Pig Cytochrome P450s

 

 

Compiled by D. Nelson June 21, 2007

59 different genes. Some are not found yet.

(CYP2F, CYP2G, CYP2T, CYP2U1, CYP2W1, CYP2AB1, CYP2AC1)

 

 

>CYP1A1 pig AB052254

MFSVFGLPIPISATELLLASAIFCLVFWVVRTWQPQVPKGLKSP

PGPWGWPLLGHVLTLGKSPHLALARLSQRYGDVLQIRIGCTPVLVLSGLDTIRQALVR

QGDDFKGRPDLYSFTLISNGQSMTFNPDSGPVWAARRRLAQKALNTFSIASDPASSSS

CYLEDHVSKEAECLLGKFQELMAGPGHFDPYKYVLVSVANVICAICFGQRYDHDNPEL

LSLINLSNEFGEVTAAGNPADFIPILRYLPNTSLDLFKDLNQKFYIFMQKMVREHYKI

FEKGRIRDITDSLIEHCQDKRMDENANIQLSDEKIVNIVIDLFGAGFDTVTTAISWSL

MYLVTNPSIQRKIQEELDTVIGQARRPRLSDRPQLPYMEAFILELFRHTSFVPFTIPH

STTRDTSLNGFYIPKGRCVFVNQWQINHDQKLWDDPSVFRPERFLTADGTINKALGEK

VILFGLGKRKCIGETIARLEVFLFLAILLQQVEFRVTPGVKVDMTPIYGLTMKHAHCE

HVQMHVRS

 

>CYP1A2 86% to 1A2hum, 75% to 1A1hum  CB483208.1

189 KLWGDPSEFRPERFLTADGTAIHKTMSEEVILFGMGKRRCIGEVLAKWEVFLFLAILLQQ 368

369 LEFSVPP 389

 

>CYP1B1 BP156940, BX674206 lower case = cow seq

MATSLSLYDHLLPIPLSVQQTTLLLLLSVLAAVHVGQWLLRQRRRQPGSAPPGPFAWPLI

GNAASMGPAPHLSFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQSVAFADRPPF

ASFRVVSGGRSLAFGQYSESWKAQRRAAHSTMRAFTTRQPRGCRVLERHVVGEARELVSL

LVCGSAGGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDAEFRELLSHNEEFGRTVGAGSL

VDVLPWLQRFPNPVRTTFREFEQLN

RNFSNFVLDKFLRHRESLRPGAAPRDMMDAFILSAGKEAAAGSGDAGARPDVE

YVPATVTDIFGASQDTLSTALQWLLILFIRYPEVQARVQAELDQVVGRDRLPCLEDQPHL

PYVMAFLYEAMRFSSFVPVTIPHATLANASWL

gyhipkdtvvfvnqwsvnhdpvkwsnpedfdptrfldkdglinkdltgsvmvfsvgkr

rcigeeiskmqlflfisilahqcnfkanpdepskmdfnygltikpksfkinvtlresmel

ldsavqklqvekecq*

 

>CYP1D1P not found in EST or nr

 

>CYP2A19 pig  AB052255

MLASGLLLVALLTCLTIMVLMSVWRQRKLQGKLPPGPTPLPFIG

NYLQLNTEQMYNSLMKISQRYGPVFTVHLGPRRIVVLCGYDAVKEALVDQAEEFSGRG

EQATFDWLFKGYGVAFSNGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGYLIEAF

RGTRGAFIDPTYFLSRTVSNVISSIVFGDRFDYEDKEFLALLRMMLGSFQFTATSTGQ

LYEMFYSVMKHLPGPQQQAFKDLQGLEDFIARKVEHNQRTLDPNSPRDFIDSFLIRMQ

EEKKNPDTEFYWKNLVLTTLNLFFAGTETVSTTMRYGFLLLMKHPDVEAKVHEEIDRV

IGRNRQAKFEDRAKMPYTEAVIHEIQRFGDMIPMGLARRVTKDTKFRDFLLPKGTEVF

PMLGSVLRDPKFFSNPRGFNPQHFLDENGQFKKNDAFVPFSIGKRYCFGEGLARMELF

LFLTNILQNFHLKSPQLPQDIDVSPKHVGFATIPPTYTMSFQPR

 

>CYP2B22 pig AB052256

MMMFSAILLLIVLIGVFLLWGHPSSQGHLPPGPRPLPFLGNILQ

MDRKGFLKSFQALRERYGDVFTVYLGPRPVVMICGTEAIREALVDQAEAFSGRGKIAV

VEPIFQGYGVIFSNGERWKTLRRFSLATMRDFGLGKRSVEERIQEEAQCLVEELRKSQ

GALQDPTYYFHSSTANIICSIVFGKRFAYRDPEFLQLLDLLFQTFLLISSFPSQLFEL

YSAFLKYFPGSHRQIYKNLQQVNAFIGRSVEKHRETLDPSDPRDLIDSYLLRMDKEKS

NPNSEFHEQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHITERIHKEIDRVIGSH

RPPALDDRAKMPYMDAVIHEMQRFGDLIPMGVPHTVTKDTHFRGYLLPKGTEVYPILT

SALHDPRYFENPEAFNPDHFLDATGALKKNDAFMPFSIGKRICLGEGLARTELFLFFT

TILQNFSVASPVAPEDIDLTPQAVGVGTVPPPYQIQFLPRQRG

 

>CYP2C32 PIG U35733.1

SIIFHNRFDYTDPNFLTLLEKLNENFRILSSPWIQDCNNFPALI

DYLPGSHNKVFKNYAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQVA

FTFENLIDTITDLFGAGTETTSTTLRYGLLLLLKHPDDTAKVQEEIDSVIERHRSPCM

QDRSRMPYTDAVVHEIQRYIDLIPISLPHAATRDIKFRNYLIPKGMTVLTSLTSVLHD

DQEFPNPEV

 

>CYP2C33v1   pig U35837.1

SILFNDRFHYDNETFLSLMNLLNANFRQISSPWIQIYNLWPQII

KHLPGEHRAFSKRLKDRRSFILEKVKEHQKSPNLNIPQDYIDCFLSKMEQEKQNPDSE

FHLENLINSGSNLFAAGTETTTSTLRYGLLLLMKHPEVQAKVHEEIDRVIGRSQRPCM

QDKMKLPYTEAVLHEIQRYIALLPSNLPHATVRDTKFREYIIPKGTTVLPLLSSVLHD

CKEFPNPEK

 

>CYP2C33v2   pig U35838.1

SILFNDRFHYDNETFLSLMNLLNANFRQISSPWIQIYNLWPQII

KHLPGEHRAFSKRLKDRRSFILEKVKEHQKSPNLNNPQDYIDCFLSKMEQEKQNPDSE

FHLENLINSGSNLFAAGTETTTSTLRYGLLLLMKHPEVQANVHEEIDRVIGRSQRPCM

QDKMKLPYTEAVLHEIQRYIALLPSNLPHATVRDTKFREYIIPKGTTVLPLLSSVLHD

CKEFPNPEK

 

>CYP2C33v3   pig U35839.1

SIPFNDRFHYDNETFLSLMNLLNANFRHLNSPWIQIYNLWPQII

KHLPGEHRAFSKRLKDRRSFILEKVKEHQKSPNLNNPQDYIDCFLSKMEQEKQNPDSE

FHLKNLINSGTNLFVAGTETTTSTLRYGLLLLMKHPEVQAKVHEEIDRVIGRSQRPCM

QDKMKLPYTEAVLHEIQRYIALLPSNLPHATVRDTKFREYIIPKGTTVLPLLSSVLHD

CKEFPNPEK

 

>CYP2C33v4   pig  AB052257

MELLGITTLALMVCVTCLVFLSVWKKNHKRRRLPPGPTPLPIIGNLMQLNLKDIPASLSKLAKQYGPVCTVYFGSQPAVVLHGYEAVKEALIDQGDEFLGRGIIPIIDDTQGGYGLVFSNGERWKQIRRFSLMTLRNFGMGKRSLEERVQEEAQFLVEELRKTEAQPFDPTFILSCAPCNVICSILFNDRFHYDNETFLSLMNLLNANFRQISSPWIQIYNLWPQIIKHLPGEHRAFSKRLKDCRSFILEKVKEHQKSPNLNNPQDYIDCFLSKMEQEKQNPDSEFHLENLINSGSNLFAAGTETTTSTLRYGLLLLMKHPEVQAKVHEEIDRVIGRSQRPCMQDKMKLPYTEAVLHEIQRYIALLPSNLPHATVRDTKFREYIIPKGTTVLPLLSSVLHDCKEFPNPEKFDPGHFLDKDGSFRKTEYFVPFSIGKRACAGESLARMELFLFFTTILQHFVLKPLKEPKDLETKPISVGLFNLPPPFKLCLIPR*

 

>CYP2C34v1   pig U35840.1

SIIFHNRFDYTDPNFLTLLEKFNENFKIMSTPWMQVCSNFPALI

DYLPGSHNKVLKNSAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQMA

FTFENLIATISDLFEAGTETTSTTLRYGLLLLLKHPDDTAKVQKEIDSVIERHRSPCM

QDRIHMPYTDAVVHEIQRYIDLVPIGLPHTVTRDIKFRNYLIPKGTTVLTSLTSVLND

DQEFPNPEV

 

