVADPEYYKLMLTNHQYYSKFNNINH (2)

DNVIQNGLICQMGEK

WRAQRLLLSESFDYHQLKSRLPMINEVCLDKINSIHGENILEFLELITGQVVIRSFFGKSAD

GVQINKKKIQIEIADLLNELGEVRFKSKYLFVKRFFLGTKSWGFFPTNKEKELL

QRISEMRLAIEKLIQKRIVEIELKMDENEDEIKQRETDFLDV

LIKEYLKQKKQGTQKITIDEIIQQFITLFF

AGTDTTAVLSYHCLYYMAQYPEMQDEIREEVLTICKNESILDDKIKQLHKLSAFINEVLR

FKNPALRLMMRFCNQTHQVKDLTIQK (1)

GWSVTIDYQFPQWLPKHFPNPEKFD

YKRWLEKEPIKENHQFVYLPFSSGPRNCIGQHMALMEAKIILSQILRQYSIEINHD

VDSRWTARFLYQLQPGNCVKLQKR*

FN0AA12DB07LP1

FN0AA214BD08SM1.SCF

FN0AA22BD12LP1

FN0AA238BG12LP1

FN0AA241AH11SP1

FN0AA28AG05SP1

FN0AA30DF10SP1

FN0AC45CB03RRM1.SCF

FN0AC153DH12GGM1.SCF

FN0AC75CH09RRM1.SCF

FN0AC84DH09RRM1.SCF

FN0AD102CF03GGM1.SCF

FN0AD139BF07RRM1.SCF

FN0AD233BB09GGM1.SCF

FN0AD236DE03RRM1.SCF