>CYP2C34v2   pig U35841.1

SIIFHNRFDYTDSNFLTLLEKFNENFKIMSTPWMQVCSNFPALI

DYLPGSHNKVLKNSAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQMA

FTFENLIATISDLFEAGTETTSTTLRYGLLLMLKHPDVTAKVQKEIDSVIERHRSPCM

QDRIHMPYTDAVVHEIQRYIDLVPIGLPHTVTRDIKFRNHLIPKGTTVLTSLTSVLND

DQEFPNPEV

 

>CYP2C34v3   pig U35842.1

SIIFHNRFDYTDPNFLTLLEKFNENFKIMSTPWMQVCSNFPALI

DYLPGSHNKVLKNSAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQMA

STFENLIATISDLFEAGTETTSTTLRYGLLLMLKHPDVTAKVQKEIDSVIERHRSPCM

QDRIHMPYTDAVVHEIQRYIDLVPIGLPHTVTRDIKFRNYLIPKGTTVLTSLTSVLND

DQEFPNPEV

 

>CYP2C34v4   pig U35843.1

SIIFHNRFDYTDPNFLTLLEKFNENFKIMSTPWMQVCSNFPALI

DYLPGSHNKVLKNSAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQMA

FTFENLIATISDLFEAGTETTSTTLRYGLLLMLKHPDVTAKVQKEIDSVIERHRSPCM

QDRIHMPYTDAVVHEIQRYIDLVPIGLPHTETRDIKFRNYLIPKGTTVLTSLTSVLND

DQEFPNPEV

 

>CYP2C35     pig U35844.1

SIIFHNRFDYTDPNFLTLLEKFNENFKIMSTPWMQVCNTFPALI

DYLPGSHNTVFKNFAYVKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEKEKHNHQMA

FTFENLIATISDLFEAGTETTSTTLRYGLLLLLKHPDVTAKVQEEIDSVIERHRSPCM

QDRSRMPYTDAVVHEIQRYIDLIPIGLPHAVTRDIKFRNYLIPKGTTVLTSLTSVLRD

DQEFPNPEV

 

>CYP2C36     pig U35845.1

SIILHNRFDYTDPNFLTFLGKLNENFRILNSLWIQACNIFPALI

DYLPGSHNKVFKNFAYLKSYILEKVKEHQASLDVNDPRDFIDCFLIKMEQEKHNHQMV

FTLENLIATAVDLIRAGTETTSITLRYGLLLLLKHPDVTAKVQKEIDSVIERHRSPCM

QDRIHMPYTDAVVHEIQRYIDLVPISLPHAVTRDIKFRNYLIPKGTTVLTSLTSLLHD

VQEFPNPEV

 

>CYP2C42 pig Z93098.1

CDPTFILDCAPCNVICSIIFQNRFDYTDQDFLTLLEKFHENLNI

LSSPWIQVCNNFPALIDYSPGIHNKLLKNIAYLKSYVLKKVKEHQESLDINNPRDFID

CFLIKMEQEKHNQQSEYTIENLIATVSDMFSAGTETTSTTMRYGLLLLLKHPEVTAKV

QEEIDRVIGRHRSACMQDRSHMPYTDAVVHEIQRYIDLVPTNLPHAVTCDIKFRNYLI

PKGTTILTSLTSVLYDCKAFPNPEVFDPGHFLDESGNFKKSDYFMPFSTGKRICVGEG

LARMELFLFLTTILQKFNLKSVVDPKDIDTTPVANGFASVPPFYQICFIPL

 

>CYP2C42P1   pig Z93100.1

  1  LVVVLVLSLS CLLLLSLWKE SSGKGELPPG PTPLPILGNI LQLDVKNISK

 51  SLSNLAEVYG PVFTVYFGIK PTVVLYGYEA VKEALVDLGE EFLEEAISQW

101  PKKLTKDLEI IFSNGKKWKE IRRFSLMTLR EFKGWGKGAL EDRIQEEACC

151  LVEELRKTNA SPCDPTFILD CAPCNVICSI IFQNRFDYTD QDFLTLLEKF

201  HENLNILSSP WIQEFITNYL KILLI*KVMF *RK*KNTKNH WTLTILGTSL

251  TVS*SKGNRK STINSLNIQL KT**PLYLIC FLLVQRQQAP P*DMDSCFY*

301  STQRSQLRSR KRLTV*LAGT GVPACRTGAT CPTQMLWYTR SRDTLTWSPP

351  TCPML*LVTL NSETTSSPRA QQY*HL*LLC CMIAKHSPTQ KCLTLAIS*M

401  RVVTLRRVST SCLSQQENGF VWERAWPAWS YFYS*PQFYR NLT*NLWLIQ

451  RTSTPLQLPM DLLLCLPSTR PASFH

 

>CYP2C49     Sus scrofa (pig) AB052258

MDGAVVLVLCLSCLLLLSLWKQNSGKGRLPPGPTPLSILGNILQLDVKDISKSLSNLSKVYGPVFTVYFGLKPAVVLHGYEAVKEALIDGGEEFSGRGHFPMAERVNKGHGIIFSSGKRWKETRRFSLMTLRNFGMGKRSIEERVQEEARCLVEELRKTNASPCDPTFLLGCAPCNVICSIIFHNRFDYTDPNFLTLLEKLNENFRILSSPWMQVCNNFPALIDYLPGSHNKVLKNSAYVKSYILEKVKEHQASLDVKDPRDFIDCFLIKMEQEKHNHQVAFTFENLIATITDLFGAGTETTSTTLRYGLLLLLKHPDVTAKVQKEIDSVIERHRSPCMQDRSRMPYTDAVVHEIQRYIDLIPISVPHAVTRDIKFRNYLIPKGTTVLTSLTSVLRDDQEFPNPEVFDPGHFLDESGNFKKSDCFMPFSTGKRICVGEGLARMELFLFLTSILQKFTLEPVVDLKDIDTTPILSGFSHMPPSYQLRFIPV*

 

>CYP2C91 differs from known pig sequences 66% to 2C36, frameshift and small deletion

pseudogene?

Partial seq known but confidential

 

>CYP2D21     miniature pig D89502 8 amino acid differences to CYP2D25

MGLLTGGLLGILALAMVIFLLLVDLMHRRSRWAPRYPPGPMPLP

GLGNLLQVNFQDPRLSFIQLRRRFGDVFSLQQIWRPVVVLNGLAAVREALVSHSHETS

DRPPVFILEHLGYGPRSEGVILARYGKAWREQRRFSVSTLRNFGLGKKSLEEWVTQEA

SCLCAAFADQAGRPFSPNNLLNKAVSNVIASLTFARRFEYNDPRMLKLQDLVLEGLKE

EVGLMRQVLEAMPVLRHIPGLCAKLFPRQKAFLVMIDELITEHKMTRDLAQPPRDLTD

AFLDEMKEAKGNPESSFNDENLRLVVADLFSAGMITTSTTLAWALLLMILHPDVQRRV

QQEIDEVIGHARQPEIKDQALMPFTLAVLHEVQRFGDIVPLGVAHMTSRDIEVQGFLI

PKGTTLITNLTSVLKDETVWKKPFRFYPEHFLDAQGEFTKQEAFMPFSAGRRSCLGEP

LARMELFLFFTTLLQRFSFSVPTGQPRPSDHGVFAFLLFPSPYQLCAVPR

 

>CYP2D25     Sus scrofa (pig) Y16417, NM_214394

MGLLTGDLLGILALAMVIFLLLVDLMHRRSRWAPRYPPGPMPLP

GLGNLLQVNFQDPRLSFIQLRRRFGDVFSLQQIWRPVVVLNGLAAVREALVSHSHETS

DRPPVFILEHLGYGPRSEGVILARYGKAWREQRRFSVSTLRNFGLGKKSLEEWVTQEA

SCLCAAFADQAGRPFSPNNLLNKAVSNVIASLTFARRFEYNDPRMLKLLDLVLEGLKE

EVGLMRQVLEAMPVLRHIPGLCAKLFPRQKAFLVMIDELITEHKMTRDLAQPPRDLTD

AFLDEMKEAKGNPESSFNDENLRLVVAHLFSAGMITTSTTLAWALLLMILHPDVQRRV

QQEIDEVIGHVRQPEIKDQALMPFTLAVLHEVQRFGDIVPLGVAHMTSCDIEVQGFLI

PKGTTLITNLTSVLKDETVWKKPFRFYPEHFLDAQGRFTKQEAFMPFSAGRRSCLGEP

LARMELFLFFTTLLQAFSFSVPTGQPCPSDHGVFAFLLFPSPYQLCAVPR

 

>CYP2E1      sus scrofa (pig) AB052259

MTALGITVALLVWLVTLLLISIWKHIHSSWKLPPGPFPLPIVGNIFQLDLKNIPKSFTMLAERYGPVFTVYLGSRRIVVLHGYKAVKEVLLHYKNEFSGRGEIPTFQVHKDKGVIFNNGPTWRDTRRFSLTTLRDFGMGKQGNEQRIQREAHFLLEALRKTHGQPFDPTFLIGCAPCNVISDILFRQHFDYNDKTCLRLMSMFNENFYLLSTGWIQLYNNFSGYLRYLPGSHRKLMKNISEIKDYALERVKDHRDSLEPSCPRDFTDTLLMEMEKEKYSAEPIYTLDNIAVTVADMFFAGTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPNRIPAIKDRLDMPYLDAVVHEIQRFIDLIPSNLPHEATRDTVFRDYIIPKGTVVIPTLDSVLYDSQEFPEPEKFKPEHFLNENGKFKYSDHFKAFSAGKRVCVGEGLARMELFLFMAAILQHFNLKSLVDPKDIDLSPIAIGFAKIPPHYKLCVIPRSQV*

 

>CYP2F no 2F ortholog was found in ESTs or nr

 

>CYP2G no 2G ortholog was found in ESTs or nr

 

>CYP2J32v1 pig BW982013.1 CB287444.1, Z84061.1, BE014607.1

97% to CJ016505.1, 80% to 2J27 cow,

ALGSLAEALWTALRPSTILLGAVAFLFFADFLKKRRPKNYPPGPPRLPFIGNLFHLDLDK

GHLSLQRFVKKYGNVFSLDFGALSSVVITGLPFIKEAFVHQDKNFSNRPIVPIQQRVFKD

KGVVMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNPHFK

INNAVSNIICSITFGERFDYQDNQFQELLKLLDEVMCLQTSVWCQIYNIIPWIMKFLPGP

HQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIEAYLQEIEKHTGDATSSFQEENLICS

TLDLFVAGTDTTSTTLRWGLLYMALYPEIQEKVQAEIDRVLGQLQQPSSSARESMPYTNA

 

>CYP2J32v2 pig CJ016505.1

NRPTVPIQQRVFKDKGVVMSNGQVWKEQRRFALTTLRNSGLGKKSLEERIQEEAQYLIQA

IGEENGQPFNPRFKINNAVSNIICSITFGERFDYQDDQFQELLKLLDEVMCLQTSVWCQI

YNIIPWIMKFLPGPHQTLFSNWEKLKMFVAHVIENHRRDWNPAEARDFIDAYLQEIEKHK

GDATSSFQEENLICSTLDLFVAGTETTSTTLRWGLLYMALYPEIQEK

VQAEIDRVLGXLQQPSTAARESMPYTNA

 

>CYP2J33 pig BP170090.1 CK453810.1, BW982704.1, DB811462.1

DB817476.1, DY414727.1 DY418828.1 85% to CJ016505.1

80% to 2J28 cow

MTQALGSLAEALWTALHPSTLLLGAVTFLFFADFLKKRRPKNYPPGPLRLPFVGNLFHLD

FEKAHLSLQRFVKKYGNIFSLDLCALSAVVVTGLPLIKEVLVHQNQKFANRPILPIQDRV

FKNKGVVTSSGQVWKEQRRFTLTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNP

QFKISNAVSNIICSITFGKRFDYQDDQFQELLRLLREVTHLQTLLWCQLFNVFPRIMKFL

PGPHQTLFSDWEKLEMFIARVIENHRRDWNPAEARDFIDAYLQ

EIEKNKGNATSSFHEENLICSTLDLLFPG

TDTTLITLRWGLLYMALHPEIQEKVQAEIDRVLGQSQQPSTAARESMPYTNAVIHEVQRM

GNIIPLNVPREVAEDTTLAGYHLPKGTMVLTNLTAL

HRDPAEWATPNIFNPEHFLENGKFKKREAFLPFSIGKRACLGEQLARTELFVFFTSLLQK

FSFRPPDNEKLSLKFRVGLTLSPVTYCICAVPRA*

 

>CYP2J34 pig  BW981916.1, CJ028862.1, BW967356.1, CJ025847.1, BP142154.1

BP168104.1, CJ025026.1, BW967863.1,  83% to BW982013.1

80% to 2J28 cow

MTPALGFLAEALWTALRPSTLLLGAVAFLFFADFLKRRSPKNYPPGPPRLPFLGNFFHLD

VEKGHLALQRFVKEYGNIISLDSSVFSSVVITGLPLIKEAFVHQDQHFANRPMIPTQERV

FKKNGLIMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAIGEENGQPFNP

HFKINNAVSNIICSITFGKRFDYQDDRFQELLRLLDEVTCQHTSVQVQLYNMFPRIMKFL

PGPHQTLFSNWEKLQIFVACVIENHKRDWNPAEARDFIDAYLQEIEKHKGNATSSFQEEN

LIFTTLDLFFAGTETTSTTLRWGLLYMALYPE

 

>CYP2J35 pig BW960287.1, BI359857.1 75% to 2J28 cow

MLGAVGFLAEVFGTALGPSALLLSAVAFLFVADILKRWRPKNYPPGPLRLPFVGNFLHLD

FEQWHLSLQRFVKKYGNVLSLDLGAFSSVVITGLPLIKEALVHQDQNFVNRPINLNQV

FQKNGLIMSNGQVWKEQRRFALTTLRNFGLGKKSLEERIQEEAQYLIQAVREENGQPFDP

HFKINNAVSNIICSITFGERFDYQDDQFQELLRLLDEVTCL

PKLVRVQLFNVFPRIMKLLPGPHQIIFSNREKLRMF

IARVIENHRRDWNPAEARDFIDAYLREIEKGSSPSVFNEENLICSTLDLFFAGTETTS

TTL

 

>CYP2J pig BF191621.1, BX914614.2, BQ601924.1 85% to 2J30 cow

pssible end of 2J34 or 2J35

GQSQQPSIAARECMPYTNA

VIHEVQRMGNIIPMNVPREAAEGTTLAGYHLPKGTMVLTNL

TALHRDPAEWTTPDRFNPEHFLENGQFKKREAFLPFSIGKRACLGEQLARTELFVFFTSL

LQKFTFRPPDNEKLSLKFRMGLTLSPVTYRICAVPRA

 

>CYP2R1 95% to human 2R1 BW980853.1, BG732954.1, BI359965.1

lowewr case = cow seq

    MWEPPGAEVFPAALGGVL

2   FLLLFALGVRQLLKQRRPSGFPPGPSGLPFIGNIYSLAASAELPHIYMKKQSQVYGEIFS 181

182 LDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTKMGGLLNSRYGRGWVDHRR 361

362 LAVNSFRSFGYGQKSFESKILEETKFFMDAIETYSSRPFDFKQLITNAVSNITNLIIFGE 541

542 RFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPFGKHQQLFRNAAVVYDFLS 721

722 RLIEKASINRKPQSPQHFVDAYLDEMDQGEKDPSSTFSKENLIFSVGELIIAGTETTTNV 901

902 LRWAILFMALYPNIQGR 952

    vqkeidliigpsgkpswdekckmpyteavlhevlrfcnivplgifhatsedavvrgysi

    pkgttvitnlysvhfdekywrdpeifyperfldssghfakkealipfsl (1)

    GRRHCLGEQLARMEMFLFFTALLQRFHLHFPHelvpnlkprlgmtlqpqpylicaerr*

 

>CYP2S1 DT323081.1 85% to CYP2S1 cow

MEAAGTWALLLVLVLLLLLALALPGIRTGGHLPPGPAPLPLL

GNLLQLRPGAL

YLGLMRLSKKYGPVFTVYLGPWRRVVVLVGREAVQEALGGQAEEFSGRGMVATLDGTFDS

HGVFFSSGERWRQLRKVTMLALRDLGMGKREGEELIQAEAQRLVEEIRGTKGRPLDPSLL

LAQATSNIICSLIFGRRFPYDNEEFQAVVRAAGGTVVGVSSPWGQTYEMFSRVLQYLPGP

HTQLLGHLGTLAAFAVQQV

 

>CYP2T no 2T ortholog was found in ESTs or nr

 

>CYP2U1 no 2U1 ortholog was found in ESTs or nr

 

>CYP2W1 no 2W1 ortholog was found in ESTs or nr

 

>CYP2AB1 no 2AB1 ortholog was found in ESTs or nr

 

>CYP2AC1 no 2AC1 ortholog was found in ESTs or nr

 

>CYP3A22     Miniature pig AB006010

MDLIPSFSVETWLLLATSLVLLYLYGTYSHGLFKKLGIPGPKPL

PYLGSVLEYRKGMWHFDNKCFKKYGKMWGFYDGRQPVLAMRDPEMIKAVLVKECYSAF

TNRRNFGPAGVMKNAISVAKDEQWKRVRTLLSPTFTSGKLKEMFPIIAQYGDMLVRNL

RKEAEKGNSINTKEIFGAYSMDVITSTAFGVDVDSLNNPRDPFVQYARKLLRFDFLDP

FILSIILFPFLSPFFEVLDITLFPRSSVKFFTQSVKRMKESRLKDQQMRRVDLLQLMI

NSQNSKETDAHKALSDQELVAQSIIFICAGYETTSSSLSFLAYILATHPDVQQNLQEE

IDATFPSKALPSYDALAQMEYLDMVVNEILRLYPIAARLERVCKKDVEIHGVSVPKGT

VMMVPVFSIHRDPELWPEPEEFRPERFSKKNKDSINPYTYLPFGTGPRNCIGMRFALM

NMKLALVRVLQNFSFKPCKETQTPLKLSSQGLIQPEKPILLKVVPRDGTVSGA

 

>CYP3A29v1   pig  Z93099, AB052262

MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPL

PYFGNILGYRKGVDHFDKKCFQQYGKMWGVYDGRQPLLAVTDPNMIKSVLVKECYSVF

TNRRSFGPLGAMRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNL

RKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDP

FLLSLIFFPFLTPIFEVLNITLFPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMI

NSQNSKEMDPHKSLSNEELVAQGIIFIFAGYETTSSALSLLAYELATHPDVQQKLQEE

IEATFPNKAPPTYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHGVFVPKGT

VVVVPVFVLHRDPDLWPEPEEFRPERFSKKHKDTINPYTYLPFGTGPRNCIGMRFALM

NMKLALVRVLQNFSFKPCKETQIPLKLTTQGLTQPEKPVVLKILPRDGTVSGA

 

>CYP3A29v2   Sus scrofa (pig) AB052260

YSVFTNRRSFGPRGAMRTALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDPFLLSLIFFPFLTPIFEVLNITLFPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMINSQNSKEMDPHKSLSNEELVAQGIIFIFAGYETTSSALSLLAYELATHPDVQ

 

>CYP3A29v3   Sus scrofa (pig) AB052261

YSVFTNRRSFGPLGAMRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDPFLLSLIFFPFLTPIFEVLNITLFPKSSVNFFTKSVKRTKESRLTDQQKRRVDLLQLMINSQNSKEMDPHKSLSNEELVAQGIIFIFAGYETTSSALSLLAYELATHPDVQ

 

>CYP3A29v4   Sus scrofa (pig) AB052262

YSVFTNRRSFGPLGAMRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDPFLLSLIFFPFLTPIFEVLNITPFPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMINSQNSKEMDPHKSLSNEELVAQGIIFIFAGYETTSSALSLLAYELATHPDVQ

 

>CYP3A29v5  Sus scrofa (mini pig) AF424780

MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPL

PYFGNILGYRKGVDHFDKKCFQQYGKMWGVYDGRQPLLAVTDPNMIKSVLVKECYSVF

TNRRSFGPLGAMRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNL

RKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDP

FLLSLIFFPFLTPIFEVLNITLFPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMI

NSQNSKEMDPHKSLSNEELVGPGIIFIFAGYETTSSALSLLAYELATHPDVQQKLQEE

IEATFPNKAPPTYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHGVFVPKGT

VVVVPVFVLHRDPDLWPEPEEFRPERFSKKNKDTINPYTYLPFGTGPRNCIGMRFALM

NMKLALVKVLQNFSFKPCKETQIPLKLTTQGLTPTEKPVVLKILPRDGPLSGA

 

>CYP3A39v1   Sus scrofa (pig) NM_214422

MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPL

PYFGNILGYRKGVDHFDKKCFQQYGKMWGFFDGRQPVLAITDPDMIKTVLVKECYSVF

TNRRSFGPRGAMRTALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNL

RKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNTDFLNNPQDPFVENSKKLLKFSFFSP

LFLSIIFFPFLTPILEVLNVTLFPKSVVNFFMRSIKRMKESRLKDKQTHRVDFLQLMI

NSQNSKETDTHKGLSDEELVAQGVFFIFAGYETTSSSLSLLVYELATHPDVQQKLQEE

IDATFPSKALPSYDALAQMEYLDMVVNEILRLYPIAARLERVCKKDVEIHGVSVPKGT

VMMVPVFSIHRDPELWPEPEEFRPERFSKKNKDSINPYTYLPFGTGPRNCIGMRFALM

NMKLALVRVLQNFSFKPCKETQTPLKLSSQGLIQPEKPILLKVVPRDGTVGGA

 

>CYP3A39v2   Sus scrofa (pig) AB052263

YSVFTNRRSFGPRGAMRTALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYEDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNTDSLNNPQDPFVENSKKLLKFSFFSPFFLSIIFFPFLTPILEVLNVTLFPKSVVNFFMRSIKRMKESRLKDKQTHRVDFLQLMINSQNSKETDTHKGLSDEELVAQGVFFIFAGYETTSSSLSLLVYELATHPDVQ

 

>CYP3A39v3   Sus scrofa (pig) AB052264

YSVFTNRRSFGPRGAMRTALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNTDSLNNPQDPFVENSKKLLKFSFFSPFFLSIIFFPFLTPILEVLNVTLFPKSVVNFFMRSIKRMKESRLKDKQTHRVDFLQLMINSQNSKETDTHKGLSDEELVAQGVFFIFAGYETTSSSLSLLVYELATHPDVQ

 

>CYP3A39v4   Sus scrofa (pig) AB052265

YSVFTNRRSFGPRGAMRSAVSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFSPFFLSIIFFPFLTPILEVLNVTLFPKSVVNFFMRSIKRMKESRLKDKQTHRVDFLQLMINSQNSKETDTHKGLSDEELVAQGVFFIFAGNETTSSSLSLLVYELATHPDVQ

 

>CYP3A46v1   Sus scrofa (pig) AB052266

YSVFTNRRSFGPRGAMRSAVSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNVDSLNNPQDPFVENSRKLLKFSFFSPFFLSIIFFPFLTPILEVLNITLFPKSVVNFFTRSIKRMKESRLKDTQKHRVDLLQLMINSQNSKETDTHKGLSNEELVAQGVIFIFAGYETTSSSLSLLVYELATHPDVQ

 

>CYP3A46v2   Sus scrofa (pig) AB052267.1

YSVFTNRRSFGPRGAMRSAVSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNVDSLNNPQDPFVENSRKLLKFSFFSPFFLSIIFFPFLTPILEVLNITLFPKSVVNFFTRSIKRMKESRLKDTQKHRVDLLQLMINSQNSKETDAHKALSDQELVAQSIIFIFAGYETTSSSLSFLAYILATHPDVQ

 

>CYP3A88

CYP3A1 NEW 86% TO 3A22 AND 3A39v1, 76% to human 3A4 and 3A5

Partial seq known but confidential

3 aa diffs to CB479861.1 EST, probably the same seq.

F22946.1 extends seq toward N-term.

AJ959509.1 overlaps F22946 with 1 aa diff in 42

Be aware this may be a hybrid of two or more gene sequences.

BP447724.1, DB797665.1, DB798166.1, DB798326.1, DB799120.1

DB799225.1

92% to 3A39v1

MDLIPGFSTETWVLLATSLVLLYLYGTYSHGLFKKLGIPGPRPLPYF

GNILGYRKGVDHFDKKCFQQYGKMWG

FFDGRQPVLAITDPDMIKTVLVKECYSVFTNRRSFGPRGAMRSAVSLAEDEEWKRIRTLL

SPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNV

DSLNNPQDPFVENSRKLLKFSFFSPFFLSIIFFPFLTPILEVLNITLFPKSVVNFFTRSI

KRMKESRLKDTQKHRVDLLQLMINSQNSKEMDAHKGL

SNEELVAQGVIFIFAGYETTSSSLSLLVYKLATHPDVQQKL

QEEIDATFPNKAPPTYDGLAQMEYLD

MVVNESLRIFPVTPRVERVCKKDVEIHGVFVPKGTVMMVPIFALHRAPELWPEPEEFRPE

RFSKKNKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQIPLKI

SSQGLIQPEKPIVLMVVPRDGTTSGA*

 

>CYP4A21     pig NM_214425, AJ586859

MTVPALASVSGLLQVASLLGLLLLLLKAAQLYLRRQWLLKALQQ

FPSPPSHWLYGHSREFQEESELQPLLKRVEKYPSACARWLWGTRAMVLVYDPDYMKVV

LARSEPKAPVLYRLLIPWIGCGLLLLNGQMWFQRRRMLTPAFHYDILKPYVGLMAKSV

QVMLDKWEQLVAQDPRLEIVGPVSLMTLDTIMKCAFSHQGSAQTDGDSQSYIQAIWDL

KNLIFSRLRSAFLQNDIIYRLSPEGRQCQRACQKVHQHTDRVIQLRKTHLQKEGEMEN

VKKKRHLDFLDILLFARMENGNSLSDTDVRAEVDTFMAAGHDSTASGISWVLYALASN

PEHQQRCREEIQGLLGDGTSITWDHLDQMPYTTMCIKEALRLYPPVPSVGRELSKPIT

FPDGRSLPAGIILSLSIYGLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRN

CIGKQFAMNEMKVVVALTLLRFELAPDPSRIPVPIQGIVLKSKNGIHLNLRKIP

 

>CYP4A23     pig NM_214424.1

MTVPALASVSGPLQVASLLGLLLLLLKAAQLYLHRQWLLKALQQ

FPSPPSHWLYGHSREFQEESELPPLLKRVEKYPSACARWLWGTRAMVLVYDPDYMKVV

LARSDPKTSVVYRLLIPWIGCGLLLLNGQTWFQRRRMLTPAFHYDILKPYVGLMAKSV

QVMLDKWEQLVAQDPRLEIVGPVSLMTLDTIMKCAFSHQGSVQTDGDSHSYIQAIWDL

KNLFSTRTKSAFLQNDIIYRLSPEGHKNHRAARIAHQHTDRVIQLRKAQLQKQGEMEN

VRKKRHLDFLDILLLAQMEKGNSLSDTDLRAEVDTFMFEGHDTTASGISWILYALASH

PEHQQRCREEIQGLLGDGTSITWDHLDQMPYTTMCIKEALRLYPPVPGVSRELSKPIT

FPDGRSLPAGIILSLFIYGLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRN

CIGKQFAMNEMKVAVALTLLRFELAPDPSRKPIATPEVVLNSKNGIHLKLRKLP

 

>CYP4A24     pig  AJ586619, NM_214424

MTVPALASASGLLQVASLLGLLLLLLKAAQLYLHRQWLLKALQQFPSPPSHWLYGHSREFQEESELPPLLKRVEKYPSACALWRWGTRAMVLVYDPDYMKVVLARSDPKNSVVYRLLIPWIGCGLLLLNGQTWFQRRRMLTPAFHYDILKPYVGLMAKSVQVMLDKWEQLVAQDPRLEIVGPVSLMTLDTIMKCAFSHQGSAQTDGDSHSYIQAIWDLKNLFSIRTKSAFLQNDIIYRLSPEGRKNHRAARIAHQHTDRVIQLRKAQLQKQGEMENVRKKRHLDFLDILLLARMEKGNSLSDTDLRAEVDTFMFEGHDTTASGISWILYALASHPEHQQRCREEIQGLLGDGTSITWDHLDQMPYTTMCIKEALRLYPPVPGVSRELSKPITFPDGRSLPAGITLSLSIYGLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRNCIGKQFAMNEMKVAVALTLLRFELAPD

 

>CYP4A25     pig AJ318097

MTVPALASASGLLQVASLLGLLLLLLKAAQLYLRRQWLLKALQQ

FPSPPSHWLYGHSREFQEESELQPLLKRVEKYPSACARWLWGTRAMVLVYDPDYMKVV

LARSEPKAPVLYRLLIPWIGCGLLLLNGQTWFQRRRMLTPAFHYDILKPYVGLMAKSV

QVMLDKWEQLVAQDPRLEIVGPVSLMTLDTIMKCAFSHQGSAQTDGDSHSYIQAIWDL

KNLFSIRTKSAFLQNDIIYRLSPEGRKNHRAARIAHQHTDRVIQLRKAQLQKQGEMEN

VRKKRHLDFLDILLLARMEKGNSLSDTDLRAEVDTFMFEGHDTTASGISWILYALASH

PEHQQRCREEIQGLLGDGTSITWDHLDQMPYTTMCIKEALRLYPPVPGVSRELSKPIT

FPDGRSLPAGIILSLSVYSLHHNPQVWPNPEEFDPSRFAPGSARHSHAFMPFSGGSRN

CIGKQFAMNEMKVAVALTLLRFELAPDPSRKPTVIPEVVLHSKNGIHLKLRKLP

 

>CYP4B1      Sus scrofa (pig) AK231936.1

MVPALLSLSLSHLSLWALGLILALGVLKLTSLLLRRQMLARAMDK

FPGPPTHWIFGHALEIQQTGSLDKMVSWAHQFPHAHPLWLGPFLGFLNIYEPEYAKAVYS

RGDPKASDLYDFFLQWIGKGLLVLHGPKWFQHRKLLTPGFHHDVLKPYVAVMANSARVML

DKWEEKAREDKSFDIYHDVGHMALELLMKC

TFGKGTSGLNYSDNAYHLAVRDLTLLMQQRLSSFQYHNDFIYWLTPHGRRFLRACRVAHD

HTDQVIRERKAALQDKEEQERIQSRRHLDFLDILLGAQDEDRVKLPDADLRAEVDTFMFG

GHDTTTRGISWFLYCMSLNPEHQHRCRDEIREILGDRDSIQGEDLGKMTYLTMCIRESFRLYPP

GPQVYRQLSEPVSFVDGRSLPAGSLISLHIYALHRNSAVWPDPEVFDPLRFSLENMAGRH

PFAFLPFSAGPRNCIGQQFAMNEMKVVAALSLLRFEFAPDPSRPPIPMPQLTLCSKTGIH

LRLTSLGQGSGK*

 

>CYP4F52 AK233364 2 aa diffs to AK233483

MLQLSLSWLGLGPVEASPWLLLLLVGASWLLARVLVWTCTSLDNV

RRLRGFPQPPKPNWLLGHMGQVPPTEEGMTKLTQMMNTYPNGFMIWMGPITPIIVLCHPD

LIRTMANASAAVAPKDVVFYDFLKPWLGDGLLLSAGDKWSSHRRMLTPAFHFNILKPYMK

IFNDSVNVMHAKWQRLVTEGHNRLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYIAAI

LELSALVAKRHQQIFLHLDFLYYLTPDGWRFHKACRLVHDFTDAVIQERRNTLPTEGIDD

FLKAKAKAKTLDFIDVLLLTKDEDGKGLSDEDIRAEADTFMFEGHDTTASGLSWVLYNLA

KHPEYQERCRQEVHELLRDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQD

IVLPDGRIIPKGVICLISIFGTHHNPLVWQDPEVYDPFRFDPENIKERSPLAFIPFSAGP

RNCIGQTFAMTEMKVVLALTLLRFRVLPVEEEPRRKPELILRAEGGLWLRVEPLSASPQ*

 

>CYP4F52 AK233483 2 aa diffs to AK233364

MLQLSLSWLGLGPVEASPWLLLLLVGASWLLARVLVWTCTSLDNV

RRLRGFPQPPKPNWLLGHMGQVPPTEEGMTKLTQMMNTYPNGFMIWMGPITPIIVLCHPD

LIRTMANASAAVAPKDVVFYDFLKPWLGDGLLLSAGDKWSSHRRMLTPAFHFNILKPYMK

IFNDSVNVMHAKWQRLVTEGHNRLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYIAAI

LELSALVAKRHQQIFLHLDFLYYLTPDGWRFHKACRLVHDFTDAVIQERRNTLPTEGIDD

FLKAKAKAKTLDIIDVLLLTKDEDGKGLSDEDIRAEADTFMFEGHDTTASGLSWVLYNLA

KHPEYQERCRQEVHELLRDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVTVISHRCTQD

IVLPDGRIIPKGVICLISIFGTHHNPLVWQDPEVYDPFRFDPENIKERSPLAFIPFSAGP

RNCIGQTFAMTEMKVVLALTLLRFRVLPVEEEPRRKPELILRAEGGLWLRVEPLSASPQ*

 

>CYP4F53 AK230568 85% to AK233364

MLQLSLSKMGLWLMAASPWLLLLLVGASWLLVQVLVW

TYTSYDNARRLRGFPQPPKRNWFLGHLGLIQSSEEGLLYTQDLASTYGDVCCWWVGPWHA

VIRIFHPTYIKPVLFAPAAIAPKASVFYDFLKPWLGDGLLLSAGDKWSSHHRMLTPAFHF

NILKLYMKNFNDSVNVMHAKWQHLVTEGHNRLDMFEHISLMTLDSLLKCVFSFHSNCQEK

PSQYIAAIVELSALVAKRHQQIFLHLDFLYYLTPDGWRFHKACRLVHDFTDAVIQERRNT

LPTEGIDDFLKAKDKAKTLDFIDVLLLTKDEDGKRLSDEDIRAEADTIMFGDHDTTASGL

SWVLYNLAKHPEYQECCRQEVHELLRDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVTV

ISRRCAQDIVLPDGRIIPKGVICLISIFGTHHNPSVWPDPEVYDPFRFDPENIKGRSPLA

FIPFSAGPRNCIGQTFAMTEMKVVLALTLLHFRVLPDKEEPRRKPELILRAEGGLWLQLE

PLSAGQQ*

 

>CYP4F54 AK238099 95% to AK233210 22 diffs

MLQLSLSWLGPGPVSASPWLLLQLVGATWLLSRILS

WIYDFYDNCCRLRCFPQPPKRNWFWGHWDLAKSNEEGLQLIEDMGRLFCDVYLWWLGPFY

PILRLVHPNFVAPLLQAPATIIPKDMLFYSFLKPWLGVGLLLSAGEKWSHQRRLLTPAFH

FDILKSYVKIFNRSADIMHAKWQRLASEGHTRLDMFEHISLMTLDSLQKCVFSFDSNCQE

KPSEYITAILALSALVIKRCEQIFLHKDFLYYLTPEGRRFRKACRLVHDFTDAVIQERRC

TLISQGSQDFLRAKAKAKTLDFIDVLLLAKDEDGKGLSDEDIRAEADTFMFAGHDTTASG

LSWVLYNLAKHPEYQERCRKEVQELLRDREPKEIEWDELAQLPFLTMCIKESLRLHPPVP

GISRCCAQDVVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVYNPFRFDPESPQKRSPL

AFIPFSAGPRNCIGQTFAMTEMKVVLALTLLRFRVLPDEEEPRRKPEIVLRAEGGLWLRV

EPLRGGQQ*

 

>CYP4F55v1 AK233210 5 aa diffs to AK239242 allele?

MLQLSLSWLGLGPVSASPWLLLQLVGATWLLSQ

ILSWIYDFYDNCCRLRCFPQPPKRNWFWGHRDLAKSNEECLQLMEDVGHYFHDVYLWWLG

PFYPILRLVHPNFVAPLLQAPATIIHKDMFLYIFLKPWLGVGLLLSAGEKWSHQRRLLTP

AFHFDILKSYVKIFNRSADIMHAKWQRLASEGHTRLDMFEHISLMTLDSLQKCVFSFDSN

CQEKPSEYIAAISELSALVTKRNEQIFLHKDFLYYLTPEGRRFRKACRLVHDFTDAVIQE

RRRTLISQGSQDFLRAKAKAKTLDFIDVLLLAKDEDGKGLSDEDIRAEADTFMFAGHDTT

ASGLSWVLYNLAKHPEYQERCRQEVQELLRDREPKEIEWDELAQLPFLTMCIKESLRLHP

PVTGISRCCTQDVVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVYNPFRFDPESPQKR

SPLAFIPFSAGPRNCIGQTFAMTEMKVVLALTLLRFRVLPDEEEPRRKPEIVLRAEGGLW

LRVEPLRGGQQ*

 

>CYP4F55v2 AK239242 5 aa diffs to AK233210

MLQLSLSWLGLGPVSASPW

LLLQLVGATWLLSRILSWIYDFYDNCCRLRCFPQPPKRNWFWGHQDLAKSNEECLQLMED

VGHYFHDVYLWWLGPFYPILRLVHPNFVAPLLQAPATIIHKDMFLYIFLKPWLGVGLLLS

AGEKWSHQRRLLTPAFHFDILKSYVKIFNRSADIMHAKWQHLASEGHTRLDMFEHISLMT

LDSLQKCVFSFDSNCQEKPSEYIAAISELSALVTKRNEQIFLHKDFLYYLTPEGRRFRKA

CRLVHDFTDAVIQERRRTLISQGSQDFLRAKAKAKTLDFIDVLLLAKDEDGKGLSDEDIQ

AEADTFMFAGHDTTASGLSWVLYNLAKHPEYQERCRQEVQELLRDREPKEIEWDELAQLP

FLTMCIKESLRLHPPVTGISRCCTQDVVLPDGRIIPKGNICVISIFGIHHNPSVWPDPEV

YNPFRFDPESPQKRSPLAFIPFSAGPRNCIGQTFAMTEMKVVLALTLLRFRVLPDEEEPR

RKPEIVLRAEGGLWLRVEPLRGGQQ*

 

>CYP4F55v2 AK232426 100% to AK239242

QLLPPPVFPATPKTELVLGSPGPATIIHKDMFLYIFLKPWLGVGLLLSAGEKWSHQRRLL

TPAFHFDILKSYVKIFNRSADIMHAKWQHLASEGHTRLDMFEHISLMTLDSLQKCVFSFD

SNCQEKPSEYIAAISELSALVTKRNEQIFLHKDFLYYLTPEGRRFRKACRLVHDFTDAVI

QERRRTLISQGSQDFLRAKAKAKTLDFIDVLLLAKDEDGKGLSDEDIQAEADTFMFAGHD

TTASGLSWVLYNLAKHPEYQERCRQEVQELLRDREPKEIEWDELAQLPFLTMCIKESLRL

HPPVTGISRCCTQDVVLPDGRIIPKGNICVISIFGIHHNPSVWPDPEVYNPFRFDPESPQ

KRSPLAFIPFSAGPRNCIGQTFAMTEMKVVLALTLLRFRVLPDEEEPRRKPEIVLRAEGG

LWLRVEPLRGGQQ*

 

>CYP4F56 CYP4F2V2 84% to 4F3 human, 88% to 4F49 cow, 94% to 4F2v1 above

94% (15 aa diffs to AK233364)

94   GDGLLLSAGDKWSSHRRMLTPAFHFNILKPYMKIFSDSVNVMHAKWQRLVTEGHNRLDMF 273

274  EHISLMTLDSLQKCVFSFDSNCQEKPSEYIAAILELSALVAKRHQQIFLHKDFLYYLTPE 453

454  GRRFRKACHLVHNFTDAVIQERRRSLPKEGIDDFLKAKANAKTLDFIDVLLLTKDEDGKG 633

634  LSDEDIRAEADTFMFEGHDTTASGLCWVLYNLAKHPEYQERCRQEVHELLRDHEPKEIEW 813

814  DDLAQLPFLTMCIKESLRLHPPVTVISRRCTQNTVLPDGRIIPKGVICLISIFGTHHNPS 993

994  L 996

 

>CYP4V2 CB473254.1, DB791600.1 lower case = cow seq

    mlapwllsvgpklllwsglc

    avslagatltlnllkmvasyarkwrqmrpvptigdpyplvghalmmksdardffqqiidfteecr

    hlpllklwlgpvplvalynaetvevilssskhieksymyk FLEPWLGLGLLTST

1   GNKWRSRRKMLTPTFHFTILEDFLDVMNEQATILVTKLEKHVNQEAFNCFF 153

153 YITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRVSDSIHRRMKAPWLWFDFLYFMFK 329

330 DGQEYRKSLKILHNFTSNVITERASEMKRDEERSHDDKDIPPHKNKCKAFLDLLLNVTDD 509

510 KGNKLSHEDIREEVDTFMFE 557

    ghdttaaainwslyllg

    FYPEVQKKVDNELDEVFGKSDRPATLEDLKKLKYLECVIKESLRLFPS

3   VPFFARSINEDCEIAGHKIVKDSQVIIVPYALHRDPRYFPNPEEFRPERFFPENSKGRH 179

180 SYAYVPFSAGPRNCIGQKFAIMEEKTILSCILRHFWVESNQKREELGLAGEPILRPTNG 356

    IWIKLKRRNTDES*

 

>CYP4X1 DB802053.1 DB802658.1

MESSWLETHWARPLHLALVFCLALGLLQAVKLYLQRQRLLRDLRPFPSPPSHWFYGHQKI

IQNGGMETLGEITDKYPRAFPFWLGPFQAFFFIYDPDYAKTLLSRPDPKSNFLYKFMDPV

VGKGLLNLNGPKWFQHRRLLTPGLHLNALKSHVEIMAHSVNTMLGKWERICGTEDTLLEI

SAHVTLLTLDIIMKCVFGLETNCQINSTYDHYVKAVNEGSNLIFYRVYNFLYHHDIIFKF

SPKGHRFLELRKILHPYTAKIIQAGKNSLMNENQQGNTQKRKY

RNIFDIALSAQAENGDSFSDTDLRSEVNTFLLAGHETMTGGLT

WLLYHLALYPEHQERCREEIRSILGDGSSITWGQLGEMSYTTMCIKESLRLAPPVLSFSR

ELSKPITFSDGRSLPAGITVVCSIWGLHHNPAIWENPQVFDPLRFSQENNDKRHCYAYLP

FSAGPRNCVGQQFAMAELKAAVALILLRFSLTAEATRPLVSRPNIFLKPKNGLYLHLKKLP*

 

>CYP5A1 pig NM_214046.1, 82% to human 5A1, one diff to published 5A1

MEVLGFLSPELNGPMVTMALAVVLLALLKWYSTSAFSRLEKLGI

RHPKPSPFIGNLTFFRQGFWESHMELRKQYGPLSGYYLGRRMIVVISDPDMIKQVLAE

KFSNFTNRMATGLESKPVADSILFLRDKRWEEVRSVLTSAFSPKKLNKLTPLISQACD

LLLAHLERYAESGDAFDIQRCYCCYTTDVVASVAFGTQVNSSEEPEHPFVKHCRRFFA

FSVPRLILVLILSFPSIMVPLARILPNKKRDEVNGFFNKLIRNVIALRDQQAAEERRQ

DFLQMVLDLRHSAPSVGVENFDIVRQAFSSAKGCPADPSQPHLPRPLSKPLTVDEVVG

QAFLFLIAGYEIITNTLSFVTYLLATNPDCQEKLLREVDDFSKKHPSPEHCSLQQGLP

YLDMVLSETLRMYPPAFRFTREAARDCEVLGQRIPAGTVLEVAVGALHHDPKHWPHPE

TFDPERFTAEAQRLQQPFTYLPFGAGPRSCLGVQLGLLEIKLTLLHILRKFRFEACPE

TQVPLQLESKSALSPKNGVYIRIVPR

 

>CYP7A1 pig AK230789.1 88% to cow 7A1

MMSISLLGGIVTAVCCCLWLLLGMR

RRQTGEPPLENGIIPYLGCALQFGANPLEFLRANQRKHGHIFTCQLMGNYVHFITNPLSY

HKVLCHGKYLDWKKFHFTASAKAFGHRSIDPSDGNTTDNINKTIIKTLQGDALNLLAAAM

MENLQLVLRPQVAPQPEKPAWVTEGMYSFCYRVMFEAGYVTLFGKDPIGHDAQKALILNN

LDNFKQFDKIFPALVAGFPIHVFKTGHYAREKLAEGLRLQKLRKRDHISELVRFLNDTLS

TLDDAEKAKSLLAVLWASQANTIPATFWCLFQTIRSPEAMKAASEEVNKTLEKAGQKISL

DDKPIYLNQIELDSMPVLDSIIKESLRLSSASLNIRTAKEDFTLHLQDGSYNIRKDDIIA

LYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYSHGLKLKYYYMPFGSGATICPGRL

FAVQEIKQFLILMLSYFDLELVESHVKCPPLDQSRAGLGILPPSNDIEFRYKLKHL*

 

>CYP7B1 pig AJ956520.1, AJ955923, CK455462.1, CJ000103.1

MGRFSPEPWLPQLLSPRGLALAAALLLLVLFLRTRRTRRPGEPPLVKSWLPFIGEAL

KLQRDPIGFMTTLQKQYGDIFTVLLGGKYITFILDPFQYQSVIKNQKLSFRGFSNKVLL

RVFSIKKLVEDDAMNDELHTCYQLLQGRHLDMLMENTMQSLKQVFEPQLLKTTSWHTESL

FTFCNSVIFEMTLTTVYGSILLGHRKTFITELKDDFFKFDGKFTQLASGMPIELLGNIKSIRLKLIKL

LTTENLAKFQGWSEVVQRRQDILEKYYLPQDIEIGAHHLGLLWASVANTAPTMSWTMYYL

LRNPEAMAVLRDEIDHLLQSTGQKKGPGFSIHLTREQLDSLVYLESTILESLRLSSFSST

FRFVQEDLTLHLEAQDCCLRKGDFVGVFPPILHYDPEIFEAPEEFRFDRFVENGKKKTTF

FKRGKKLKYYLMPFGFGISKCPG

RFLAVVEIKQLLVILLTYFDLEIIDDKPVKLNFSRSLFGIQHPDSDVSFRYKVKS*

 

>CYP8A1 new lower case = cow seq

Pig ESTs BP457025.1, BE013722.1, BE013644.1, AJ666831.1

  30 mswavvfgllaallllllltrrrtrrpgeppldlgsipwlghalefgkdaagfltrmkek 209

 210 hgdiftvlvggrhvtvlldphsydavvweprsrldfhayavflmerifdvqlphynpgde 389

 390 kskmkptllhkelqaltdamytnlrtvllgdtveagsgwhemgllefsygfllragyltq 569

 570 ygveapphtqesqaqdrvhsadvfhtfrqldlllpklargslsagdkdrvgkvkgrlwkl 749

 750 lsptrlasrahrsrw

    LESYLQHLEEMGVSEQMQARALVLQLW

1   ATQGNMGPAAFWLLLFLLKNPEALAAVRGELEPILSRAEQPISQMTTLPQKVLDSTPVLD 180

181 SVLSESLRLTAAPFITREVVADLALPMADGREFTLRRGDRLLLFPFLSPQKDPAIYTDPE 360

361 VFKYNRFLNPDGSEKRDFYKDGKRLKNYSLPWGAGHNQCLGRAYAVSSIKQFVFLVL 531

    AHFDLELSSPDVEMPEFDLSRYGFGLMQPERDVSIRYRLRA*

 

>CYP8B1     Sus scrofa (pig) AJ488932, NM_214426

MVLWGPVLGVLLVAIVGYLCLQGLLRQRRPEEPPLDKGSVPWLG

HAMTFRKNMLEFLKHMWARHGDIFTVQLGGQYFTFVMDPLSFGPILKDAKRKLDFVEY

AEKLVLKVFGYRSMQGDHRMIHSASTKHLMGDGLEELNKAMLDNLSLVMLGPKGPSPD

ASCWREDGLFHFCYDILFKAGYLSLFGRTEDKEQDLLQAEELFMQFRKFDRMFPRFVY

SLLGPREWLEVGRLQCLFHKMLSVEHSLERHGISSWITDMLQVLREQGVAPAMQDKFN

FMMLWASQGNTGPTTFWALLFLLKHPEAMRAVREEATRVLGEARLEDKQSFDVEVSAL

NHMPVLDSVMEETLRLGAAPTLLRVVNSDQILKMASGQEYRLRHGDILALFPYLSVHM

DPDIHPEPTTFKYDRFLTPSGSRKVNFYKAGKKIHHYTMPWGSGISICPGRFFALTEM

KLFVLLMVTHFDLELVDPDTPVPPVDPQRWGFGTMQPSYEVRFRYRLRPTE

 

>CYP11A1     Sus scrofa (pig) NM_214427

MLARGLALRSVLVKGCQPFLSAPRECPGHPRVGTGEGACISTKT

PRPFSEIPSPGDNGWINLYRFWKEKGTQKIHYHHVQNFQKYGPIYREKLGNLESVYII

DPEDVALLFKFEGPNPERYNIPPWVAYHQHYQKPVGVLLKKSGAWKKDRLVLNTEVMA

PEAIKNFIPLLDTVSQDFVGVLHRRIKQQGSGKFSGDIREDLFRFAFESITNVIFGER

LGMLEEIVDPEAQKFIDAVYQMFHTSVPMLNLPPDLFRLFRTKTWRDHVAAWDTIFNK

AEKYTQNFYWDLRRKREFNNYPGILYRLLGNDKLLSEDVKANVTEMLAGGVDTTSMTL

QWHLYEMARSLNVQEMLREEVLNARRQAQGDTSKMLQLVPLLKASIKETLRLHPISVT

LQRYLVNDLVLRDYMIPAKTLVQVAVYAMGRDPAFFSNPGQFDPTRWLGKERDLIHFR

NLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVELQHFSDVDTIFNLILMPDKPIFL

VFRPFNQDPLQA

 

>CYP11B1     pig D38590

MAIWAKAEAWLAGPWLALNRARTLGTRAVLAPKGVLPFEAIPQF

PGKKWMRVLQLWREQGFENNHLEMHQTFQELGPIFRFDVGGRNMVLVMLPEDVERCQK

VEGLHPQRDVPGPWLAYRHLRGHKCGVFLLNGPTWRLDRLQLNPGVLSLQAMQKFTPL

VDGVARDFSQALRARVMQNARGSLTLDIKPSIFRYTIEASNLVLFGERLGLLAHQPNP

ESLDFIHALEVMFKSTVQLMFMPRSLSRWTSTGTWKEHFEAWDCIFQYANKAIQRLYQ

ELTLGHPWHYSGVVAELLTHANMTVDAIKANSIDLTAGSVDTTAYPLLMTLFELARNP

EVQQALRQESLAAAARISENPQKAITELPLLRAALKETLRLYPVGIFLDRCVTSDLVL

QNYHIPAGTLVKVLLYSLGRNPAVFARPERYHPQRWLDNQGSGTRFPHLAFGFGMRQC

LGRRLAQVEMLLLLHHVLKNFLVETLVQEDIKMIYRFIMTPSTLPLLTFRAIS

 

>CYP11B2 Pig ESTs CV872108.1, BI341717.1  93% to 11B1 pig

MAIWAKAEAWLAGPWLALHRARTLGTRAALAPKAVLPFEAIPQCPGNKWMRVLQLWREQG

FENIHLDMHQTFQELGPIFRFDVGGRHMVLVMLPEDVERLQKVEGLHPQRMFLEPWLAYR

QLRGHKCGVFLLNGPTWRLDRLQLNPGVLSLQAMQKFTPLVDGVARDFSQALRARVMQNA

RGSLTLDIKPSIFRYTIEASNLVLFGERLGLLAHQPNPES

 

>CYP17A1       Sus scrofa (pig) U41519 to U41525

MWVLLVFFLLTLTYLFWPKTKGSGAKYPRSLPVLPVVGSLPFLP

RRGHQHMNFFKLQDKYGPIFSFRLGSKTTVVIGDHQLAKEVLLKKGKEFSGRPRVMTL

DILSDNQKGIAFADHGTSWQLHRKLALSTFSLFKGGNLKLENIINQEIKVLCDFLATR

NGESIDLAQPLSLAMTNIVSFICFNFSFKKGDPALQAIVNFNDGILDAVGKEILYDMF

PGIRILPSQTLENMKQCVRMRNELLREILENRKENYSRNSITNLLDIMIQAKTNAESN

TGGPDHNLKLLSDRHMLATVADIFGAGVETSASVVKWIVAFLLHYPLLRKKIQDAIDQ

NIGFNRAPSISDRNQLVLLEATIREVLRFRPVSPTLIPHRAIIDSSIGEFTIDKDTDV

VVNLWALHHNEKEWHRPDLFMPERFLDPTGTQLISPSLSYLPFGAGPRSCVGEMLARQ

ELFLFTAGLLQRFDLELPDDGQLPCLVGNPSLVLQIDPFKVKIKERQAWKEAHTEGSTS

 

>CYP19A1      Sus scrofa (pig) U37311

MVLEMLNPMHYKVTSMVSEVVPFASIAVLLLTGFLLLVWNYKNT

SSIPGPGYFLGIGPLISYLRFLWMGIGSACNYYNKTYGEFIRVWIGGEETLIISKSSS

VFHVMKHSHYTSRFGSKPGLQFIGMHEKGIIFNNNPVLWKAVRTYFMKALSGPGLVRM

VTVCADSITKHLDKLEEVRNDLGYVDVLTLMRRIMLDTSNNLFLGIPLDEKAIVCKIQ

GYFDAWQALLLKPDIFFKIPWLYRKYEKSVKDLKEDMEILIEKKRRRIFTAEKLEDCM

DFATELILAEKRGELTKENVNQCILEMLIAAPDTMSVTVFFMLFLIAKHPQVEEELMK

EIQTVVGERDIRNDDMQKLEVVENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGT

NIILNIGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRACAGKYIAMVMMKVT

LVILLRRFQVQTPQDRCVEKMQKKNDLSLHPDETSGLLEMIFIPRNSDKCFTK

 

>CYP20A1 new lower case = cow

DT324969.1, BG894896.1, BI336725.1, BP449309.1

Trace file gnl|ti|861177001

MLDFAIFAV

3   TFLLALVGAVLYLYPASRQAAGIPGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVV 182

183 SFWFGRRLVVSLGTVDVLKQHINPNKTSDPFETMLKSLLRYQSDSGNMSENHMRKKLYEN 362

363 GVTNSLQSNFALLLKLSEELLDKWLAYPESQHVPLCQHMLGFAMKSVTQMVMGSTFEDEQ 542

543 EVIRFQKNHGTVWSEIGKGFLDGSLDK

    NHMRKKLYENGV

TNCLRSNFALLIKLSEELLDKWLSYPESQ

HVPLCQHMLGFAMKSVTQMVMGSTFEDEQEVIRFQKNHGTVWSEIGKGFLDGSLDKSTTRKKQYEDALMQLESILKKI ikerkgrnfsqhifidslvqgnlndqqiledtmifsla

scmitaklctwavcflttyeeiqkklyeeidqvlgkgpitsekieelrycrqvlcetv

RTAKLTPVSARLQDIEGKIDKFIIPRETLVLYALGVVLQDPGTWSSPYK

FDPERFDDESVMKTFSLLGFSGPQEC

PELGWRYMVTTVLWSVLLRRRHLLPVEGQVIETNYDLVTSS

XEEAGITVSKRFRPGILLPWLRKLTI*

 

>CYP21A1       PIG S53049 M83939

MVLVWLLLLLTLLAGARLLWGQWKLRNLHLPPLVPGFLHLLQPNLPIYLLGLTQRLGPIY

RLRLGLQDVVVLNSKRTIEEALVRKWVDFAGRPQIPSYKLASQHCPDISLGDYSLFWKAH

KKLTRSALLLGVRSSMEPRVEQLTQEFCERMRAQAGTPVTIQKEFSVLTCSIICCLTFGD

KEDTLVHALHDCVQDLMKTWEHWSIQILDMVPFLRFFPSPGLRRLKQAIENRDHLVEKQL

RRHKESMVAGQWRDMLDYMLQEAGRQRVEEGQGQLLEGHVHMSVVDLFIGGTETTANTLS

WAVVYLLHHPEIQWRLQEELDRELGPGAAGSRVPYKDRARLPLLNATIAEVLRLRPVVPL

ALPHRATRPSSIFGYDIPEGTVVIPNLQGAHLDETVWEQPHEFRPDRFLAPGANPSALAF

GCGARVCLGEPLARLELFVVLVQLLQAFTLLPPEGALPSLQPHPHSGINLKVQPFQVRLQ

PRGGRGEGPGPR

 

>CYP24A1 pig NM_214075

MSSPISKSGSLAALLQQLRSCGQPPRPVTSTACVPRRSKEVPLC

PMEQPGETQDAAXAGSTRWPLLGSLLEILWKGGLKKQHDTLAEYHRKYGKIFRMKLGS

FDSVHLGSPCLLEALYRTESAHPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSA

FQKKLMKPMEVMKLDNKINEVLADFMSRIDELCDERGCIEDLYSELNKWSFESICLVL

YEKRFGLLQKNAGEEALNFITAIKTMMSTFGKMMVTPVELHKNLNTKVWQAHTLAWDT

IFKSVKSCIDHRLEKYAEQPSADFLCDIYHHNQLSKKELYASVTELQLAAIETTANSL

MWILYNLSRNPHVQQKLLKEIQSVLPENQMPRAEDLRNMPYLKACLKESMRLTPSVPF

TTRTLDKAMVLGEYALPKGTVLMLNTYVLGTNEENFEDSSQFRPERWLQEKKKINPFA

HLPFGVGKRMCIGRRLAELQLHLALCRIIRKYAIVATDSEPVGMLHLGILDPTRQLPI

AFCQR

 

>CYP26A1  93% to human 26A1

Pig ESTs CN161524.1, CN162920.1, CF179212.1, DY434075.1, CF180567.1, CN165481.1,

MGLPALLASVLCTFVLPLLLFLAAIKLWDLYCVSSRDRSCTLPLPPGTM

GFPFFGETLQMVLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVS

VHWPASVRTILGSGCLSNL

HDSSHKQRKKVITQAFSREALQCYVPVIAEEVDSCLEQWLSCGERGLLVYPQVKR LMFRI 181

182  AMRILLGCEPRLASGGEAEQQLVEAFEEMTRNLFSLPIDVPSSGLYRGLKARNLIHARIE 361

362  ENIRAKICGLRAAGAGGGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASA 541

542  ATSLITYLGLYPHVLQKVREELKSKGLLCKGNQDNKLDMEILEQLKYIGCVIKETLRLNP 721

722  PVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDAADIFTNKEEFNPDRFLLPHPEDAS 901

902  RFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWRLLNGPPTMKTSPTVYPVDDLPA 1081

1082 RFTRFQGEI* 1111

 

>CYP26B1 pig AK238570.1, CJ034657.1 aa 88-142

LLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNTVANSIGDIHRNKR

 

>CYP27A1     pig AK232936.1

MAALGCARLRWALLGTRVPFPVIGSQGARAKAAIPTALPAAQTAEAPGTGPGDRRLRTLKELSGPGRLRLLFQLLAQGYVLHLHQLQVLNKAKYGPMWINYIGPQIHVNVASAPLLEQVMRQEGKYPVRNDMDLWKEHRDLQGLTYGPFTTEGESWYRLRQALNQRMLKPADAALYTNALNEVVDDFMVRLNQLRAESTLGDHVPDIAHQFYFFALEAICYILFEKHIGCLERSIPQDTKAFVRSVGFMFQNSLYATFLPKWTRPLLPYWRRYLDGWNTIFSFGKKLIDQKLEEIEAQLQAGGPEEPRISGYLHLLLTSGQLSPREAEGSLPELLMAGVDTTSNTLTWALYHLSKNPEIQAALHEEVVGMVPAGRVPQYKDLAHMPLLKAVLKETLRLYPVVPVNSRVTDKEIEVGGFLFPKNTQFVLCHYVVSRDPSIFPEPDRFSPKRWLRKNQTDALKGQHPFGSVPFGYGVRGCLGRRIAELEMQLLLTRLIQQYEVTLAPETGEVQSVARIVLVPNKKVGLRFLQRQG

 

>CYP27B1 pig DQ295065

MTQTLKLASRVFHRVCRAPELGSRGSDSAPRGLADLPGPSTPGF

LAELFCKGGLSRLHELQVQGAARFGPVWLASFGKVRTVYVAAPTLVEQLLRQEGPLPE

RCSFSPWTEHRRRRQRSCGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLHDVVQD

LVRRLRSQRGLGAGPPALVRDVAGEFYKFGLEGIAAVLLGSRLGCLEPEVPPDTETFI

RAVGSVFVSTLLTMAMPSWLHRLVPGPWARLCRDWDQMFAFAQEHVERREAEAAMKSQ

GKPEEDLGSGAHLTYFLFREELPAPSILGNVTELLLAGVDTVSNTLSWALYELSRHPE

VQMALHSEIKTALGPSSSAHPSATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIC

VGDYIIPKNTLVTLCHYATSRDPAQFPEPNSFRPARWLGECPAPHPFASLPFGFGKRS

CMGRRLAELELQMALAQILIHFEVQPEPGSAPIRPMTRTVLVPERSINLQFVDR

 

>CYP39A1 pig ESTs BP441358.1, BP458693.1, CV872464.1, DN131248.1, CB287479.1

DN131598.1, CN156146.1, DN115951.1, BP166812.1, DN116306.1, CN154029.1,

114  MEFISPAVIIILGCVTLLLFLQWKNLRGPPCIGGWIPWIGAGFEFGKAPLEFIEKARIKY 293

294  GPIFTVLAMGTRMTFVTEEEGMNVFLKSKEVNFELAVQNPVYRTASIPKNIFLKLHEKLC 473

474  VMMKGKMGTFNLYQFTGQLTEELHKQLENLGTHGTMDLNNLVRHLLYPVTVNVLFK 641

643  KGLFPTNERKIREFHQHFQAYDEGFEYGSQ LPERLLRNWSKSKNWLLALFEKNI PDIKTY 822

823  KSAKDHSQTIMQDILDLLEMETNEQMSPNYGLLLLWASLSNAVPVTFWTLAFILSHPNIH 1002

1003 RTILEGISSVFGTTGKDKI 1059

EVSEDNLKKLPLIQWCILETIRLRAPGVITRKVLKP

VKILNYTVPSGDLLMLSPFWLHRNPKYFPEPDLFKPERWKKANLEKHAFLDWFMAFGTGKYQCP

GRWLALLEIQMCVILIFYYYDCTLLDPLPKQSSLHLVGVQQPEGQCRVEFKQRK*

 

>CYP46A1 pig BI359892.1, BF193580.1, BF190788.1,

lower case = cow seq.

mspgllmllgsavlvvfglcctfvhrar

SRYEHIPGPPRPSFLLGHLPYFWKK

KDEVCGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKRFLMSTKYNKDS

KMYHAIQTVFGERLFGQGLVSECDYERWHKQRRVMDLAFSRSSLVSLMGIFNEKAEQLVE

ILEAQADGQTPVSMQDMLTCTTMDILAKAAFGIETSMLLGAQKPLSRKVKLIL

egisasrntlakfmpgkwkqlxetresvrflrqv

GKDWVQRRREALQRGEDVPADILTQILKAEEGAQD

DEILLDNFVTFFIAGHETSANHLAFTVMELSRQPEILARLQAEVDEVIGSKRHLDCEDLG

RLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDP

LTFNPDRFSPKAPKPKFTYFPFSLGPRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQSFGLQE

qatlkpldpvlctlqprgwqpapppppc

 

>CYP51A1 pig AB042982, AB009988, NM_214432

MVLLGLLQAGGSVLGQAMEQVTGVNLLSSLLLACAFTLILVYLF

RQAIGHLAPLPAGAKSPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVG

KTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLK

SGLNIAHFRQHVSIIEKETKEYFQSWGESGERNLFEALSELIILTASHCLHGKEIRSQ

LNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKNIFYKAIQKRRQSEE

KIDDILQTLLDSTYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQ

EKCYLEQKTVCGEDLPPLTYDQLKDLNLLDRCIKETLRLRPPIMTMMRMAKTPQTVAG

YTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCI

GENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK