Potato P450s

 

March 15, 2010 with some modifications.

Last edited on July 14, 2011

 

D. Nelson

 

This list is not currently in gene name order so you may need to search

for a family name.

 

The Potato genome was published on July 14, 2011 in Nature

 

>CYP51G1

iTAG gene:chr01.349 100% match

PGSC0003DMS000001961 scaffold (-) strand

98% to tomato (scaffold02227 CYP51G1)

348444 MELGDNKILNVGLLLVATLLVAKLISALIMPRSKKRLPPVIKAWPIVGGLIRFLKGPVVML 

RQEYPKLGSVFTLNLLNKNITFFIGPEVSAHFFKAPETDLSQQEVYQFNVPTFGPGVVFD 

VDYTIRQEQFRFFTEALRVTKLKGYVDQMVTEAE (0) 347978

346958 EYFSKWGESGEVDLKYELEHLIILTASRCLLGEEVRNKLFDDVSALFHDLDNGMLPIS 

VIFPYLPIPAHRRRDNARKKLAEIFANIINSRKHTGKAENDMLQCFIDSKYKDGRPTTEG  

EITGLLIAALFAGQHTSSITSTWTGSYLLTNNKYMSAVVDEQKNLMKKHGNKVDHDILSE 

MDALYRCIKEALRLHPPLIMLLRSSHSDFSVTTREGKEYDIPKGHIVATSPAFANRLPHI 

FKNPETYDPDRFGPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFEF 

ELISPFPEIDWNAMVVGVKGEVMVKYKRRKLSAE* 345958

 

>CYP51G1

PGSC0003DMB000000098 superscaffold

1424379-1424843 (+) exon 1

1425865-1426863 (+) exon 2

 

$

 

>CYP51 pseudogene 1

PGSC0003DMB000000354 superscaffold (+) strand

94% to tomato (scaffold02227 CYP51G1)

note: this seq is more like CYP51 than the CYP51 pseudogenes in tomato

610175 MELGDNKILNVGLLLVA &

LLVAKLISTLIMARSKKRLPPVIKAWPIVGGFIRFLKGPVVMLRQEYPKLGSV

FTLNLLNKNITFFIGPEVSAHFFKAPETDFSQQ 610485

 

>CYP51 pseudogene 1

PGSC0003DMS000001451 scaffold

26293-25983 (-) strand

$

 

>CYP51 pseudogene 2

PGSC0003DMB000000327 superscaffold

89% to tomato (scaffold02227 CYP51G1)

note: this seq is more like CYP51 than the CYP51 pseudogenes in tomato

450286 MELGENKILNVGLLLVATLLVAKLISALIMPRSKKCLPPVIKAWPIVGGLICFLKGPVVM

LRQEYPKLGSVFTLNL*QDITF &

IDPEVSAHFFKAPETDL &

TQQ 450600

 

>CYP51 pseudogene 2

PGSC0003DMS000001690 scaffold

148383-148697 (+)

 

$

 

>CYP71D241 CYP71B.1

iTAG gene:chr04.1499 72% not the same sequence

PGSC0003DMB000000911

133-1970 (-) strand

91% to scaffold02227 tomato, 73% to CYP71B38 Populus, 95% to CYP71B.13

1970  MELFNLISISLFVFFLFLLKKLKNSNSQI

1883  NKRLPPGPWKLPFVGSMFHMVGGLPHRVLRDLA & 1785

1783  KKYCPIMHLQLGEVSLVVVTSPIMAKQVLKTHDLAFASRPRLLASEIVFYNCTDIAFCPY  1604

1603  GDYWRQMRKICVLKVLSGKNVRSFSSIRQDETLRLVEFFRSSYTGESINVTKRISLFTSF  1424

1423  IICRSAFGTIFKEQDEFIRVMKSVTSLLEGFNVADIFPSLKFLHVLSGMKGKIMYLHHK  1247

1246  VDTIVENVINEHKKNLVIGKTNGELGGEDLIDVLLRLMEDGDLQFPITNDNIKAIVY (0)  1076

      DMFSAGIETTSTIIDWAMVEMI

687   NSSILFKAQAEVREAFRGKETFDENNIEELKYLKLIVKEILRLHPPLPLMLPRECREVV  508

507   DIDGYTIPSKTKLIVNVWAIGRDPKNWDDAESFKSERFEQSSVDFAGNNFEFLPFGSGRR  328

327   ICPGISFGLANVYLPLANLLYHFDWKLPPGIKSSDLDMTESDGASCPRKSNLHLIKTPYQ  148

147   PSQA*  133

 

$

 

>CYP71D240P CYP71B.2Pv1

iTAG gene:chr04.1499 71% not the same sequence

PGSC0003DMB000000911

9780-12001 (+) strand

88% to scaffold02227, 72% to CYP71B38, 93% to CYP71D.9

note 71D.9 and 71D.8P may be CYP71B sequences

 9780   MNFLNFFSLFLFVSFLFLLLKY

 9846   WKNSNTQIRKKLPPGPWKLPLLGSMFHLLGGPPHHVLSDLAKKYGPIMHLQLGEISLV  10019

10020   VVISPDMAKQVLKTHDLTFASRPKLVATDIICYNGSDIIF & 10139

10141   SPYGEYWRQMRKLCIMELLSAKNVKSFSSIR*DEVLRMIQFFQSFSGETVNVTEKI  10308

10309   FQFTSSMTCRSAFGKVFKEKDEFIQVVKKVSHIMEGFDVADLFPSLKFLHVLCGMKSRI  10485

10486   MDVHHELDVILEKIINEHKNNGELGGEGLVAALIEVMKEGGL*FPITNDNIKAII  10650

11404   DIFAAGTETSSATIDWTMVEMMRHPNVLSKAQEEVRNTFKGKETFDENDVEELKYLKL  11577

11578   VVKESFRLHPPFPLLLPRECREEVDINGYTIPLKTKVMVNAW  11703

11687   LWLMHGRDPKYWNDAESFKPERFEDNSMDFVGNNFEYLPFGSGRRNCPGISFGLANVYFP  11866

11867   LAQLLYHFDWKLPNGINSSELDLTESAGSTCARKSNLYLIATPY*  12001

 

 

>CYP71B.2Pv2

PGSC0003DMB000027089

2-136 (-) strand

100% to CYP71B.2P

136   PWKLPLLGSMFHLLGGPPHHVLSDLAKKYGPIMHLQLGEISLVVV  2

 

$

 

>CYP71D239P CYP71B.3P

iTAG gene:chr04.1499 71% not the same sequence

PGSC0003DMB000000911

12184-13847 (+) strand

End is in a sequence gap

91% to scaffold02227 tomato, 72% to CYP71B38 Populus, 93% to CYP71D.8P

12184   MYTGYLLINKVNILFLLLKY

12244   WKNSNTQIRKN*PPGPWKLPLLGSMFHLLGGPPHRVLRDLA & 12366

12368   KKYGSIIHLQLGEVSLVVVTSPEMAKQVLKTHDLALHLGPC*LIAAEIVCYNGSDIVFSP  12547

12548   YGDYWRQMRKICIMELLSAKNVKSFNSIRQDEGLGMIEFFRSSSGETVNATKRIFQFAS  12724

12725   SMTCRSAFGKVFKEQDELILLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKGKIMDVHH  12901

12902   ELNVILENIINEHKNNGELGGEGLVAALLRVMKEGGHQFPITNDNIKAIIF (0)  13054

13497   DIFAAGTETSSATIDWTMVEMMRNPNVLSKAQEEVRNAFKGKETFDENDVEELKYLKL  13670

13671   VVKESFRLHPPLPLLLPRECREEVDINGYTIPLKTKVMVNAWAIGRDPKYWNDAESFKP  13847

 

$

 

>CYP71D238P CYP71B.4P

iTAG gene:chr04.1499 71% not the same sequence

PGSC0003DMB000000911

13985-15568 (+) strand

N-term in s seq gap

92% to scaffold02227 tomato, 72% to CYP71B38 Populus, 93% to CYP71D.8P

13985   MAKQVLKTHDLAFASRPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKICIMELLSAKNVKS  14164

14165   FNSIRQDEVLGMIEFFRSSSGETVNATKRIFQFASSMTCRSAFGKVFKEKDEFIQVVK  14338

14339   KVSHIMEGFDVADLFPSLKFLHVLCGMKSRIMDVHHELDVILEKIINEHKNN  14494

14495   GELGGEGLVAALIEVMKEGGL*FPITNDNIKAIIF (?)  14596

14963   DIFAAGTETSSATIDWTMVEMMRHPNVLSKAQEEVRNTFKGKETFDENDVEELKYLKL  15136

15137   VVKESFRLHPPFPLLLPRECREEVDINGYTIPLKTKVMVNAWAIGRDPKYWNDAESFKPK  15316

15317   RFEDNSMDFVGHNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINPSEL  15496

15497   DLTESAGSTCARKSNLYLIATPY*  15568

 

>CYP71B.4Pv2

PGSC0003DMB000029998

1 aa diff to CYP71B.4P

1-132 (+) strand

1   LKTKVMVNAWAIGRDPKYWNDAESFKPKRFEDNSMDFVGNNFEY  132

 

$

 

>CYP71D237P CYP71B.5P

PGSC0003DMB000000911

21642-21731 (+) strand

75% to scaffold02227 tomato

21642   GEQVLKTHDLAFAFRPMLITVEIVCYNESE  21731

 

$

 

>CYP71D236P CYP71B.6P

iTAG gene:chr10.1961 57% not the same sequence

PGSC0003DMB000000911

22277-23818 (+) strand

91% to scaffold02227 tomato, 96% to CYP71B.8P

23818   MELFNLISISLFVFFLFLLKKLKNSNSQI

23731   NKRLPPGPWKLPFVGSMFHMVGGLPHRVLRDLAKKYGPIMHLQLGEVSLVVVTSPIMA  23558

23557   KQVLKTHDPAFASRPRLLASEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNVRSFS  23378

23377   SIRQDETLRLVEFFRSSSSGEPVNVTKRISLFTSFIICRSAFGTIFKEQDEFIRVMKSV  23201

23200   TSLLEGFNVADIFPSLKFLHVLSGMKGKIL (?) 23111

        DMFSAGTETTSTIIDWAMVEMI

22831   KNSSILFKAQAEVREAFRGKETFDENNVEELKYLKLIIKETLRLHPPLPLMLPRESREEV  22652

22651   DIDGYTIPSETKLIVNVWAIGRDSNYWDDAESFKPERFEQSSVDFAGNNFEFLPFGSGRR  22472

22471   ICPGISFGLANVYLPLANLLYHFDWKLPLGIKSSDLDMTESGGASCTRKSNLHLVMTPYQPSQE*  22277

 

$

 

>CYP71D235P CYP71B.7P

PGSC0003DMB000000911

40013-40144 (+) strand

86% to scaffold02227 tomato

40013   NRMIEFYRSSSSETVNSTKKIFEFASSMTCRSAFGKVFKEQDEL  40144

 

$

 

>CYP71D186P CYP71B.8P

iTAG gene:chr04.1499 73% not the same sequence

PGSC0003DMB000000911

41179-43366 (-) strand

Cyan region is duplicated

92% to scaffold02227 tomato, 74% to CYP71B38 Populus, 97% to CYP71B.13

43366   MELFNLISISLFVFFLFLLKKLKNSNSQI

43279   NKRLPPGPWKLPFVGSMFHMVGGLPHRVLRDLAK & 43178

43178   KYGPIMHLQLGEVSLVVVTSPIMAKQVLKTHDLAFSSRPRLLASEIVLYNCTDIAFC  43008

43007   PYGDYWRQMR KICVIEVLSGKNVRSFSSIRQDETLRLVEFFR & 42882

42877   HPEPANVTKRISLFTSFIICRLAFGTIFKEQDEFIRVMKSVTSL  42746

42635   KICVLEVLSGKNVRSFSSIRQDETLRLVEFFRSSYTGESINVTKRISLFTSFIICRSAFG  42456

42455   TIFKEQDEFIRVMKSVTSLLEGFNVADIFPSLKFLHVLSGMKGKIMYLHHKVDTIVENV  42279

42278   INEHKKNLVIGKTNGELGGEDLIDVLLRLMEDGDLQFPITNDNIKAIV  42135

        DMFSAGTETTSTIIDWAMVEMI

41733   KNSSIIFKAQAEVREAFRGKETFDENNVEELKYLKLIVKETLRLHPPLPLMLPRESREEV  41554

41553   DIDGYTIPSETKLIVNVWAIGRDSNYWDDAESFKPERFEQSSVDFAGNNFEFLPFGSGRR  41374

41373   ICPGISFGLANVYLPLANLLYHFDWKLPSGIKSSDLDMTESDGASCTRKSNLHLIMTPYQPSQE*  41179

 

$

 

>CYP71D234P CYP71B.9P

PGSC0003DMB000000911

61879-62040 (+) strand

83% to scaffold02227 tomato

61879 KQVNSMFHKRALRNRMIEFYQSSSGETVNAIFEFASSMTYRSAFGKVFKEQDEL  62040

 

$

 

>CYP71D233P CYP71B.10P

PGSC0003DMB000000876

9452-10318 (+) strand

85% to scaffold02227 tomato, 715 TO CYP71B38 POPULUS

 9452   MHFFNFFSLFLFVSSLFLL

 9509   IKWKNSNSKTKKLPPGPWKLPLIGSMFHLLGGLPHHVLRDLAKKYGPIMHLQLGEVSL  9682

 9683   VVVTSPDMAKQVLKTHDLAFASRPKLLAAEILFYNGTDIVFSPYGDYWRQMRKICLLELL  9862

 9863   SAKNVKSFNSIRQDEVLRMIDFFRSSIGETVNATKKFYQFSSSMTCRAAFGKVLKEQD  10036

10037   ELILLVKKASHLMEGFDVADIFPSLKFFHLLCGMKGKIMDAHHELDAILENIINEHKN  10210

10211   NGELGGEGLVATLLRLMKEGGFQFPITNDNIKAIIF (0)  10318

 

$

 

>CYP71D232 CYP71B.11

iTAG gene:chr04.1499 72% not the same sequence

PGSC0003DMB000000876

14415-16211 (+) strand, one frameshift

85% to scaffold02227 tomato, 72% to CYP71B38 Populus

14415   MHLFNFFSLFLFLFVSSLFLL

14478   IKWKNSNRKVKRLPPGPWKLPLIGSMFHLLGGLPHQVLRDLA & 14603

14606   KYGPIMHLQLGEVSLVVVTSPDMAKQVLKTHDLAFASRPKLLAAEILFYNGTDIVFS  14776

14777   PYGDYWRQMRKICLLELLSAKNVKSFNSIRQDEVLCMIDFFRSTTGETVNATKKFYQFS  14953

14954   SSMTCRATFGKVLKEQDELILLVKKASHLMEGFDVADIFPSLKFLQVLCGMKGKIMDAH  15130

15131   HELDVILESIINEHKNNGELGGEGNLVATLLRLMKDGGFQFPITNDNIKAIIF (0)  15286

        DMFGAGTETSSTTIDWTMVEMM

15663   RDPNVLSKAQAEVRNVFKGKETFDENDVEELKYLKLVVKESFRLHPPFPLLIPRECREEV  15842

15843   DINGYNIPLKTKVMVNTWAIGRDPNYWNDAESFKPERFEHNSMDFVGNNFEYLPFGSGRR  16022

16023   ICPGISFGLANVYFPLAQLLYHFDWKLPSGINPSDLDLTESAGLTCARKSNLYLIAAPHQAE*  16211

 

$

 

>CYP71D185bP CYP71B.12P

PGSC0003DMB000000876

62340-62834 (+) strand

Seq runs into a gap

94% to scaffold02227 tomato, 80% to CYP71B38 Populus, 100% to CYP71B.6P

62340   MELFNLISISLFVFFLFLLKKLKNSNSQI

62427   NKRLPPGPWKLPFVGSMFHMVGGLPHRVLRDLAKKYGPIMHLQLGEVSLVVVTSPIMA  62600

62601   KQVLKTHDPAFASRPRLLASEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNVRSFS  62780

62781   SIRQDETLRLVEFFRSSS  62834

 

$

 

>CYP71D185a CYP71B.13

iTAG gene:chr04.1499 74% not the same sequence

PGSC0003DMB000000876

70832-72649 (+) strand, one frameshift

93% to scaffold02227 tomato, 74% to CYP71B38 Populus, 97% to CYP71B.8P

70832   MELFNLISISLFVFFLFLLKKLKNSNSQI

70919   NKRLPPGPWKLPFVGSMFHMVGGLPHRVLRDLAKKYGPIMHLQLGEVSLVVVTSPIMA  71092

71093   KQVLKTHDPAFASRPRLLASEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNVRSFS  71272

71273   SIRQDETLRLVEFFRSSYTGESINVTKRISLFTSFIICRSAFGTIFKEQDEFIRVMKSV  71449

71450   TSLLEGFNVADIFPSLKFLHVLSGMKGKIMYLHHKVDTIVENVINEHKKNLVIGKTNGE  71626

71627   LGGEDLIDVLLRLMEDGDLQFPITNDNIKAIVY (0) 71719

        DMFAAGTETTSTTIDWAMVEMI

72114   KNSSILFKAQAEVREAFRG & 72170

72170   KETFDENNVEELKYLKLIVKETLRLHPPLPLMLPRESREEVDIDGYTIPSKTKLIVNVWA  72349

72350   IGRDPKYWGDAESFKPDRFEQSSVDFVGNNFEFLPFGSGRRICPGISFGLANVYLPLANL  72529

72530   LYHFDWKLPSGIKSSDLDMSESDGASCTRKNNLHLIMTPYQPSQE*  72649

 

$

 

>CYP71D243P CYP71B.14P

iTAG gene:chr09.1524 100% short, missing N-term due to frameshift

PGSC0003DMB000000110

648213-650001 (-) strand

81% to scaffold01435 tomato, 64% to CYP71B38 Populus

650001   MEFQFPFNFIFLFLFLLSLYLLH

649932   VEWKKSRNLNKKLPPGPWKLPLLGSVHHLALEGGLK & 649825

649825   EHGPFMHLQLVEISTIVVSSLDMTREVMKTHDLAFASRPKLVSLDIICYKSTDIVFSPYG  649646

649645   DYWRQMRKVCVLELLTTKNVRSFSSIRRDEASRLVQLIQSSTRGEPINVTERILRYESSM  649466

649465   TCKAAFRDQLLKDEEKFIEILRELVELAGGFSVADIFPSIKILHVVSGLRSRILKLHKNV  649286

649285   DAIVEDVINKHKKNIASGKKGNGEFGGEDLVDVLLRLMESGELKIPITNDNIKAIMI (0) 649115

         DMFAAGTETSGTITIWAMTEMM

648413   RNPSVLTKAQTEVRKAFKENETFNKDIIEELKYLKQVVKETLRLHPPFPLLIPRECMEET  648234

648233   NINGYTI  648213

 

$

 

>CYP71D242 CYP71B.15

iTAG gene:chr09.1523 100% missing the beginning of exon 2

PGSC0003DMB000000110

644778-645398 (-) strand

Exon 1 in a seq gap

84% to scaffold01435 tomato, 74% to CYP71B38 Populus, 75% to CYP71D7 potato

645398   DLFGAGTETSGTTIIWAMSEMM

645332   RNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPRECREET  645153

645152   SINGYTIPLKTRVMVNVYAMGRDPKYWLDAESFIAKRFEQSSIDYMGNNFEYLPFGAGRQ  644973

644972   MCPGITFGLINVYLPLAKLLYHFDWKLPDGVKPKDVDMTENCGITAARKSELYLIATPYY  644793

644792   LSQE*  644778

 

$

 

>CYP71D184 CYP71B.16v1

iTAG gene:chr04.1493 75% not the same sequence

PGSC0003DMB000000998

297-917 (+) strand

exon 1 is off the contig end

91% to scaffold02227 tomato

297   DMFSGGTETSSTLIDWAMVEMM

363   RNPSVLLKAQAEIRNAFTEKETFDENDAEKLKYLKLVVKETFRLHPPGPLLIARECREEV  542

543   DINGYTIPLKTKVMVNAWAIGRDPKYWIDAECFKPERFEQISVDFIGNSFEFLPFGSGRR  722

723   ICPGISFGLANIFFPLAKLLYHFDWKLPIGINPSDLDLTESAGITCARKSNLYLIATPHQPCQE*  917

 

>CYP71B.16v2

PGSC0003DMB000015878

8-188 (-) strand

100% to CYP71B.16

188   VDFIGNSFEFLPFGSGRRICPGISFGLANIFFPLAKLLYHFDWKLPIGINPSDLDLTESAGI  3

 

$

 

>CYP71D244P CYP71B.17P

iTAG gene:chr04.1493 71% not the same sequence

PGSC0003DMB000000998

26332-30374 (+) strand

84% to scaffold02227 tomato, 74% to CYP71B38 Populus

26332   MHFFNFFSLFLFVSSLFLL

26389   IKWKNSNSKNKRLPPGPWKLPLLGSMFHLLGGLQHHVLRDLAKKYGPIMHLQLGEVSL  26562

26563   VVVTSPDMAKQVLKTHDLTFASRSKLIATEILFSNGSDIVFSPYGDYWRQIRKICLLELL  26742

26743   STKNVKSFNSIRQDEVLHMIEFFRSSSGETVNATKKFYQFASSMTCRSPFGKVLKEQD  26916

26917   ELILLVKKASKFVEGFDVADIFP*LKFLHVLCGMKGKIMDAHHALDVILENIINEHKN  27090

27091   NGELGGEGN*VATLLRLMKEGGFQFPITNDNIKAIIF  27201

        NIFVAGTETSSTTIDWAMVEMM

29821   RNPSVLFKAQAEVRNTFKEKETFDENDVEELKYLKLVIKETFRLHPPIPLLIPRECREDV  30000

30001   DINGYIIPLKTKVIVNAWAIKRDPKYWNDAECFKPERFEQISIDFIGNSFEFLPFGSGRR  30180

30181   ICPGISFGLANI & 30216

30219   FPLAKLLYHFDWKLPIGINPSDLDLTESAGITCARKSNLHLIATPHQPCQE*  30374

 

$

 

>CYP71D245P CYP71B.18P

PGSC0003DMB000000998

39316-40181 (+) strand

85% to scaffold02227 tomato

39316   MHFFNFFSLFLFVSSLFLL

39373   IKWKNSNSKTRRLPPGPWKIPLIGSMFHLLGALPHQVLRNLAIKYGPIMHLQLGEVSL  39546

39547   VVVTSPDMAKQVLKTHALAFASRPKLLVGELLFYKGTDIVFSPYGDYWRQMRKICLLKLL  39726

39727   SAKNVKSFSSIRQDEVRLMIEFFRSSSGETVNVTKMIYQFSSSMICRSAFGKVFKEQN  39900

39901   KFIELVKEASRLMEGFDVADLFPSLKFLHVLCGMKGKIMDAHHALDAILENIINEHRNN  40077

        DELDGEGF &

40110   LLRLMKEGGFQFPITNNNIKAIIF (0) 40181

 

$

 

>CYP71D246P CYP71B.19P

PGSC0003DMB000009163

176-334 (+) strand

94% to CYP71B.16, 86% to scaffold02227 tomato, 3 aa diffs to CYP71B.16v1

176   DMFAGGTETSSTLIDWAMVEMM

242   RNPSVLLKAQAEIRNTFTGKETFDENDAEKL  334

$

 

>CYP71D6v1 Solanum chacoense (Chaco potato)

           GenEMBL U48434 (1641bp)

           Hutvagner, G., Barta, E. and Banfalvi, Z.

           Isolation and sequence analysis of a cDNA and related gene for

           cytochrome P450 from Solanum chacoense.

           Gene 188 (2), 247-252 (1997)

MQLISIFLFICFLFLLRKWKKYSKNSQTKKLPPGPWKLPFIGSM

HHLAGGRPHRVLRDLAKKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKL

LAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSAKSVRSFSSIRCDEVVRLIDSIQ

SSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKEQDMFIKLIREVIRLAEGFDVADIF

PSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFATRKNDDHALGGENLIDVLL

KLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAMVEMLKNPRVLAKAQAEVR

EAFRNKVTFDENDVEDLKYLKLVIKETMRLHAPIPLLVPRECRKETEINGYTIPVKTK

VMVNVWALGRDPKYWDDVECFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGTSFGLA

NDYLPLAQLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDDLYLIATPYQP

 

>CYP71D7   Solanum chacoense (Chaco potato)

           GenEMBL U48435 (3107bp)

           Hutvagner, G., Barta, E. and Banfalvi, Z.

           Isolation and sequence analysis of a cDNA and related gene for

           cytochrome P450 from Solanum chacoense.

           Gene 188 (2), 247-252 (1997)

MQLVSIFLFISFLFLLRKWKKYLNNSQTKKLPPGPWKLPFIGGM

HHLAGGLPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFASRPKL

LAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSIRHDEVVRLIDSIQ

PCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLAEGFDVADIF

PSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNLATRKSDDAIGGEDLVDALVR

LMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAKVRE

AFRDKVTFDENDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTIPVKTKV

MVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISFGLAN

VYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLIATPHQP

 

$

 

>CYP71D249 CYP71D.1

iTAG gene:chr04.1488 96% missing C-term and area around frameshift

PGSC0003DMB000000123

423041-424637 (-) strand, one stop codon, possible pseudogene

85% to CYP71D7 potato, 77% to scaffold00510 tomato

424637   MQLVSIFLFLCFLFLLR

424586   KWKKYSNNTQTKKLPPGPWKLPFIGSMHHLAGGLPHRVLRDLAKKYGPLMHLQLGEVSAI  424407

424406   VVTSAEMAKQVLKTHDLAFASRPKFMAMGIIIFYGRCNIAFTPYDEYWRQMRKICVMEVL  424227

424226   SAKNVRSCSSIRHDELVCLIDSIKSSSSSGEPVNFTERIIWFTCSMTCRSAFGQVLKEQE  424047

424046   VFIKLIREVISLAEGLGVADIFPSYKFLHVFSGAKTKILNAHRNVDSIVEDVINEHKK  423873

423872   NLAIRKNGDSLGGEDLIDVLLRLMNDRSLQFPINNDNIKVVIV (0)  423744

423652   DMFIAGTETSSTTIVWSMVEIMKNLSVFAKVQAEVREAFRDKVTFDENDV*ELKYLKL  423479

423478   VIKETLRLHAPVPLLVPRECREETNINGYTIPVKTKFMVNVWAFGRDPKYWDDAESFRP  423302

423301   ERFEQCSVDFIGNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEARD  423122

423121   LDLTELSGITAARKGDLYLIATPYQP*  423041

 

$

 

>CYP71D250 CYP71D.2

iTAG gene:chr04.1493 100% missing C-term

PGSC0003DMB000000123

456358-458214 (+) strand

87% to CYP71D7 potato, 75% to scaffold00510 tomato

456358   MQMVSIFLFLCFLFLLRKWKKYSNNTQTKKLPPGPWKLPFIGSMHHLAGGLSHRVLRDLA  456537

456538   KKYGPLMHLQLGEVSAVVATSPDMAKQVLKIHDIAFASRPSLLATDIICYNRRDIAFIPY (1) 456717

456985   GEYWRQMRKICVMEVLGAKNVRSFSSIRRDEVVRLIDSIQSSSFSGEPVNFTEKIIWFTSS  457167

457168   MTCRSAFGQVLKEQEVFIKLIREVISLTEGFDVADIFPSYKFLHGFGGAKKQLLNAHRKV  457347

457348   DSIVEDVIKEHKKNLATRKSDDSIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVII (0)  457515

         DLFAAGTETSSTTTVWAMAEMFKNPTLLSKAQAEV  457707

457708   REAFRNKVKFGENDVEDLKYLKLVIKETLRIHAPIPLLVPRECREETKINGYTIPMKTKV  457887

457888   MVNVWALGRDPKYWDNAESFKPERFEECSMDFVGNNFEFLPFGGGRRICPGISFGLANIY  458067

458068   LPLAQLLYHFDWKLPTGIEPRDLDLIELSRITASRKGDLYLIVTPYQQ*  458214

 

$

 

>CYP71D7v2 = old CYP71D.3

iTAG gene:chr04.1491 100% missing C-term

PGSC0003DMB000000123

497035-498695 (+) strand

97% to CYP71D7v1 potato, 78% to scaffold00510 tomato

497035   MQLVSIFLFISFLFLLRKWKKYLNNSQTKKLPPGPWKLPFIGSMHHLAGGLPHRVLRDLA  497214

497215   EKYGPLMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPY (1) 497394

497480   GEYWRQMRKICIMEVLSAKNVRSFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSS  497662

497663   MTCRSAFGQVLKEQEVFIKLIREVISLAEGFDVADIFPSYKFLHGFGGAKKKLLNAHRKV  497842

497843   DSIVEDVIKEHKKNIATRKSDDAIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVII (0) 498010

498084   DLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAEVREAFRDKVTFDGNDVEELKYLKLVIKE  498269

498270   TMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQ  498449

498450   CSIDFIGNNFEYLPFGGGRRICPGISFGLANVYFPLAQLLYHFDWKLPTGMEPKDLDLTE  498629

498630   SAGITVARKGDLYLIATPHQP*  498695

 

$

 

>CYP71D6v2 CYP71D.4

iTAG gene:chr04.1492 100% missing C-term

PGSC0003DMB000000123

503303-506910 (+) strand

94% to CYP71D6 potato, 78% to scaffold00510 tomato

503303   MQLISIFLFICFLFLLRKWKKYSKYSQTKKLPPGPWKLPFIGSMHHLAGGLPHRVLRDLA  503482

503483   KKYGPLMHLQLGEVSAVVVTSPDIAKQILKTHDIAFASRPKLLAMDIICYDRCDIAFSPY (1) 503662

505684   GEYWKQMRKICVMEVLSAKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNLTERVIWFTSS  505866

505867   MTCRSAFGQVPKEQDMFIKLIREVISLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKV  506046

506047   DAIVEDVINEHKKNFSTRKNDDHALGGEDLVDVLLRLMNDKSLQFPINNDNIKAIII (0) 506217

         DMFAAGTETSSTTTVWAMAEMLKNPSVLAKAQAEVR  506406

506407   EAFRNKVTLDENDVEELKYLKLVIKETMRLHAPIPLLVPRECREETEINGYTIPVKTKVM  506586

506587   VNVWALGRDPKYWDDVESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISFGLANVYL  506766

506767   PLAQLLCRFDWKLPAGMEPKDLDLTELAGMSVARKGDLYLIATPYQP*  506910

 

$

 

>CYP71D4bP CYP71D.5P

iTAG gene:chr04.1493 100%

PGSC0003DMB000000123

511219-512949 (+) strand

96% to CYP71D4a, 94% to scaffold00510 tomato

insertion after NGAL

511219   MQFLSLASISLSLSFLFLL

511276   RKWKNSNSQSKKLPPGPWKLPLLGSMLHMVGGLPHHVLRDLAKKYGPLMHLQLGEVSA  511449

511450   VVVTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLEL  511626

511627   LSAKNVRSYGSIRRDEVDRLVNLIRSSSGEPVNFIERLFLFTSSMTCRSAFGKVFKEQ  511800

511801   DKFIQLIKEVIGLAGGFDVADLFPSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKN  511980

511981   IAMGKTNGAL  512010

512151   GGEDLIDVLIRLMNDGGLQFPITNVNIKAIIF (0) 512246

512329   DMFAAETETSSSTLDWAMVQMMKNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKL  512502

512503   VIKETLRLHPPVPLLVPRECREETDINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPE  512682

512683   RFEQCSVDFIGNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPIGMEPKDL  512862

512863   NLTELVGVTAARKDDLILVATPYQPPQQ*  512949

 

$

 

>CYP71D4a    Solanum tuberosum cv. Datura (potato)

iTAG gene:chr04.1499 100%

            GenEMBL AJ296346

            Michel Schneider

            56.1% identical to CYP71D1

            induced rapidly by Phytophthora infestans infection or wounding

            (pesonal communication from Michel Schneider)

MQFLSLASIFLFLSFLFLLRKWKNSNSQSKKLPPGPWKLPLLGS

MLHMAGGLPHHVLRDLAKKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPK

LLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYGSIRRDEVDRLVNFI

RSSSGEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIFP

SLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKFAIGKTNGALGGEDLIDVLIRL

MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMMKNPSVIAKAQAEVREA

FKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINGYTIPVKTKVM

VNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGGGRRICPGISFGLANV

YLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATPYEPPRQ

 

>CYP71D4a CYP71D.6

PGSC0003DMB000000123

594529-596119 (-) strand

98% to CYP71D4 potato, 95% to scaffold00510 tomato, 98% to CYP71B.19P

596119   MQFLSLASIFLFLSFLFLLRKWKNSNSQSKKLPPGPWKLPLLGSMLHMAGGLPHHVLRDLA  595937

595936   KKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCP  595760

595759   YGDYWRQMRKICVLELLSAKNVRSYGSIRRDEVDRLVNFIRSSSGEPVNFTERLFLFT  595586

595585   SSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHD  595406

595405   KVDAIVEDVINEHKKNIAMGKTNGALGGEDLIDVLIRLMNDGGLQFPITNNNIKAIIF (0)  595232

595149   DMFAAGTETSSSTLVWAMVQMMKNPSVFAKAQAEVREAFKDKETFDENDVEELKYLKL  594976

594975   VIKETLRLHPPVPLLVPRECREETDINSYTIPVKTKVMVNVWALGRDPKYWDDAESFKPE  594796

594795   RFEQRSVDFVGNNFEYLPFGSGRRICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDL  594616

594615   NLTELVGVTAARKDDLILVATPYEPPRQ*  594529

 

$

 

>CYP71D251P CYP71D.7P pseudogene C-term

PGSC0003DMB000000797

65501-65722 (+) strand

76% to scaffold02227 tomato, 75% to CYP71D7 potato

65501 DNFEYLPFGSGRRMCPGISFGLANVYFPLAQLLYHFDWKLPSGINPSDLDLTKSTGVTCSRESKLYLIVTPYQPCQE* 65722

 

$

 

>CYP71D252P CYP71D.8P

iTAG gene:chr04.1499 73% not the same sequence

PGSC0003DMB000000797

72760-74336 (+) strand

92% to scaffold02227 tomato, 68% to CYP71D7 potato

72760   MHFFNFFSLFLFVSFLFLLV

72820   KYWKNSNTQIRKRLPPGPWKLPLIGSMFHLLGGPPHRVLRDLAKQYGSIIHLQLGEVSLV  72999

73000   VVTSPDMAKQVLKTHDLAFASRPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKICIMELL  73176

73177   SAKNVKSFNSIRQDEVLHMIEFF & 73245

        RSSSGETVNAT &

73277   KRIFQFASSMTCRSAFGKVFKEQDELILLVKKVSHLTEGFDVADIFPSLKFLHVLWGMKG  73456

73457   KIMDVHHELDVILENIINEHKNNGELGGEGLVAALLRVMKEGGHQFPITNDNI  73615

73616   KAIIF (0) 73630

73722   DIFGGGTETSSATIDWTMVEMMRNPNVLSKAQAEVRNKFKGKETFDENDVEELKYLKLVV  73901

73902   KESFRLHPPFPLLLPRECREEVDINGYTIPLKTKVMVNAWAIGRDPKYWNDAESFKPERF  74081

74082   EDNSMDFVGNNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPSGINPSDLDL  74261

74262   TESAGLTCARKSNLYLIAAPHQAE*  74336

 

$

 

>CYP71D252P-de2b CYP71D.8P-de2b

PGSC0003DMB000000797

74785-74916 (+) strand

74785 QLLYHFDWKLPNGINPSELDLTESAGSTCARKSNLYLIATPYQ*  74916

 

$

 

>CYP71D253 CYP71D.9

iTAG gene:chr04.1499 69% not the same sequence

PGSC0003DMB000000797

90390-92243 (+) strand, one frameshift

86% to scaffold02227 tomato, 71% to CYP71D4 potato, 71% to CYP71B38 Populus

90390   MNFLN &

90404   LFSLFLFVSFLFLLL

90449   KYWKNSVTQIRKKLPPGPWKLPLLGSMFHLLGGPPHHVLSDLAKKYGPIMHLQLGEISLV  90628

90629   VVISPDMAKQVLKTHDLAFASRPKLVATDIICYNGSDIVFSPYGEYWRQMRKLCIMELL  90805

90806   SAKNVKSFSSIRQDEVLRMIQFFQSSSGETVNVTEKIFQFASSMTCRSAFGKVFKEKDxxxxxx  90979

90954   LGKYSRKKMNLYKWYKKVSHIMEGFDVADLFPSLKFLHVLCGMKSRIMDVHHELDVILEK  91133

91134   IINEHKNNDELGGEGLVAALIKVMKEGGLQFPIPNDNIKAIIF (0) 91262

91638   DIFAAGTETSSATIDWTMVEMMRHPNVLSKAQEEVRNTFKGKETFDENDVEELKYLKLVV  91817

91818   KESFRLHPPFPLLLPRECREEVDINGYNIPLKTKVMVNAWAIERDPKYWNDAESFKPGRF  91997

91998   EDNSMDFVGHNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINPSELDL  92177

92178   TESAGSTCARKSNLYLIATPY*  92243

 

>CYP71D254P CYP71D.10P pseudogene

PGSC0003DMB000000797

105457-105633 (+) strand

88% to scaffold02227 tomato, 67% to CYP71D4 potato

105457   LSIKNVKSFSSIRQDEVLCMIEFYRSSSGETVNATKRIFEFASSMTYR*AFGKVFKEQD  105633

 

 

>CYP71D255P CYP71D.11P pseudogene joined with CYP71D.12P pseudogene

PGSC0003DMB000000797

106779-107399 (-) strand

91% to scaffold02227 tomato, 72% to CYP71D4 potato

107605-107991 (-) strand

92% to scaffold02227 tomato, 75% to CYP71D4 potato, 97% to CYP71B.8P

108063   MELFNLISISLFVFFLFLLKKLKN

107991   SNSQINKRLPPGPWKLPFVGSMFHMVGGLPHRILRDLAKKYGPIMHLQLGEVSLVVVTSP  107812

107811   IMAKQVLKTHDLAFSSRPRLLASEIVLYNCTDIAFCPYGDYWRHMRKICVLKVLSGKNV  107635

107634   RSFSSIRQDE  107605

107399   DMFAAGTETASTIIDWAMVEMIKNSSILFKAQAEVREAFRGKETFDENIIEKLKYLKLIV  107220

107219   KETLRLHPPLPLMLPRECREVVDIDGYTIPSKTKLIVNVWAIGRDPNYWDDAESFKPERF  107040

107039   EQSSVDFAGNNFEFLPFGSGRRICPGISFGVANVYLPLANLLYHFDWKLPSGIKSSDLDM  106860

106859   TESDGASCTRKSNLHLIMTPYQPSQE*  106779

 

$

 

>CYP71D198 ortholog CYP71D.13v1

iTAG gene:chr04.2003 99%

PGSC0003DMB000001161

14362-15974 (+) strand

89% to CYP198P scaffold04799 tomato, 55% to CYP71D4 potato

14362   MEYQHFPYFIFISLVLFLSSFFLVSQKWKKSKSPNKTLPPGPWRLPFIGNLHQLMSDLPH  14541

14542   RSLRNLSKKYGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCT  14721

14722   DIGFSSYGDYWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISSLRSSTPDSLINLSNK  14901

14902   IFWFTNTVTCRAVSGKIIHDRNKFIMLVKDIYSLIGGFDLTDLFPSQKWLHNISGMKYKL  15081

15082   SKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNEDFVDALLRVMESEEFGPRITNQNIKAVIL (0) 15273

15357   DMFLAGTETASTTLIWAFLELIKNPRVMVKAQLEVRERLNGKKTFNDTDLEELNYLQFVI  15536

15537   KETLRLHPPAPLLIPRECREETKIDGYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERF  15716

15717   ENSSIDFRGNHFEFIPFGAGRRMCPGMLFGLVNIAHPLSQLLYHFDWKVPHGVNPNDLDT  15896

15897   IETEGLTARRKNDLYLIATPFGLSK*  15974

 

>CYP71D.13v2

PGSC0003DMB000000213

1094503-1095120 (-) strand

1 aa diff to CYP71D.13, exon 1 is in a seq. gap

1095120   DMFLAGTETASTTLIWAFLELI

1095054   KNPRVMEKAQLEVRERLNGKKTFNDTDLEELNYLQFVIKETLRLHPPAPLLIPRECREET  1094875

1094874   KIDGYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERFENSSIDFRGNHFEFIPFGAGRR  1094695

1094694   MCPGMLFGLVNIAHPLSQLLYHFDWKVPHGVNPNDLDTIETEGLTARRKNDLYLIATPFGLSK*  1094503

 

$

 

>CYP71D262P CYP71D.14P

iTAG gene:chr04.1899 92% missing region near frameshift and C-term

PGSC0003DMB000000576

5334-10098 (-) strand

87% to scaffold04799, 56% to CYP71D4 potato

10098  MEYQHFPYFIFISLVLFLSSFFLVSQKWKKSKSPNKTLPPGPWRLPFIGNLHQLMSDLPH  9919

 9918  RSLRNLSKKYGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCT  9739

 9738  DIGFTSYYVKSIIFYDCTDIGFTSYGDYWRNMRKVCVLELLSTKMVKSFASIRQEEISNL  9559

 9558  ISSLRSSSSTPDSLINLSNKFFWFTNTVTCRSVSGKIIHDRNKFIMLVKDIYSLIGGFDL  9379

 9378  TDLFPSQ & 9358

       KWLHNISGM &

9332   ESKLSKAHSKVDEILEKIVNDHRDNRAKGNKYNGESGNEDFVDALLRVMESGEFGPPITN  9153

9152   QNIKAVIL (0) 9129

9045   DMFLAGTETASTTLIWAFLELIKNPRVMEKAQLEVRQRLNEKKTFNDTD  8899

5810   TDLEELNYLQFVIKETLRLHPPGPLLIPRECREETKINGYTIPVKTKVLVNAWSIGRDPK  5631

5630   YWHNSESFIPERFENSTNDFKGNHFEFIPFGAGRRMCPGMLFGLVNVAHPLSQLLYHFDW  5451

5450   KVPDGVNPNDLDTIESEGLIARRKSDLYLIATPFGLSK*  5334

 

$

 

>CYP71D261P CYP71D.15P

PGSC0003DMB000000576

15746-16264 (-) strand

81% to scaffold04799,

16264   ISVVLFLSSFFLVSQKWKKSKSPNKTLPPGSWRLPFIGNLHQLMSDLPHRSL  16109

16108   RNLSKKYGPIMHLRLGNISTIIISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCTDIA  15929

15928   FTSYGDYWRNMRKVCVLELLSTKMVKSFASIRQEEISNLISSLRSSSSTPDSLINLSNKLY  15746

 

$

 

>CYP71D260P CYP71D.16P

iTAG gene:chr04.1905 81% not the same sequence

PGSC0003DMB000000576

35086-36699 (-) strand

87% to scaffold04799

36699   MEYQHFPYFIFISLVLFLSSFFLVSQKWKKSKSPNKTLPPGPWRLPFIGNLHQLMSDLPH  36520

36519   RSLRNLSKKYGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCT  36340

36339   DIGFTSYGDYWRNMRKVCVLELLSTKMVKSFASIRQEEISNLISSLRSNTPDSLTNLSNK  36160

36159   IFWFTNTVTCRSVSGKIIHDRNKFIILIKDVFSLIGGFDLTDLFPSQKWLHNISGMKYKL  35980

35979   SKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNEDFVDALLRVMESEEFGPPITNQNIKAVIL (0) 35788

        DMFLAGTETTSTTLIWAFLELMKNPRVMEKAQLEVRERLNGEK &

        TFNDTDLEELNYLQFVIKETLRLHPPGPLLIPRECREETKIN  35449

35448   GYTIPVKTQVMVNAWSIGRDPKYWHNSESFIPERFENSSIDFRGSHFEFIPFGAGRRMCP  35269

35268   GTLFGLVNVAHPLSQLLYHFDWKVPHGVNPNDLDTIETEGITARRKNDLYLIATPFGLYK*  35086

 

$

 

>CYP71D259P CYP71D.17P

iTAG gene:chr04.1902 90% not same sequence

PGSC0003DMB000000576

46783-48156 (-) strand

87% to scaffold04799

48156   MESQHLSFIIFISIVLFLYSFFLLSQKWKKSKSPNKKLPPGPWRLPFIGNLHQLMSDLPH  47977

47976   RSLRNLSKKYGPIMHLRLGDISTIVVSSSEMAKEIMKTQDLYFVDRPQIMSASIIF & 47809

47807   YDCTDIALSPYGDYWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISSLSYSTPDSLI  47631

47630   NLSNKIFWFTNTVTCRSVSGKIIHD*NKFIMLVKDIYSLIGGFDLTDLFPSQKWLHNISG  47451

47450   MKSKLSKAHSKVDEILEKIVNDHRDNRAKGKKYNGESGNEDFVDALLRVMESEEFGPPIT  47271

47270   NQNIKAVIL (0) 47244

        DMFLAGTESN &

47130   TTIIWAFLELMKNPRVMEKAQLEVRERLNGKKTFNDTDLEELNYLQFVIKETLRLHPPVP  46951

46950   LLVPRECREETKINGYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERFENSSIDF  46783

 

$

 

>CYP71D258 CYP71D.18

iTAG gene:chr04.1905 100% missing C-term

PGSC0003DMB000000576

86163-87802 (-) strand

68% to scaffold04799 tomato

87802   METQQLPLIFFISLLLFLYFIFYLFQIWKKSKTLTKKLPPGPWKLPIIGNLHQLASHGGL  87623

87622   PHHTLRTLSQKYGPLTHLQLGEISAIVVSSPEMAKEIMKTQDVRFATRPQSMTGSIIFYN  87443

87442   YSDIALCPYGDYWRNMRKICVLELLSAKMVKSFNSIRQEEMSSLVSSIINSTPDESLVNL  87263

87262   SNKIFWFTGSVTCRSAFGKVVHDQDKLIMLVKEAVSLSSGFDLTDLFPSHKWLHGISGMK  87083

87082   SRLLKAHEKVDVILEKLINEHCENRANGNKGNGESGAEDLIDVLLRVMESGEFGMPITNQ  86903

86902   NIKAVIF (0)  86882

86780   EMFMAGAETSSTTIIWAFSEMIKNPGVMAKAQLEVREAFKGKKTFEDIDLEELKYLKLVI  86601

86600   KETLRLHPAAPLLIPRECREETQIDGYNIPIKTKVIVNAWAIGRDSRYWHDDPESFIPER  86421

86420   FENSSIDFRGNNFEFIPFGAGRRMCPGMLSGLATVGHSLAKLLYHFDWKLPDGVSVDDFD  86241

86240   MTEAEGVAASRKNDLCLIATPFDLS*  86163

 

$

 

>CYP71D257P CYP71D.19P

PGSC0003DMB000000576

155917-156084 (-) strand

76% to scaffold04799 tomato

156084 MEYQHLPYFIFISLVLFLSSFFLVSQKWKKSKSPNKTLPPGPWKLPFIGNLHQLMS  155917

 

$

 

>CYP71D256P CYP71D.20P

iTAG gene:chr04.1906 89% missing regions around two frameshifts

PGSC0003DMB000000576

191874-193206 (-) strand

89% to scaffold04799 tomato

193206   KKYGPIMHLRLGNNSTIVVSSSEMAKEIMKTQDLHFVDRPQIMSTSIILYDCTDIAFSSY  193027

193026   GDYWRNMRKVCVLELLSTKMVKSFASIRQEEISNLISSLRS & 192904

192904   QFIHDRNKFIMLVKDICSLIGGFDLTDLFPSQKWLHNISGMKSKLSKAHSKVDEILEKII  192725

192724   NDHRDNRAKGKKYNGESGNEDFVDALLRVMESEEFGLPITNQNIKAIIL (0) 192578

192489   EMFLAGTETASTTIIWAFLELMKNSRVMEKAQLEVRERLDGKKTFNDSDLEELNYLQFVI  192310

192309   KETLRLHPPAPLLFPRECREETKIDGH & 192229

192230   TIPVKTKVLVNAWSIGRDPKYWHNSESFIPERFENSSIDFRGNHFEFIPFGAGRRMCPGM  192051

192050   LFGLVNVARPLSQLLYHFDWKVPHGVNPNDLDTIETEGLTARRKNDLYLIATPFGHSN*  191874

 

$

 

>CYP71D189b ortholog CYP71D.21

iTAG gene:chr03.2702 100%

PGSC0003DMB000000026

1435151-1436760 (-) strand

66% to scaffold04799 tomato, 58% to CYP71D4 potato

1436760   MEIQHLLFIFASLLLFLSLILLLWKQSKTLNKKLPPGPWRLPFIGNLHQLMNGRLPHHT  1436584

1436583   FRDLSQNYGPIFHLRLGEVSHVVVSSPDIAKEIMKIQDLNFATRPQLMVGEIIMYNYSDI  1436404

1436403   GTCPYGDYWRSMRKVCILELLSTKMVKSFDSIRQAEMSSLISSINSMPDSLINLSDKIF  1436227

1436226   WFTGSVTCRSAFGKIINGQDKLIMLIKDITLLAGATELADLFPSRKWLHQIYGLKSKILK  1436047

1436046   VHKEADVILENIINEHQKNRANGKKGNSEYGGEDLVDVLLRVMESGELGTPITNNNIKAVIF (0)1435861

1435759   DMFVAGAETSSAIIIWALAEMIRNPSIMAKAKFEVREVLKGKTIFEDTDLEEL  1435601

1435600   KYLKLVIKETLRLHPPFPLLLPRECREETRIGEYTIPIKTRVLINAWAIGRDPEYWHNPE  1435421

1435420   SFIPERFDNSSIDFRGNHFEFIPFGAGRRMCPGWLFGLMNVEHPLAQLLYHFDWRTPYEG  1435241

1435240   PLENFDMTETDGITAIRKDDLCLIATPFD*  1435151

 

$

 

>CYP71D264 CYP71D.22

iTAG gene:chr03.2703 100% missing C-term

PGSC0003DMB000000026

1439837-1441508 (-) strand

67% to scaffold04799 tomato, 59% to CYP71D4 potato

1441508   MELLLFIITSLVLFLSFILLLRKQSKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHHTFRDLSRK  1441317

1441316   YGPIFHLRLGEVSHVVVSSPDTAKEIMKIQDLHFATRPQLLFGEIIMYNHSDIGTCPYGD  1441137

1441136   YWRNMRKVCTLELLSTKMVRSFDSIRQAEMSSLISSINSMPDSLINLTDKIFWFTGPVT  1440960

1440959   CRSAFGKIIHGQDKLIMLLKDITLLAGGFDLTDVFPSRKWLHGICGLKSKILKVHNEMDA  1440780

1440779   ILENIINEHCRNRANGKKGNSESEGEDLIDVLLRVMESGELGTPITNNNIKAVIF (0) 1440615

1440451   DMFLAGAETSSTTIIWAFAEMIRNPSIMAKAQLEVREVLKGKKVFEDIDLEEL  1440293

1440292   KYLKLVIKETLRLHPPLPLLLPRECREETRIGEYTIPIKTRVLVNAWAIGRDPKYWHNSE  1440113

1440112   SFIPERFDNSSIDFRGNHFEFIPFGAGRRMCPGWLFCLMNVEHSLAQLLYHFDWKSPYEG  1439933

1439932   PLENFDMTVTNGATARRKDDLCSIATPFDLS*  1439837

 

$

 

>CYP71D263P CYP71D.23P

iTAG gene:chr03.2704 98% missing the C-term

PGSC0003DMB000000026

1447497-1448536 (-) strand

68% to scaffold04799 tomato

1448536   MELLFIFTSLVLFLSFILLLRKQSKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHYTFRDLSRK  1448348

1448347   YGPIFHLRLGEVSHVVVSSPDTVKEIMKIQDLHFSTRPQLLFGEIIMYSHSDIGTCPYGD  1448168

1448167   YWRNMRKVCILELLSTKI  1448114

1448098   DMFIAGAETSSAIIIWALAEMIRDPRTMAKAQFEVRQVLKGKTIFEDTDLEELKYLKLVI  1447919

1447918   KEMLRLHLPFPLLLPRECREETRIGGYTIPVKTRVLINAWAIGRDPEYWHNPESFIPERF  1447739

1447738   DNNHIDFRGNHFPLV & 1447694

1447703   PFGAGRRMCPG*LFGLMNVEHPLAQLLYHFDWKTPYEGPPESFDMTETDGVTAIRKDDLC  1447524

1447523   LIATTFDL*  1447497

 

$

 

>CYP71D189a CYP71D.24v1

iTAG gene:chr03.2706 96% missing region around stop codon

PGSC0003DMB000000026

1455567-1457177 (-) strand, one stop codon, possible pseudogene

66% to scaffold04799 tomato, 96% to CYP71D.21

1457177   MELLFTITSLLLFLSLILLLWKQS

1457105   KTLNKKLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQNYGPIFHLRLGEVSHIVVSSPD  1456926

1456925   IAKEIMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLSTKMVKS  1456746

1456745   FDSIRQAEMSSLISSINSMPDSLINLSDKIFWFTGSVTCRSAFGKIINGQDKLIMLIKD  1456569

1456568   ITLLAGATELADLFPSRKWLHQIYGLKSKILKVHKEADVILENIINEHQKNRANGKKGNS  1456389

1456388   EYGGEDLVDVLLRVMESGELGTPITNNNIKAVIF

          DMFVAGAETSSAIIIWALAEMIRNPRIMAKAQFEVRQVLKGKTIFEDTD  1456029

1456028   LEELKYLKLVIKETLRLHPPLPLLLPRECRAETRIGEYTIPIKTRVLINAWAIGRDPEYW  1455849

1455848   HNPKSFIPERFDNSSIDF*GNHFEFIPFGAGRRMCPGWLFGLMNVEHPLAQLLYHFNWKT  1455669

1455668   PYEGPLESFDMTETDGVTATRKDDLCLIATPFD*  1455567

 

>CYP71D.24v2

PGSC0003DMB000004115

Scaffold is only 865 bp

100% to CYP71D.24

  3   SLLLFLSLILLLWKQSKTLNKKLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQNYGPIFHLRLGEVSHIV  215

216   VSSPDIAKEIMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLST  395

396   KMVKSFDSIRQAEMSSLISSINSMPDSLINLSDKIFWFTGSVTCRSAFGKIINGQDKL  569

570   IMLIKDITLLAGATELADLFPSRKWLHQIYGLKSKILKVHKEADVILENIINEHQKNRAN  749

750   GKKGNSEYGGEDLVDVLLRVMESGELGTPITNNNIKAV  863

 

$

 

>CYP71D208 ortholog CYP71D.25

iTAG gene:chr07.1451 100%

PGSC0003DMB000000652

225730-227358 (+) strand

94% to CYP71D208 scaffold05390 tomato, 59% to CYP71D4 potato

225730   MDFQHLVFFFLFISFLFLLI

225790   QKWRKPKTRLPPGPWRLPIIGSVHHLTSGLPHQVLKKLSQKYGPIMYLQLGEVPTVVVSS  225969

225970   SHMAKQILKTHDLAFASRPETMLGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMV  226149

226150   KSFSPIRQDELSNLLSSIRSMDLNLPINLVEKLLWFMNAATCRSAFGNVCKDQRELIKLI  226329

226330   HQAQSLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDAVLDNIINVHRDNRANGKSC  226509

226510   NGESGTEDLIDVFLRVMESGQFPVSLTNDNIKAVLL (0)

226735   DMFVAGSDTSSSTVIWALSEMMRNPNIMEKAQVEVREVFKGKKTC  226869

226870   DDDTDLENLSYLKLVIKETLRLHPPTPLLVPRECREETEIDGFTIPLKSKVMVNVWAIGR  227049

227050   DPENWENPECFIPERFENSSIEFTGNLFEFLPFGAGRRICPGIQFGLALITLPLAHLLYN  227229

227230   FDWKLPEGISASNLDMTEANGISARREKDLYLIATPYVSPLH* 227358

 

$

 

>CYP71D187 ortholog CYP71D.26

iTAG gene:chr02.480 100% missing C-term

PGSC0003DMB000000378

201986-203576 (-) strand

97% to scaffold03494 tomato, 62% to CYP71D4 potato

203576   MEIQFTNLVAFLLFLSTILLLL

203510   KKWKTQNLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKCYGALMHLQLGEIPTVII  203331

203330   SSPRMAKEVLKTHDLVFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAK  203151

203150   MVKFFSSIRQDELSKMVSSIRTMPNNLPVNLTDKIFWFTSSVTCRSALGKICCDQDKLI  202974

202973   IFMREIISLAGGFSVADFFPTWKMLHDVGGSKTRLVKAHRKIDEILENVVNEHKQNRADG  202794

202793   KKGNGEFGGEDLIDVLLRVRESGEVQIPITDDNIKAILV (0)  202677

202597   DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLK  202427

202426   LVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSP  202247

202246   ERFENSSIDFLGSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHEN  202067

202066   LDLTESPGISATRKDDLVLIATPYDP*  201986

 

$

 

>CYP71D265 CYP71D.27P

iTAG gene:chr06.1405 93% retains intron, missing N-term due to frameshifts

PGSC0003DMB000000579

18149-19747 (+) strand

74% to scaffold05575 tomato, 61% to CYP71D.26

18149   MEINYSLASLLLLLVLSF &

        VIRQWRNKN &

18239   KLPPGPWKLPFIGSLHHLIGGGLPHRVLRNLSQRYGPIMYLQLGEVPTVVISSPTMAKQV  18418

18419   LKTHDLAFANRPQLTSTNIIFYNNKDIAFSQYGDYWRQMRKICILELLSTKMVKSFGAIR  18598

18599   QDELSSLISSLRSMSGSTINMTEKIFLLSNCITCRSAFGKICKDRDEFITIMKEVLLLG  18775

18776   AGFFLADLFPSCKLLHNITGEKTRMVNAHKKVDVILEEILNEHIENKAAGKKVNGEFGDE  18955

18956   DLVDVFLRVKENAELQFPITNDNIKAVIF (0)

19125   DIFLAGTETSFTVLVWAFTELMKNPHIMAKAQSEVRRVFKGKKSYDEKDIEKLTYLNLVIKET  19315

19316   LRLHAPVPLLAPRECREQTDIDGYTIPISTRIIVNGWAIGRDPESWHDPDNFIPERFENS  19495

19496   SVDYIGNHFEFIPFGAGRRICPGMIFGLANIGLPLAQLLYHFDWKLPNGTNPNDLDMTET  19675

19676   HGLSAARVKDLYLIVVDHKNDEE* 19747

 

$

 

>CYP71D266 CYP71D.28

iTAG gene:chr06.1406 100%

PGSC0003DMB000000579

21735-23347 (+) strand

73% to scaffold05575 tomato, 97% to CYP71D.30P

21735   MEMFNSFLSNLVLLLLFLSSLILI

21807   VKKWSKPKNRNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGE  21986

21987   VPTVVISSTTIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTL  22166

22167   ELFSIKMIKLFSAIREDELTSLISSIRSMRGSPVNMTKKIFLFTNCIICRSAFGKVCKDR  22346

22347   GEFLTTLKEVLLLAAGFFMADLYPSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEHIEN  22526

22527   KAAGKKGNGEFGDEDLVDVLLRVKENAELQYPITNDHIKAVIF (0) 22655

22724   DIFLGGTGSSSSTIIWALSEMIKNPNVMIKAQSEVRQVFKGKQNFSEEEVENLTYLKSVI  22903

22904   KETLRLHTPAPLLGSRECREQRVIDGYTIPLKARVLVNAWALARDPESWDDPENFIPERF  23083

23084   ENSSIDFMGNHFEFIPFGSGRRVCPGLLLGVANVIHPLAQLLYHFEWELPNGTNPEDLDM  23263

23264   TETHGLTAEKKENLYLIAIDYRNNEEF*  23347

 

>CYP71D.28v2

PGSC0003DMB000035926

2-121 (-) strand

100% to CYP71D.28

121   VLVNAWALARDPESWDDPENFIPERFENSSIDFMGNHFEF  2

 

$

>CYP71D266-de2b CYP71D.28-de2b

PGSC0003DMB000000579

23834-23902 (+) strand

23834   DLDMTETHGLTAEKKENLYLIAI  23902

 

$

 

>CYP71D267P CYP71D.29P

iTAG gene:chr06.1405 84% not the same sequence

PGSC0003DMB000000579

104902-106471 (+) strand

72% to scaffold05575 tomato

104902   MEINYSLASLLLFLSSLLIVIRQWRNKKQNKLPPGPWKLPFIGSLHHLIGGGLPHRILRN  105081

105082   LSQRYGPIMYLQLGQVPTVVISSPTMAKQVLKTHDLAFANRPQLTSTSIIFYDNKDIAFS  105261

105262   PYGDYWRQMRKICILELLS & 105318

105321   KSFGAIRQEELSSLMSSLRSMSGATINMTEKIFLLSNCITCRTAFGKICKDQDKFITIMK  105500

105501   EVLILGAGFFLADLFPSWKLLHNIRSEKTRMVNAHKKIDVILEEILNEHIENKAAGKKGN  105680

105681   GEFGDEDLVDVFLRVKENADLQFPI &

         QSKAVIF

105852   DIFLAGTETSFTVLV & 105896

105896   VWVFTELMKNPHIMAKAQSEVRRVFKGKKSYDEKDIEK  106009

106010   LTYLNLVIKETLRLHAPVPLLAPREQTVIDGYTIPINTRVIVNGWTIGRDPESWDDH  106180

106181   DNFIPERFENSSVDFIGNHFEFIPFGAGRRICPGMVFGLANVELPLAQLLYHFDWKLPNG  106360

106361   TKPNDLDMTETHGLSAARAKDLYLIVVDHKNDEEKF*  106471

 

$

 

>CYP71D268P CYP71D.30P

iTAG gene:chr06.1414 95% missing region around frameshift and N-term

PGSC0003DMB000000579

108555-110180 (+) strand

72% to scaffold05575 tomato, 97% to CYP71D.28

108555   MEMFNSFLSNLVLLLLFLSSLILI

108627   VKKWSKPKNRNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGE  108806

108807   VPTVVISSTTIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMH*ICTS  108986

108987   ELFSIKMIKLFSAIREDELMSLISSIRSMRGSPVNMTKKIFLFTNCIICRSAFGKVCKDR  109166

109167   GEFLTTLKEVLLLAAGFFMADLYPSWNLLHNLRGEKTRMVNAHKKVDAVMKEILNEHIEN  109346

109347   KAAGKKGNGEFGDEDLVDVLLRVKENVELQYPITNDHIKAVIF (0) 109475

109556   DIFLGGTGSSSSTIIWALSEMIKNPNVMIKAQSEVRRVFKGKQNFSEEEVENLTYLKSVI  109735

109736   KETLRLHTPAPLLGSR & 109783

109785   ECREQTVIDGYTIPLKARVLVNAWALARDPESWDDPENFIPERFENSSIDFMGNHFQFIP  109964

109965   FGSGRRVCPGLLLGFANVIHPLAQLLYHFEWELPNGTNPKDLDMTETHGLTTEKKENLYL  110144

110145   IAIDYRNNEEF*  110180

 

>CYP71D.30Pv2

PGSC0003DMB000032821

3-119 (+) strand

1 aa diff to CYP71D.30P

3   FIPFGSGRRVCPGLLLGFANVIYPLAQLLYHFEWELPNG  119

 

$

 

>CYP71D206 possible ortholog CYP71D.31v1

iTAG gene:chr06.1784 100%

PGSC0003DMB000000593

36359-37988 (-) strand

95% to scaffold02597 tomato

37988   MEMNLVSFLLLFSFLLIIF

37931   RKWRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVTYLELGEVPTVII  37752

37751   SSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAK  37572

37571   MVKSFSSIRKDELSSVLSSMDSVGGSCEVNMTEKIVRFTSSVTCRLVFGKLCRDRDELIN  37392

37391   LMKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRVAGI  37212

37211   KGNGAYGGEDLVDIFLRIKENDQLQFPIINDHIKAVIL (0) 37098

36982   DMFTAGTETSSTTIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVI  36803

36802   KETLRLHAPSIVHRECREETIVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERF  36629

36628   ENSPIDYLGNNYEFLPFGAGKRICPGMQFGLANVKQPLARLLYHFNWGLPCGINTPKDLD  36449

36448   MSEKSGLSAAKEKDLYLIAKTNQSLDIML* 36359

 

>CYP71D.31v2

PGSC0003DMB000047967

3-110 (+) strand

100% to CYP71D.31

3 DLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMR  110

 

$

 

>CYP71D205 ortholog CYP71D.32

iTAG gene:chr06.1785 100%

PGSC0003DMB000000593

40856-42679 (-) strand

89% to scaffold02597 tomato

42679   MEIIYSSTYNFVALLILFSFLFTLFDKLLRKSLAKQEKLPPGPWRLPIIGSLPIIGSLHH  42500

42499   LRGALLFPHRTLKNLATKYGPIMYLQLGEIRAVIVSSPNMVKEILKTHELAFATKPQLTS  42320

42319   IDITTYNYKDIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDEIMRLLSSIRSTNG  42140

42139   SHLVNLTELILRYTNSVTCRSAFGKVYTNQDQLINLLRDVLDTLGGFDVADLFPSWKLLH  41960

41959   KMSGVKSKLLKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGGEDLVDVLLRVKENGE  41780

41779   LQFPITSDHIKAIIS (0)  41735

41476   DMFAAGTETSAATIIWALSEMMRRPNIMAKAQNEVRQVFKGNTT  41345

41344   INEDDLDKLIYLKLVIKETLRLHPPSTLLPRECRKQTYINGYTIPPKTRVLINTWALGR  41168

41167   DSESWDDTESFIPERFENSHVDYMGNYFEFIPFGSGRRICPGMQFGLTNVKHPLAQLLYH  40988

40987   FDWVLPYGANPEDLDMIEKNGLSAAKHKDLCLIAIEHKDDGKV*  40856

 

$

>CYP71D209 ortholog CYP71D.33

iTAG gene:chr08.1295, 100%

PGSC0003DMB000000191

634872-636474 (+) strand

95% to scaffold00777 tomato

634872   MEIQLSLFNLFPLFLFFSFLFILL

634944   KKWNTKLTKLPPGPWRLPLIGSLHHLKGKLPHHNLRDLARKHGPLMYLQLGEVPVVVIS  635120

635121   SPRIAKAVLKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKM  635300

635301   LKSYNMIRKDELSKLLSSIRLSTGSAVNITEKLLWFTSCMTCRLAFGKICNDRDELIMLI  635480

635481   REILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKG  635660

635661   NNEFGGEDMIDALLRVKENNELQFPIENDNMKAVIL (0)  635768

635857   DLFIAGTETSYTAIIWALSEMMKHQNVMAKAQAEVRQVFKEKENLDENDLDKLPYLKSVI  636036

636037   KETLRMHPPVPLLGPRECREQTEIDGYTVPLNARVMVNAWAIGRDPESWEDPESFKPERF  636216

636217   ENISVDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQFLYQFDWKLPDKVNANDFST  636396

636397   TETSRVFAASKDDLYLIPANPREQE*  636474

 

$

 

>CYP71D273P CYP71D.34P

PGSC0003DMB000000158

228855-228956 (-) strand

85% to scaffold00508 tomato

228956   EFGYEDLVDVFLRMKENAELQFPITNDPIKAVIF  228855

 

$

 

>CYP71D272P CYP71D.35P

iTAG gene:chr06.2052 90% missing regions around stop codons and frameshifts

PGSC0003DMB000000158

1271167-1272789 (-) strand

91% to scaffold02597 tomato

1272789   MEMNLVSFLLLFSFLYIIFRKWRRSQK*NLPPGPWRLPLIGSLHHLISGHNPHRIF  1272622

1272621   RDLARKYGLVMYLELGEVPTVIMSSPSTSKQVLKTHDLAFASRPQFTSIDIVMYNNKDIA  1272442

1272441   FAEYGDYWKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSSIDSVGGSSEVNMT*KIVR  1272262

1272261   FTSSVTCRLVFGKLCRDRDELINLMKDALFFVGGFDVGDFFPSWKLLYKMSGAKSKLVKM  1272082

1272081   HQNIDSVLERIVNEHIKNRATGIKGNGAYGGEDLVDVFLRIKENDQLQFPITN &  1271923

          HIKAVIL (0)

          DMFTAGTETSSTTIIWALSELMK  1271722

1271721   HPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKETLRLHAPSIVHRECREETI  1271548

1271547   IDGCTIPTKATVLVTTWAIVRDPEVWDDPKSFIPERFKNSTIDYLGNNYEYLPFGAGKRI  1271368

1271367   CLGMQFGLANVKQPLARLLYHFDWGLPCGTSTPKDLDMSEKSGLSAAKEKDLYLIAKTNQSLDVML* 1271167

 

$

 

>CYP71D271P CYP71D.36P

iTAG gene:chr06.2053 84% missing region around internal stop codon

PGSC0003DMB000000158

1289185-1290245 (_) strand

90% to scaffold02597 tomato

1290245   KLCRDRDELINLMKDALFLVGGFDVGDFFPSWKLLHKMSGAKSKLVKMHQNVDSVLERIV  1290066

1290065   NEHIKNRAAGIK*NGAYGGEDLVNVFLRLKENDQLQFPITNDHIKAVIL (0) 1289919

1289808   DMFTAGTETSSTTIIWALSELMKHPKIMAKAQSEVIQAFKEKIDFDEEDLDNLPYLKLVI  1289629

1289628   KETLRLHAPSIVNRECREATIIDGCTIPAKATILVNTWAIGRDPEVWDDPESFIPERF  1289455

1289454   ENSTIDYLGNNYEYLPFGAGKWIWPGMQFGLANVKQPLARLLYHFDCGLPCGTSTPKDLD  1289275

1289274   MSEKSGLSAAKEKDLYLIAKTNQSLDIML* 1289185

 

$

 

>CYP71D270P CYP71D.37P

PGSC0003DMB000000158

1300373-1300828 (-) strand

89% to scaffold02597 tomato

1300828   ELEKNFLEIIDFDEEDLDNLPYLKLVIKETLRLHAPSIVHRECQDETIVDGYTIPVKA  1300655

1300654   TVLVNTWAMGRDPEVWDDPESFTPERFENSPIDYLGNNYEFLPFGAGKRICPGMQFGLAN  1300475

1300474   VKQPLARLLYHFNWGLPCGTNTPKDLDMSEKVD* 1300373

 

 

>CYP71D269P CYP71D.38P

iTAG gene:chr06.2055 89% missing the N-term

PGSC0003DMB000000158

1334968-1336743 (-) strand

Cyan is a duplication, 87% to scaffold02597 tomato

Yellow region may be framesifted

1336743   MEMNLVSFLLLFSFLYIIFRKWRRSQK*NLPPGPWRLPLIGSLHHLISGHNPHRIF  1336576

1336575   RDLARKYGPVTYLELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIA  1336396

1336395   FAEYGD  1336378

1336378   LARKYGPVTYLELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAF  1336202

1336209   LHFAEYGDYWKQM & 1336173

1336169   RKICIMELLSAKMVKSFSSIRKNELSSVLSSIDYVGGSSEVNMTEKIVRFTSSVTCRLVF  1335990

1335989   GKLCRDHDELINLMKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDSVLERI  1335810

1335809   VNEHIKNRAAGIKGNGAYGGEDLVDVFLRIKENDQLQFPITNDHIKAVIL (0) 1335660

1335552   DMFTAGTESSSTTIIWALSELMKHPKIMAKAQSKVRQAFKEKIDFDEEDLDNVPYLKLVI  1335373

1335372   KETLRLHAPSIVHRACREETIIDGCTIPAKATVLVNTWAIGRDPEVWDDPESLYQRD  1335202

1335201   LKILY*LFGK*L*VSPVWCRKTDCPGMQFGLANVKQPLARLLYHFDWGLPCGTSTPKDLD  1335022

1335021   MSEKSGLSAAKEKDLYLI  1334968

 

$

 

>CYP71D225 CYP71D.39

iTAG gene:chr08.1750 100% fusion of two P450s,

this one is the second half of the fusion, missing C-term

PGSC0003DMB000000144

1051634-1057472 (-) strand

74% to scaffold00777 tomato

1057472   MEILHFHFNLISILLFFFILFIVVRKWKEMNQSLLPPGPWKLPVIGSLHHLIGALPHHVF  1057293

1057292   TKIAKKYGPLMHLKLGEVDAVVVSSPHLAKEILKVHDLSFAARPKLVASDIVFYRQKDIA  1057113

1057112   FAEYGDYWKQMRKICISELLSAKMVKLFSLIRQDEVHNLVTSIRSTPDDVVNMTEKALQL  1056933

1056932   TSSVICRSAFGKVWDDRDNLLMIMREVLDLLAGFDVMDLFPSWKLLHQISGKRNRLMNMH  1056753

1056752   HKLDVILENIINDHKQNKENGEKGNNEFEGEDLIDVLLRVMENDELRFPMTNDNIKAVIL (0) 1056573

          DMFFGGTETSATTIQ  1056393

1056392   WALSELMKNSYVMDKAQAEVRCACKGKKDLDDNDLEKLKYLKLVIKETLR  1056243

1052065   LQLHPPGPLLTPRECREETTIGGYTIPL*TKVIVNCWAMARDPESWDDPEDFVPERFENS  1051886

1051885   SVDFKGNHYQFIPFGAGSRICPGMQYSLADVMYPLAKLLYHFDWKLPNGKQPEDLDMTET  1051706

1051705   FGITANRKNDLYLIAIPHDLSKY* 1051634

 

$

 

>CYP71D213 CYP71D.40

iTAG gene:chr08.1750 100% fusion of two P450s,

this is the first half of the fusion protein, missing the N-term 29 aa

PGSC0003DMB000000144

1058161-1059754 (-) strand

75% to scaffold00777 tomato

1059754   MEILHFYFKLIPILLVFFILFLLVRKWKEMNQRLLPPGPWKLPLIGSLHHLIGALPHH  1059581

1059580   VLRNLSKKYGPLMHLKLGEIDAVIVSSPHLAKQVLKVHDLSFAARPKLVASDIVFYRQND  1059401

1059400   IAFAEYGDYWKQMRKICTSELLSSKIVKSFSLIRQDEVHNLVASICSMPNVVVNMSEKVL  1059221

1059220   QLTSSVICRSAFGKVWDDRDNLLMIMRELLALLAGFDVVDLFPSWKLLHKISGKRNRLMN  1059041

1059040   MHYKLDVILENIINDHKQSKANGGKGNNEFEGENLIDVLLRVMENDELQFPMTNDNIKAVIL (0) 1058855

1058781   DIFFRGTETSATTIQWTLSELMKNPNVMAKVQEEVRKTFDRKKVYDDNILKELKYLKLVI  1058602

1058601   KETLRLHPPGPLLPPRECREETTIEGYTISLKTKLIVNCWAMGRDPESWDDPENFMPERF  1058422

1058421   ENSCVDFKGNHYQFIPFGAGSRMCPGMHFGLANVVYPLAQLLYHFDWQLPYGQQPEDLDM  1058242

1058241   TETLGLSATRKHDLRLIAIPHDLSQY* 1058161

 

$

 

>CYP71D224 CYP71D.41

iTAG gene:chr08.1751 95% missing C-term and region around stop codon

PGSC0003DMB000000144

1062930-1065080 (-) strand, one stop codon

87% to scaffold00777 tomato

1065080   MHEIHFNTVSFLLFFFLLLV

1065020   IFIRKSKKTNQRLPPGPWKLPIIGSIHHLIGALPHHVLRNLSKKYGPLMHLQLGEINAVI  1064841

1064840   VSSPHMAKQVLKVHDLSFAERPELIASDIVFYRQKDIVFARYGDYWKQMRKICISELLSA  1064661

1064660   KMVKSFSLIRQDEVHDLVASIRSYA*NVVVNISEKVLRLTSSVICRSAFGKVWDDRDNLL  1064481

1064480   MLMREVLSLTGGFNVYDFFPSWTLLREISGTRSRLMSMHKKIDVILEKIIHEHKEE  1064313

1064312   KGRGEFGGEDLIDVLLRVMENGELRFPITNDNIKAVIL (0)  1064199

1063535   DLFFGGTETSSVIIQWALSELMKNPNVMTKAQAEVRCVCKGKKDLNDNDVEELKYL  1063368

1063367   KLVINETLRLHPASPLLGLRQCREETQIDGYTIPLRAQVIVNGWAIARDPESWDDPETFV  1063188

1063187   PERFENSGVDFKGNHFQYIPFGAGSRMCPGMHFGLANVVYPLAQLLFHFDWKLPYGQQPE  1063008

1063007   DLDMTETLGISATRKNDLHLIAIPQ*  1062930

 

>CYP71D.41v2

PGSC0003DMB000017669

2-172 (+) strand

100% to CYP71D.41

2   RPELIASDIVFYRQKDIVFARYGDYWKQMRKICISELLSAKMVKSFSLIRQDEVHDL  172

 

$

>CYP71D224-de1b CYP71D.41-de1b

PGSC0003DMB000000144

1065583-1065729 (-) strand

1065729   KKRPLMHLQLGEVDAVLVV*SLHFAK*IPKVHGLSLAAWPELMVFDILF  1065583

 

$

 

>CYP71D212 CYP71D.42

iTAG gene:chr08.1752 88% exon 2 matches 100% but exon 1 is CYP71D211

PGSC0003DMB000000144

1070639-1072671 (-) strand, one frameshift

86% to scaffold00777 tomato

1072671   MEILHFHFNSVSFLLFFFLLLVLFFRKSKKSNQ

1072572   RLPPGPWKLPIIGSIHHLIGALPHHVLRNLSKKYGPLMHLQLGEINAVIVSSPHMAKQVL  1072393

1072392   KVHDLSFAARPELIASDIVFYR & 1072327

1072327   SKSIVFARYGDYWKQMRKICISELLSAKMVKSFSLIRQDEVHDLVASIRSTPNVVVNMSE  1072148

1072147   KVLRLTSSVLCRSAFGKVWDDRDYLLMIMREVLPLLGGFDVADFFPSWTLLHEISGTRSR  1071968

1071967   LMSMHNKIDVVLEKIIHEHKVNQPNEEKGHGEFGGEDLIDVLLRVMENGELRFPFTNDNVKAIIL (0) 1071773

1071247   DMFFGGTETSSTTIQWALSELMKNPNVMTKAQAEVRCVCKGKKDLNDNDVEELKYLKLVI  1071068

1071067   NETLRLHPASPLLGLRQCREETKIDGYTIPLKAQVVVNGWAIARDPESWDDPETFVPERF  1070888

1070887   ENSCVDFNGNHFQYIPFGAGSRMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLDM  1070708

1070707   TETLGISATRKNDLHLIAISHD*  1070639

 

$

>CYP71D212-de1b CYP71D.42-de1b

PGSC0003DMB000000144

1084500-1084610 (-) strand

1084610   GEVDAVLVVSSPHLAK*ILKVHDLSFAARLEFMVFDI  1084500

 

$

 

>CYP71D211 CYP71D.43v1

iTAG gene:chr08.1752 94% exon 1 matches 100% but exon 2 is CYP71D212

missing a small region around a frameshift

PGSC0003DMB000000144

1084983-1086825 (-) strand

93% to scaffold00777 tomato

1086825   MEIHFNYVSFLLSFFLLLV

1086768   IFVRKSKKSNQKLPPGPWKLPVIGSMHHLIGALPHHVLRNLSKKYGPLMHLKLGEIDAVI  1086589

1086588   VSSPHMAKQVLKVHDLSFAARPELMASDIVFYSQKDIVFAKYGDYWKQMRKICISELLSA  1086409

1086408   KMVKSFSLIRQDAVHDLVASIRSTPNVVVNMSE & 1086310

1086310   KVLRLTSSVICRSAFGKVWDDRDNLLMLMREVLSLSGGFDVADFFPSWTLLHGIGGMRNR  1086131

1086130   LKSLHQKIDVILEKIIHEHKENRANGKEGNSEFGGEDLIDVLLRVMENGELQFPITNDSV  1085951

1085950   KAIVL (0) 1085936

1085591   DLFFGGTETSSVIIQWALSELMKNPNVMAKAQAEVRCVCTGKKDLNDNDVEELKYLKLVI  1085412

1085411   NETLRLHPASPLLGLRQCREETIIDGYTIPLKSQVVVNGWAIARDPESWDDPETFVPERF  1085232

1085231   ENSCVDFNGNHFQYIPFGAGSRMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLDM  1085052

1085051   TETLGISATRKNDLHLIAISHD*  1084983

 

>CYP71D.43v2

PGSC0003DMB000058415

5-103 (+) strand

100% to CYP71D.43

5   ETFVPERFENSCVDFNGNHFQYIPFGAGSRMCP  103

 

>CYP71D.43v3

PGSC0003DMB000029888

13-132 (-) strand

100% to CYP71D.43v1

132   YGDYWKQMRKICISELLSAKMVKSFSLIRQDAVHDLVASI  13

 

$

 

>CYP71D210 CYP71D.44

iTAG gene:chr08.1753 94% missing a small region around a frameshift

PGSC0003DMB000000144

1087927-1089608 (-) strand, one frameshift, possible pseudogene

92% to scaffold00777 tomato, 96% to CYP71D.43v1

1089608   MEIHFNSVSFLLSFFLLLA

1089551   IFVRKSKKSNQRLPPGPWKLPIIGSMHHLVGALPHHVLRNLSKKYGPLMHLKLGEIDAVV  1089372

1089371   VSSPHMAKQVLKVHDLSFAARPELMTSDIVFYSQKDIVFARYGDYWKQMRKICISELLSA  1089192

1089191   KMVKSFSLIRQDAVHDLVASIRSTPNVVVNISEKVLRLTSSVICRSAFGKVWDDRDNLLM  1089012

1089011   LMREVLSLSGGFDVADFFPSWTLLHGIGGMRSRLKSMHKKFDVILEKIIHEHKENRANGK  1088832

1088831   EGNSEFGGEDLIDVLLRVMENGELRFPITNDSVKAIVL (0) 1088718

1088536   DLFFGGTETSSVIIQWALSELMKNPNIMAKAQAEVRCVHKGKKDLNDNDLEELKYL  1088369

1088368   KLVINETLRLHPDSPLLGLRQCREETIIDGYTIPL & 1088264

1088262   KSQVVVNGWAIARDPESWDDPETFVPERFENSCVDFNGNHFQYIPFGAGSRMCPGMHFG  1088086

1088085   LANVVYPLAQLLYHFDWKLPYGQQPEDLDMTETLGISATRKNDLHLIAISHD*  1087927

 

$

 

>CYP71D274 CYP71D.45

iTAG gene:chr05.736 99% 1 aa diff at C-term

PGSC0003DMB000000210

233275-235441 (+) strand

81% to CYP71D204 scaffold05575 tomato

233275   MYYSLFNLVSLLIFLSSLVILVRKWSKNKKQRLPPGPWRLPFIGSLHHLIIGGQLPHR  233448

233449   VFRNLARRYGPIMYLQLGEIPVVIISSPTIAQEILRTHDLAFADRPQFVSTNIIFYNNKD  233628

233629   IVFSQYGDYWRQMRKICMVELLSVKMVKSFSGIRQDELSSLISSICSTRGGATVLINMSE  233808

233809   KVFRFINSVTCRSAFGKICKGKDEFITLMKEVLFFAGGFDVADLFPSWKLLHNISGVKSR  233988

233989   LMNAHQKVDAIMENIINEHIENKAIGKKRNGEFGDEDLVDVLLRIKENSQLQFPITNDHI  234168

234169   KAVIT (0)  234183

234818   DIFIAGTEASSLTIIWALSEMMRNPNVMAKAQHEVRQVFKGKKNYDEKDIEKLTYLK  234988

234989   LVIKETLRLHTPGPLMGPRECRENTNIDGYIIPQKTRVLVNVWALARDPKYWQNPTSFIP  235168

235169   ERFENSSIDFMGNDFEFIPFGSGRRMCPGIQFALANVGFSLAQLLYHFEWELPNGVNPKD  235348

235349   LDMTETHGLTASKKKDLYLIATNYRINEYY*  235441

 

$

 

>CYP71D204a ortholog CYP71D.46

iTAG gene:chr05.736 83% not the same sequence

PGSC0003DMB000001530

4022-5726 (+) strand

92% to CYP71D204 scaffold05575 tomato

4022   MFSSLFNLVSLLLFLSSLVI

4082   ILLRKWSQNKKQRLPPGPWRLPFIGNLHHLIGGGLPHRVLRNLSQRYGPIMYLQLGQVPA  4261

4262   VVISSPTIAQEILKIHDLAFADRPQFVSTNIIFYNNKDVAFSQYGDYWRQMRKICIIELL  4441

4442   SAKMVKSFSGIRQDELSSLISSIRSTNGSTINMTEKVFQFTNCVTCRSAFGKICKDRNEF  4621

4622   ITLLKEVLAFIGGFDVADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKAA  4801

4802   GKKGNGEFGDEDLVDVFLRVKENAELQFPITNDHIKAVIS (0) 4921

5103   DIFIAGSETSSTTIIWALSELMMNPNVMAKAQSEVRQVFKGKKNYGEEDIEKLTYLKLVI  5282

5283   KETLRLHTPVPLIGPRECREKTNIDGYTIPHNTRVLINAWALARDPKNWENPESFIPERF  5462

5463   ENSSIDFMGNHFEFIPFGAGRRMCPGIQFGLANVGLPLAQLLHHFEWELPYGGNPKDLDM  5642

5643   TETHGLTASKAKDLYLNATNYKNDEEH*  5726

 

$

 

>CYP71D220bP CYP71D.47Pv1

iTAG gene:chr10.1955 87% missing the region around two frameshifts

PGSC0003DMB000000008

1513188-1514961 (-) strand

Cyan is duplicated region

91% to scaffold01435 tomato

1514961   MEFQFPFNFILLFLFLSFLYLLLVEWKKSRNFNKK

          FPPGPWKLPFLGSLHHLALEGELPHHALTNLGK &

1514856   FPPGPWKLPFLGSLHHLALEGELPHHALTNLGK & 1514758

1514756   KYGPLMHLQLGEISMIVVSSMDMAREVLKTHDLAFASRPKVASIDIICYKSTDIVFSP  1514583

1514582   YGEYWRQMRKVCVMELLTAKNVRSFSSIWHDEASRLVQFIQSSTHGEPINVTERILWYAS  1514403

1514402   SVTCKAAFGNQLLKDQEKFIEMVKELMELAGGFSLADIFPSIKILHVLSGVRSRILKV  1514229

1514228   HKNVDVIVEDVINEHKKNIASGKKGNGAFGGEDLIDVLLRLMESGELKIPITNDNIKAIMV (0) 1514046

1513823   DLFSAGTETSSTTATWAMTEMMRNPSVLKKAQAEVREAFKGKETFDEDVIEELKYLK  1513635

1513634   QVVKETFRLHPPLPLLAPRECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIP  1513455

1513454   ERFEQSSVDFMGNNFEFLPFGAGRRMCPGITFGLINVHLPLAKLLYHFDWKLPDGQKSED  1513275

1513274   MDMTEVSGITAARKSELYLIATPYYPSP*  1513188

 

>CYP71D.47Pv2

PGSC0003DMB000013568

2-217 (+) strand

100% to CYP71D.47P

  2   ETFRLHPPLPLLAPRECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFE  181

182   QSSVDFMGNNFE  217

 

$

 

>CYP71D220a = OLD CYP71D231 possible ortholog CYP71D.48v1

iTAG gene:chr10.1955 exon 2 is correct but exon 1 is not a match

PGSC0003DMB000000008

1522322-1524064 (-) strand

exon 1 is 91% to scaffold01435 tomato

Note exon 2 has 1 aa diff to exon 2 of CYP71D220P

1524064   MEFQFPFNFIFLFLFLSFLYLLL

1523995   VQRKKSRNLNKKLPPGPWKLPFLGSIHHLVLEGGLPHHALTNLSKKYGPLMHLQLGEIST  1523816

1523815   VIVSSTDMAREVLKTHDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELL  1523636

1523635   TAKNVRSFSSIRKDEASGLVQFIQSSTCGEPINVTERILWYQSSITCKAAFGELLKDQE  1523459

1523458   KFIQMVKEVMELAGGFNLADIFPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKNI  1523279

1523278   ASGKKGNGAFGGEDLVDVLLRLMESGELKIPITNDNIKAIMI (0) 1523153

1522939   DLFSAGTETSSTTATWAMTEMMRNPSVLKKAQAEVREAFKGKETFDEDVIEELKYLK  1522769

1522768   QVVKETFRLHPPLPLLVPRECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIP  1522589

1522588   ERFEQSSVDFMGNNFEFLPFGAGRRMCPGITFGLINVHLPLAKLLYHFDWKLPDGQKSED  1522409

1522408   MDMTEVSGITAARKSELYLIATPYYPSP*  1522322

 

>CYP71D.48v2

PGSC0003DMB000008404

1-255 (+) strand

100% to CYP71D.47P and CYP71D.48

  1   QSSVDFMGNNFEFLPFGAGRRMCPGITFGLINVHLPLAKLLYHFDWKLPDGQKSEDMDMT  180

181   EVSGITAARKSELYLIATPYYPSP*  255

 

>CYP71D.48v3

PGSC0003DMB000011273

2-93 (-) strand

100% to CYP71D.48

93   DLFSAGTETSSTTATWAMTEMMRNPSVLKKAQAEVREAFKGKETFDEDVIEELKYLK  23

22   QVVKETF  2

 

$

 

>CYP71D230P CYP71D.49P

PGSC0003DMB000000008

1528317-1528931 (-) strand

82% to scaffold01435 tomato

1528931   MEFQYPFNFIFLFLFLSFLYLLL

1528862   VEWKKSRNLNKNLPPGPWKLPFLGSIHHLALEGGLPHHVLTKLGKKYGPVMHLQLGEIST  1528683

1528682   VVVSSMDMAREVLKTHDLAFASRPKLASIDIICYKSMDIAFTPYGEYWRQMRKVCVLELF  1528503

1528502   TSKNVRYFSSIRRDEASRLVQFIRSSTRSEPINVTKRVSWYQSSNTCKAAFGELLKDQE  1528326

1528325   KFI 1528317

 

$

 

>CYP71D219 CYP71D.50

iTAG gene:chr10.1958 92% missing the seq before the frameshift

PGSC0003DMB000000008

1530771-1532409 (-) strand, one frameshift

90% to scaffold01435 tomato, 96% to CYP71D.53

1532409   MEFQFPFNFIFLFLFLSFLYILL

1532340   VDWKKSRNLNKKLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGK & 1532206

1532206   KHGPFMHLQLGEISTIIVSSMDMAREVLKTHDLAFASRPKLLALDIICYKSTDIAFS  1532036

1532035   PYGDYWRQMRKVCVLELLTTKNVRSFSSIRWDEASRLVQFIRSSTRDEPINVTERILWYQ  1531856

1531855   SSITCKTAFGELLKDQEKFLGIVRELMEVAGGFSLADIFPSIKILQVLSGLKSKILKVH  1531679

1531678   KNADVIVEDVINEHKKNIASGKKGNGAFGGEDLVDVLLRLKESGELKIPITNDNIKAIII  1531499

1531391   DLFSAGAETSGTTTIWAMSEMMRKPSVLAKAQAEVRQAFKGKETFDE  1531251

1531250   DVIEELKYLKQVVKETLRLHPPVPLLVPRECREETNINGYTIPLKTRVMVNVYAMGRDPK  1531071

1531070   YWEDAESFIPERFEQTSVDFMGNNFEYLPFGAGRRMCPGITFGLINIYLPLAKLLYHFDW  1530891

1530890   KLPDGLKPKDVDMTEFSGITAARKSELYLIATPYYPSHE*  1530771

 

$

 

>CYP71D229P CYP71D.51P

iTAG gene:chr10.1958 86% missing the seq before the first frameshift

and the region around the second frameshift

PGSC0003DMB000000008

1534678-1536312 (-) strand

82% to scaffold01435 tomato

1536312   MEFQFPFNFIFLFLFLSFLYLQF

1536243   VEWKKSRNFNKKLLPGPWKLP & 1536181

1536179   FLGSIHHLALEGGLPHHALTKLGKKYGPFMHLQLGEISMVVVYSVVMAREVLKTHDLAFA  1536000

1535999   SRPKLVSIDIIFYKSTDIAFSPYGDYWRQIRKICVLELFTAKNVRSFSSIRRDEASSLMQ  1535820

1535819   FIRSSTRGVPINITEHISWYQSSITCKAAFGELLKDQEKFIGLVKELVKLAGGFSMADI  1535643

1535642   FPSIKIIHVLSGLKSRILKVHKNVDVIVEDVINEHKMNIASGKKGNGAFGGED*LVDVLL  1535463

1535462   RLRESGELKTPITNDNIKAIMI (0) 1535397

1534872   DLFAAGTETSITTTIWTMTEMMRKPSVLAKAQVEVREAFKGKETFNEDIIEDLKYLKQVV  1534693

1534692   KESLR  1534678

 

$

 

>CYP71D228P CYP71D.52P

PGSC0003DMB000000008

1548302-1548965 (-) strand

76% to scaffold01435 tomato

1548965   MEIQFPFNFIFLILFLSFLYLLF

1548896   VEWKKSRNFNKKLPPGPWKLPFLGSVHHLAIEGELPHHALTNLGKKYGPFMHLQLSEIST  1548717

1548716   IVVSSMDMAREVLKTHDLAFASRHKLVTTDMIFYKSMDIAS &  1548594

1548592   PYGDYLREVRKICVLELFTAKNIRSFSSIRREEASSLVQFIRSSTRGKPINITKQISWYQ  1548413

1548412   SSNTCKATFGKLFKD*EKFIGLVRNLVEVTGGFTVPD  1548302

 

$

 

>CYP71D218 CYP71D.53

iTAG gene:chr10.1961 94% missing end of exon 1 and C-term

PGSC0003DMB000000008

1550949-1552827 (-) strand

90% to scaffold01435 tomato, 96% to CYP71D.50

1552827   MEFQFPFNFIFLFLFLSFLYLLL

1552758   VDWKKSRNLNKKLPPGPWKLPFIGSVHHLPLEGGLPHHALTNLGKKHGPFMHLQLGEIST  1552579

1552578   IVVSSMDMAREVLKTHDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELL  1552399

1552398   TTKNVRSFSSIRRDEASHLVQFIRSSTRDEPINVTERILWYQSSITCKTAFGELLKDQE  1552222

1552221   KFLGILRELMEVAGGFSLADIFPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKNI  1552042

1552041   ASGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIII (0) 1551916

1551569   DLFSAGSETSGTTTIWAMSEMMRKPSVLAKAQAEVRETFKGKETFDE  1551429

1551428   DVIEELKYLKQVVKETLRLHPPVPLLIPRKCREETNINGYTIPLKTRVMVNVYAMGRDPK  1551249

1551248   YWEDAEIFIPERFEQSSVDFMGNNFEYLPFGAGRRMCPGITFGLINVYLPLAKLLYHFDW  1551069

1551068   KLPDGLKPKYVDMTEFSGITAARKSELYLIATPYYPSHE*  1550949

 

$

 

>CYP71D227P CYP71D.54P

iTAG gene:chr10.1962 83% missing C-term and regiona around stop codon

PGSC0003DMB000000008

1560003-1562099 (-) strand, cyan is duplicated region

80% to scaffold01435 tomato

1562099   MEFQFPFNFIFLFLFLSFLYLQF

1562030   VEWKKSRNFNKKLPPGPWKIAFFRKYPSLGIRRWTSSSCTHKIGTKKYGPFMHLQLGEIS  1561851

1561850   MVVVSSMDMAREVLKTHDLAFASRPKLVSIDIIFYKSTDIAFSPYGDYWRQIRKICVLEL  1561671

1561670   FTAKNVRSFSSIRRDEASSLMQFIRSSTRGVPINITEQISWYQSSITCKAAFGELLKDQ  1561494

1561493   EKFIGLVKELVKLAGGFSMADIFPSIKIIHVLSGLKSRILKVHKNVDVIVEDVINEHKMN  1561314

1561313   IASGKKGNGAFGGED*LVDVLLRL  1561242

1561240   GGEDLVDVLLRLRESGELKTPITNDNIKAIMI (0) 1561145

1560623   DLFAAGTETSTTTTIWTMTEMM

1560557   RNPSVLAKAQVEVREAFKGKETFNEDIIEDLKYLKQVVKESLRLHPPAPLLVPRECREET  1560378

1560377   NINGYTIPLKTRVLVNVSAIMRDPQYWEDAESFIPERFEQSSVDFMGNNFEYLPFGAGRR  1560198

1560197   MCPAITFGLINVYLPLAKLLYHFDWKLPDGLKPENLDMTECDGINASRKSELYLIATPYY  1560018

1560017   PSQE*  1560003

 

$

>CYP71D217P CYP71D.55P

iTAG gene:chr10.1963  96% missing regions around frameshifts and stop codon

PGSC0003DMB000000008

1565471-1566722 (-) strand

85% to scaffold01435 tomato

1566722   MEIQFPFNFIFLFLFLSFLYLLL

1566653   VEWKKIKKLKQKTSSRPMEIALYRSVHNLVLEGELPHHALTNLGNKHGPFMHLQLGEIST  1566474

1566473   IVVSSMDMTREVLKTHDLAFASRPKLLAVDIICYKSMDIGFTPYGDYWRQMRKVCVLELF  1566294

1566293   TTKNVRS &

1566267   FGSIRWDEASRLVQFILSSTCGQPI  1566193

1566036   RKSSVLTKAQVEVREAFKGKETFDEDVIEDLKYLKQVVKETFRLHPPLPLLIPRECREET  1565857

1565856   NINGYTIPLKTRVM & 1565815

1565812   LMVNVYAMGRDPKY*EDAESFIPERFEGSSVDFMGNNFEYLPFGAGRRMCPGITFDLINV  1565633

1565632   YLPLAKLLYHFDWKLPDGVKPKDVDMTEFSGATAARKSELYLIATRYYPSHDE*  1565471

 

$

 

>CYP71D226 CYP71D.56v1

chr10.1964 100% missing C-term

PGSC0003DMB000000008

1572171-1574627 (-) strand

86% to scaffold01435 tomato

1574627   MEIQFPFNFIFLILFLSFLYLLL

1574558   VEWKKSRNFNKKLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSM  1574379

1574378   VVVSSLDMAREVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELF  1574199

1574198   TAKNVRSFSSIRRDEASSLVQFIRSSTRGEPINVTEQISWYESSNTSRAAFGKLLKDQE  1574022

1574021   KFIGLVKELVELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKNI  1573842

1573841   ASGKKGNGAFGGEDLVDVLLRLKESRELKIPITNDNIKAIMI (0) 1573716

          DLFGAGTETSGTTIIWAMSEMM

1572727   RNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPRECREET  1572548

1572547   SINGYTIPLKTRVIVNVYAMGRDPKYWEDAESFIPERFEQISVDFMGNNFKYLPFGAGRR  1572368

1572367   MCPGILFGLINVYLPLANLLYHFDWKLPDGVKLEDVDMTEFFGITAARKSELYLIATPYYPSRE*  1572171

 

>CYP71D.56v2

PGSC0003DMB000000039

766128-767046 (+) strand

100% to CYP71D.56, exon 2 in a seq gap

766128   MEIQFPFNFIFLILFLSFLYLLL

766207   VEWKKSRNFNKKLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSM  766386

766387   VVVSSLDMAREVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELF  766566

766567   TAKNVRSFSSIRRDEASSLVQFIRSSTRGEPINVTEQISWYESSNTSRAAFGKLLKDQE  766743

766744   KFIGLVKELVELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKNI  766923

766924   ASGKKGNGAFGGEDLVDVLLRLKESRELKIPITNDNIKAIM (0) 767046

 

$

 

>CYP71D216 POSSIBLE ortholog CYP71D.57

chr10.1965 98% missing beginning of exon 2 and C-term

PGSC0003DMB000000008

1576557-1578944 (-) strand

90% to scaffold01435 tomato

1578944   MEFQFPFNFTFLFLFLSFLYLLL

1578875   VEWKKSRNLNKKLPPGPWKLPFLGSIHHLALEGGLPHHALTKLGKKHGPFMHLQLGEIST  1578696

1578695   IVVSSLEMAREVMKIHDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELF  1578516

1578515   SAKNVRSFSSIRREEASSLVQFIGSSPRGETINVTERISWYESSNTCKAAFGELLKDQE  1578339

1578338   KFIGIVRELAELTGGFSVANIFPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKNI  1578159

1578158   ASGKKGNGAFGGEDLVDFLLRLKESGELKIPITNDNIKAIII (0) 1578033

          DLFSAGTETSTTTTIWAMTEMI

1577111   RNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPLPLLIPRECREET  1576932

1576931   NINGYTIPLKTRVIVNVYAMGRDPKYWEDAERFIPERFEQSSVNFMGNNFEYLPFGAGRR  1576752

1576751   ICPGITFGLINVYLPLANLLYHFDWKLPDGVKLEDVDMTEFSGITATRKSEFYLIATPYYPSHE*  1576557

 

$

 

>CYP71D.58P

PGSC0003DMB000000719

5178-5784 (+) strand

72% to scaffold05390 tomato, 98% to CYP71D.59v1

5178   MEIQQIITFFLFISFLFFLIHKLR

5248   IKTKKSRNKKILPPGPWRLPIIGSVHHLTKGIPHHVLKNLSQKFGPIMYLQLGEVPT  5418

5419   IVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELL  5598

5599   SGKMVKSFSPIRLDELSSLVSSIKSMENTPINVSEKLFWFMNSVTCRSSFGKACKDQNEAFL  5784

 

$

 

>CYP71D276 CYP71D.59v1

iTAG gene:chr04.462 97% not the same sequence

PGSC0003DMB000000719

6153-7882 (+) stand

74% to scaffold05390 tomato

6153   MEIQQIITFFLFISFLFFLIHKLR

6225   IKTKKSRNKKILPPGPWRLPIIGSVHHLTKGIPHHVLKNLSQKFGPIMYLQLGEVPT  6395

6396   IVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELL  6575

6576   SAKMVKSFSPIRLDELSSLVSSIKSMKNTPINVSEKLFWFMNSVTCRSSFGKACKDQNE  6752

6753   AMISLIHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHRENH  6932

6933   ANGKKCNAECGSNEDLIDVFFRVMGTGELPFTLTNNNIKAVIL (0) 7061

       DMFVAGSDTSSSTVTWALSEMM

7340   KSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLRLHPPTPLLVPRECREET  7519

7520   EIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSVDFSGTHFQFLPFGAGRR  7699

7700   TCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKDLYLIATPYT*  7882

 

>CYP71D.59v2

PGSC0003DMB000003883

673-918 (+) strand

100% to CYP71D.59 and CYP71D.58P

673   IKTKKSRNKKILPPGPWRLPIIGSVHHLTKGIPHHVLKNLSQKFGPIMYLQLGEVPT  843

844   IVVSSPHMAQKIMKTHDLAFASRSQ  918

 

$

 

>CYP71D282P CYP71D.60P

iTAG gene:chr04.1493 58% not the same sequence

PGSC0003DMB000000889

15340-16241 (-) strand

62% to scaffold02227 tomato

16241   MKFFNFFFLFLFVSSLFLLIKWKNSNSKTK

16152   RLPLIGSMFYLFGELPRHALKD & 16087

16087   LGQKYGQIMHL*LGEVSLVTVVSLDMVKQVLKTYDLAFVFRPKLLAIEILFYNGTYIVFP  15908

15907   SYENSWRQIRKVCLLESFSVKSVRN  15833

        VLKALGTETSSTIIDSAMVEMM

15786   RNSSVLFKVQAKVRNAFREKETFDKNNVKKLKYLKLVIKETFKFHPPLPVLLPKECKEEV  15607

15606   DIKGYVVPLKTKVMINAWAIERDLKYENDVEKL

        YKPKRFELNFIYFNGNNFEYLSFGSERRISM

        GISFGLANDFFSLA*LLYHFD*KLKN 15340

 

$

 

>CYP71D281P CYP71D.61P

PGSC0003DMB000000889

27637-27822 (-) strand

80% to scaffold02227 tomato

27822   FGSGR*NCPWISFGLANVYFPLTHLLYQFDRKLPSGINSSDLDFTESAGSTCGKKSNLYLIA  27637

 

$

 

>CYP71D280P CYP71D.62P

PGSC0003DMB000000889

32907-33043 (-) strand

78% to scaffold02227 tomato

33043   FDSGRRNCPLKLFGFANVYFP & 32981

32978   AQLLYHFDWKPPSGINPSDLDLTE  32907

 

$

 

>CYP71D279P CYP71D.63P

iTAG gene:chr04.1493 70% not the same sequence

PGSC0003DMB000000889

33480-36532 (-) strand

84% to scaffold02227 tomato

36532   MQFFNFFSLFLFVCFLFFV &

36474   IKWKNSNSKTKRLPPGPWKLPLIGSMFHLLGGLPHQVLRDLAKNMDQL  36331

36355   FSQKYGPIMHLQLGEVSLVVVTSPDMAKQVLKTHDIAFASRPKLLAAEILFYNASDIVFS  36176

36175   PYGDYWRQMRKICIMELLSAKNVKSFNSIRQDEVLHMIEF & 36056

36006   FASSMTCRSAFGKVLKEQDELILLIKKLSRFLEGFDMADIFPSLKFLHVLCGMKGKIMD  35830

35829   AHHELDAILENIINEHKNNGELGGEGLIATLLRLMKEGGFQFPITKDNIKAIIF (0) 35668

        DIFVAGTETSSTTIDWAMVEMM

34037   RNPSVLFKAQAEVRNAFRGKETFDEIDVEELKYLKLVIKESFRLHPPIPLLMPRECREEV  33858

33857   DINGYTIPLKTKVMVNAWAIGRDPKYWNDAECFKPERFEQISIDFIGNNFEFLPFGSGRR  33678

33677   MCPGISFGLANVFFPLAKLLYHFDWKLPTGINPSDHLDLTESVGAACARKNNLYLIATPHQPCQE*  33480

 

$

 

>CYP71D278P CYP71D.64P

PGSC0003DMB000000889

67826-68110 (-) strand

91% to CYP71D184 tomato

68110   MQFFNFFSLFLFVCFLFLL

68053   IKWKNSNSKNKRLPPGPWKLPLIGSMFHLLGGLPHQVLRDLAKKYGPIMHLQLGEVSL  67880

67879   VVVTSPDMAKQVLKTHDL  67826

 

$

 

>CYP71D277P CYP71D.65P

PGSC0003DMB000000365

545903-546164 (-) strand

89% to CYP71D221 tomato, 92% to CYP71D.66

546164   KWKNSNSQTTKKLPPGPWKLPFIGSMHHIVGGYPHHVLRNLAKKYGPL & 546021

546019   LMHLQLGEVCVVVVTSSEMAKNVLKTHDSRDIAFSPYGE  545903

 

$

 

>CYP71D221 CYP71D.66

iTAG gene:chr11.763 93% missing C-term and has a retained intron

PGSC0003DMB000000365

575228-577180 (-) strand MISSING SOME SEQ IN THE MIDDLE, possible pseudogene

86% to CYP71D221 scaffold07184 tomato

577180   MQIFSLVYILLFLSFLFLLR

577120   KWKNSNSQTTKKLPPGPWKLPFIGSMHHIVGGYPHHVLRDLAKIYGPLMQLQLGEVSV  576947

576946   VVVTSSEMAKQVLKTHDLAFASRPKLLVTDIITYDSRDIAFSPY () 576815

576409   GDYWRQMRKICVMELLNAKNVRSFSSIRRDEVVHLIDSIRSSSSSGEPVNFTERMIWFAS  576230

576229   SMICRSAFGQLLKEQDIFIKLIREVIRLVA

         (MISSING 45 AA HERE)

         SFANHKTSDDALGGGEDLIDVLLR  576068

576067   LMKDKSLQFPINNHNIKAIII (0)

         DMFTGGTETTSTTTIWAMAEMMKNPSIFAKAQEEVREAFRDKV  575714

575713   KFDKYDVEELKYQKLVVKETLRLHPPIPLSIPRECREETDINGYTIPVKTKVLINVWALG  575534

575533   RDPKYWDDAESFKPERFDQCSVDFSGNNFEFLPFGSGRRVCPGISFGLANIYLPLAQSLY  575354

575353   HFDWKLPTTGMEPRDLDLTKSDGITTSRKNDLYLIATPYQP*  575228

 

$

 

>CYP71D248P CYP71D.67P

iTAG gene:chr11.765 94% missing N-term and C-term and first part of exon 2

PGSC0003DMB000000365

599711-601789 (-) strand

84% to CYP71D221 scaffold07184 tomato

601789   MQIFSLV &

601763   FLFLSFLFLLRKWINSNSQTT

601700   KK*PPGPCKLPFIGSMHHIVGGYPHHVLRDLAKKYGPLMHYLQLGEVSVIVVTSSEMA  601527

601526   KQVLKTHDLAFASRPKLLVTDIITYDSRDITFSPYGE  601416

600931   GDYWRQMRTICVMELLNAKNVLSFSSIRHDEVVHLIDSIRSSSSSEEPVNFTERMIWFAS  600752

600751   SMICRSAFGQLLKEQNKFIKLIREVLRLADQGFDMADIFPSYKFLYGLGGVKQKILDIH  600575

600574   HKVDSIVEDVINEHKKNFANHKTSDDGLGGGEDLIDVLLRLMKDKSLQFPVNNHNIKAIII (0) 600392

600160   KNPSIFAKAQEEVRKAFRDKVKFDKYDVEELKYLKLVVKETLRLHPPIPLSVPRECREET  599981

599980   DINGYTIPVKTKVLINVWALGRDPKYWDDTESFKPERFDQCSVDFNGNNFEFLPFGSGRR  599801

599800   VCPGISFGLANIYLPLAQLLYHFDWKLPQG  599711

 

$

 

>CYP71D283P CYP71D.68P

iTAG gene:chr05.736 83% not the same sequence

PGSC0003DMB000000385

136258-137138 (+) strand

66% to scaffold04799 tomato

136258   LKWKKLKSPNKILSPGPWSLPFIGNLEQL  136344

136432   SSY*DYWRNMRKVCVLELLSSKMVKSLT  136515

136753   SSTPDSLINLSNSFFWFANTTTCR*KIIHDRNKLIK  136860

136862   GGFDVTNLFPSQKWLHNISGMKSKLSKAHLNVDEILE  136972

136977   IINEHLDNRAKGKKCNCKSGNEDLVDDLLKMMENGEFGYPITNQNIKAFIL (0)  137129

 

$

 

>CYP71D284P CYP71D.69P

PGSC0003DMB000000385

173565-174073 (+) strand

70% to scaffold04799 tomato

173565   KNPRVLEEAQLEVRERY  173615

173620   LEDLNYLELVIKEKLRLHPPAPLVPRECREETKINGYTIPMKTKVL  173757

173744   KPRS*VNAWSISRDLKY*HD*KSFIHERFENNTIDFKENYFKFILFGAGRRLCPRMLFGL  173923

173924   VNIAHPLSQLLYHFDWKVPHGVILNDLDTIGTEGLRQKERMIFYLIATPF  174073

 

$

 

>CYP71D247 CYP71D.70

iTAG gene:chr04.462 100% missing C-term

PGSC0003DMB000000296

826352-827812 (-) strand

N-terminal is off the end of the contig

73% to scaffold05390, 97% to CYP71D.59v1

827812   THDLAFASRSQTMLGKIFCYDCTDIAFSPYDEYWRHMRKLCIMELLSGKMVKSFSPIRLD  827633

827632   ELSSLVSSIKSMENTPINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISLIHGVLSLAG  827456

827455   GFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHRENHANGKKCNAECGSNE  827276

827275   DLIDVFFRVMGTGELPFTLTNNNIKAVIL (0)  827189

         DMFVAGSDTSSSTVAWALSEMM

826894   KSPSVMTKAQVEVREVFKGKKTFDDDDLEKLDYLKLVIKETLRLHPPTPLLVPRECREET  826715

826714   EIDGYTIPVKSKVLVNVWAIGRDPESWEDPESFIPERFDNSSVDFSGTHFQFLPFGAGRR  826535

826534   TCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKDLYLITTPYT*  826352

 

$

 

>CYP71D204b CYP71D.71v1

PGSC0003DMB000000945

8820-9443 (+) strand

Exon 1 is in a sequence gap

92% to CYP71D204 tomato, 95% to CYP71D204a potato

8820   DIFIAGTETSSATIIWALSELMM

8889   NPNVMVKAQSEVRQVFKGKKNYGEEDIEKLTHLKLVIKETLRLHTPVPLIGPRECREKTN  9068

9069   IDGHTIPHNTRVLVNAWALARDPKNWENPESFIPERFENSSVDFMGNHFEFIPFGAGRRM  9248

9249   CPGIQFGLANVGLPLAQLLHHFEWELPYGGNPKDLDMTETHGLTASKMKDLYLNATNY  9422

       RNDEEL* 9443

 

>CYP71D.71v2

PGSC0003DMB000039951

6-116 (+) strand

100% to CYP71D.71

6   TRVLVNAWALARDPKNWENPESFIPERFENSSVDFMG  116

 

>CYP71D.71v3

PGSC0003DMB000025627

14-124 (-) strand

100% to CYP71D.71v1

124   DIFIAGTETSSATIIWALSELMMNPNVMVKAQSEVRQ  14

 

>CYP71D.71v4

PGSC0003DMB000055811

3-104 (+) strand

100% to CYP71D.71v1

3   GAGRRMCPGIQFGLANVGLPLAQLLHHFEWELPY  104

 

$

 

>CYP71D200 ortholog CYP71D.72

iTAG gene:chr06.446 100%

PGSC0003DMB000000255

580178-582543 (+) strand

71% to scaffold05575 tomato

first exon 89% to CYP71D200P, 75% to CYP71D201P

580178   MYSSLFTIVSLLLFFSFFFILLSKNKKQT

580265   RLPPGPWRLPFIGSLHHLIGRGHLHPNLRNLAQRYGPLMYLQLGEIPVVIISSSTIAKE  580441

580442   LLTTHDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVKSFSTI  580621

580622   RKDEISSLISSIRSTRDSPINMTEKIFWFTNSVTCSAAFGKMFKDRDEFIKLLKDILI  580795

580796   LASGFCVTDLFPSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENKANRNKGIGDQF  580975

580976   GGEDLVDVLLKVMEDAELECPITNDHIKAVIL (0) 581071

         DIFIAGSETSSTITIWVLSEMM

582007   KNSTIMAKAQKEVRQVLRGKKNYDNEEDLEKLTYLKLVIKETLRLHTPAPLLGPRECREQ  582186

582187   TNIDGYTIPLKTKILVNAWALARDPESWHDPECFIPERFENSSIDFLGNHFEFIPFGAGR  582366

582367   RMCPGVLFGLTNVELSLAQLLYHFEWELPYGMKPKDLDMTETYGLSGGKQRDLYLVAR*  582543

 

$

 

>CYP71D207 ortholog CYP71D.73

iTAG gene:chr07.241 100%

PGSC0003DMB000000300

299717-301392 (-) strand

89% to CYP71D207 scaffold07059 tomato,

301392   MEFHHFVSFSLFIFFLFMIIQNWS

301320   RNSKTLKKKLPPGPWRLPIIGSVHHLTRGTPHRVLGNLSQKYGPIMYLQLGEVPTVVV  301147

301146   SSPHMAKQILKTHDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSAK  300967

300966   MVKSFSSIRHDELSNLLSSIDSMVGSPINLSEKLFWFMNASTCRSTFGKTCKNQNELV  300793

300792   TLIQRAMSLSSGFELADLFPSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENHTNG  300613

300612   KNYNGESGTEDLIDVFLRVMESGEFQFPLTNDNIKAVIL (0) 300496

         DMFVAGSDTSSATVIWALSEMM

300265   KSPSVMAKAQAEVREVFKGKETCNDDTDLEKLNYLKLVIKETLRLHPPTPLLVPRECREE  300086

300085   TKIDGFTIPLKSKVLVNVWAIGRDPKSWENPECFIPERFENSSIEFTGNCFQLLPFGAGR  299906

299905   RMCPGIHFGIALVTLPLAHLLYKFDWKLPEGIHVRDLDMTESNGITARRENDLYLIGTPSSF*  299717

 

$

 

>CYP71D284 CYP71D.74

iTAG gene:chr07.1451 84% not the same sequence

PGSC0003DMB000000739

100871-102643 (-) strand, one frameshift

84% to CYP71D208 scaffold05390 tomato

102643   MEFHYLVSFFLFISFLFLLIQ

102580   KWSNSKTLKKKVLPPGPWRLPIIGSVHHLTNGVPHRVLKNLSQKYGPIMYLQLGEVST  102407

102406   VVVSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGDYWRHMRKLSTLELL  102227

102226   SAKMVKSFSPIRQEELSSLLSSIRSxxxxx  102152

102134   NFPEKLLWFMNAAACRSAFGNVCKDQKELIKLIHEAQSLSGGFELADLFPSKKILHGIS  101958

101957   GMKSKLMKARNKVDVVLNNIINVHRENRANGKSCNGESGAEDFIDVFLRIMESGEFPLPL  101778

101777   TNDNIKAVIL (0) 101748

         DMFVAGSDTSSSTVIWALSEMI

101428   KSPSVMVKAQAEVREVFKGKKTFDDETELEKFTYLKLVIKETVRLHPPTPLLVPRECREE  101249

101248   TNIDGFTIPLKSKVLVNVWAIGRDPESWKSPECFIPERFENSSIEFTGNHFQFLQFGAGR  101069

101068   RICPGIQFGLALVTLPLAHLLYKFDWKLPEGINAKDLDMTEANGISARRQSDLYLIATPYVSPLD* 100871

 

$

 

>CYP71BP1 CYP71D.75

iTAG gene:chr09.1440 100%

PGSC0003DMB000000130

837499-839141 (-) strand

95% to scaffold04338 tomato

839141   MELTILLCALFLVLPLLVT

839084   KWYKECNSKKKLPPGPWKLPFIGNLHHLVDWQSSELLPHRTLAKLASKYGDLMHMKLGER  838905

838904   EAIVVSSPQMVREVMRKHDLNFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQE  838725

838724   LLSHKNIQSFYPNMLNEITNLVTSIKSSASEGGSSINMTDTLSLYTNSIICKASVGRAC  838548

838547   KSQGSLIEIMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVLLEEIINEH  838368

838367   EFQNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIII (0) 838251

838116   DLFSGGSTTSASTMEWAFSELMKKPEIMKKAQDEVREVFKGKETTIDQADIQKLKYIK  837943

837942   MVVKETVRFHPLAPLLAPRESREECEINGYVIPKGTMALVNFWAISRDPKYWQNPEVFDP  837763

837762   ERFNDSHLDFIGAHFEFTPFGTGRRICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHE  837583

837582   LDMTEKFSNALERKNNLFLIPSPYVRA*  837499

 

$

 

>CYP71D201 CYP71D.76

iTAG gene:chr06.711 100% missing N-term

PGSC0003DMB000000075

1362523-1365033 (+) strand, one frameshift

79% to CYP71D.72, 65% to scaffold05575 tomato

first exon 76% to CYP71D200P and 75% to CYP71D201P

1362523   MYFTLVTIVSLLLLFSFVVFLVS &

1362593   KAKKQIKLPPGPWRLPFIGSLHHLIGRGPLHCTLRNFAQRYGPLMYLQLGEIPVVIISSPTIAKE  1362787

1362788   LLTTHDLAFSDRPQSMSTNITFYNNKNIAFCPHDNYWKQMRKICNVQLLSVKMVKSFGAI  1362967

1362968   RKDEISSPVSSIRSTKGSPINMTEKIFWFTNSVTCSAPFGKIFKNRDEFIKLLKDMVI  1363141

1363142   LVSGFDVADFFLLGSYKLSGVESRLMNVHKKVDEIMEDILKEHLENKATRNKGIGEFG  1363315

1363316   GEDLVDVLLRVTEDAELECPFTNDHIKAVIL (0) 1363408

          DIFVAGSEPSVAITIWVLLEIL

1364494   KNPNIMAKTQKEVRQVFKGKKHYDDEENMEKLTYLNLVIKETLSLHTPTPLLPPRKCREQ  1364673

1364674   IYIDGCTIPLKTKIFVNAWALVSDSESWHDPESFIPERFENSSIDFMGNHFEFIPFGYGR  1364853

1364854   RICPRILFGLFNVKLHLAKLLYHFEWELPYGMNLKELDTAETHGLSGAKQKDLYLVARS*  1365033

 

$

 

>CYP71D285P CYP71D.77P

PGSC0003DMB000000432

202443-202928 (+) strand

84% to CYP71D.72, 77% to scaffold05575

202443   GKENYDDEENLEKLTYLNLVIKETLRLHTPIPLLPPREWTEQTDIDGCTIPLKTRILVNA  202622

202623   WALARDPESWHDPESFIPERFENSSIDFMGNRFEFLPFGAGRRICPGILFGLFNVKLPLA  202802

202803   QLLYHLEWELPYGMNPKDLDMTETHGLSGAKQNDLYLVARS*  202928

 

$

 

>CYP71D286P CYP71D.78P

PGSC0003DMB000003501

3-479 (-) strand

93% to CYP71B.16, 91% to CYP71D184 tomato

479   KETFDENDVEELKYLKLVIKETFRLHPPGPLLIARECREEVDINGYTIPLKTKVMVNAWA  300

299   IGRDPKYWIDAECFKPERFEQISIDFIGNNFEFLPFGSGRRMCPGISFGLANVFFPLAKL  120

119   LYHFDWKLPIGINPSDLDLTESAGITCTRKSNLYLIATP  3

 

$

 

>CYP71D287 CYP71D.79

iTAG gene:chr05.736 83% not the same sequence

PGSC0003DMB000004750

2-688 (+) strand

92% to CYP71D204 tomato, 95% to CYP71D204 potato

  2   YLQLGQVHVVVISSPTIAQEILKTHDLTFADRPQFVSTNIIFYNNKDVAFCQYGDYWRQM  181

182   RKICIVELLSAKMVKSFSGIRQDELSSLISSIRSTKGSTINMTEKVFQFTNCVTCRSAF  358

359   GKICKDRNEFITLLKDVLVFAGGFDVADLFPSWKLLHNISGVKSRLVKAHQKIDAIMEN  535

536   IINEHIENKAAGKKGNGEFGDEDLVDVFLRVKENAELQFPITNDHIKAAIS (0)  688

 

$

 

>CYP71D288P CYP71D.80P

iTAG gene:chr06.446 75% not the same sequence

PGSC0003DMB000000088

420230-424538 (-) strand

65% to CYP71D.46, 71% to CYP71D200P tomato

424538   MFKNLLALEVFHIIVTLAEATLVSLLLFFSILFILVSKSKKQI

424409   KLPPGPWRLPFIGSLHHLIGRGLLHRTLSNLAQRYGSVMYLQLWKIPVVIISSPTIAKE  424233

424232   LLTIHDLAFSDRPQSTSTNIIFYNNEDIAFSLHDMY*KKMRNICNVQLLSAKMVKSFGRI  424053

424052   RKDEISSLVSSIHSTRSSPINMT*KIFQFTNSVTCSAAFGKMFKDRDMFIKLLKDI  423885

423903   KIVEGYIFLVSGFDVADLIPSWKLLRELSGAESRLMNFHK  423784

421655   ILKENLENKATRNKGISEFGGEDLVDVLHRLMEDTELEYPITNDHIKAVII (0)  421503

         DIFVAGSETSAAITIWVLSEMM

420716   KKPNIIAKALKEVTQVFSGKKNYDNEEKLEKLTYLNLVIKETLR  420585

420555   RECREQTNIDGCTIFL  420508

420514   IPAWALARDPESWHDVESYIPESFENSSIDFMGNHFEFIPIGAGIRICPGILFGFFNVKH  420335

420334   PLA*LLYHFEWELPYGMNPKDLDMTETHVIMHQI* 420230

 

$

 

>CYP71D289P CYP71D.81P

PGSC0003DMB000000558

1-627 (+) strand

86% to CYP71D.46, 85% to scaffold05575 tomato

  1   EHIENKAAGKKGSGEFGDEDLVDVFLRVKENAELQFPITNEHIKAVI  141

      DIFIAGTETSSTTIIWALSELMM

332   NPNVMVKAQGEVRQVFKGKKNYGEEDIEKLTYLKLVIKETLRLHTPVPLIGPRECRENTN  511

512   IDGYTIPYKARVLVNHGHLREIRKIGKIPK  601

559   WALARDPKNWENPESFIPERFEK  627

 

$

 

>CYP71D290P CYP71D.82P

PGSC0003DMB000000558

5535-5691 (+) strand

17 copies of a small pseudogene

78% to CYP71D.45, 71% to scaffold05575 tomato

5535   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY & 5639

5641   STNIIFYNNKDIVFSQY  5691

 

$

 

>CYP71D291P CYP71D.83P

PGSC0003DMB000000558

5840-5996 (+) strand

5840   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY &  5944

5946   STNIIFYNNKDIVFSQY  5996

 

$

 

>CYP71D292P CYP71D.84P

PGSC0003DMB000000558

5997-6101 (+) strand

5997   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY & 6101

6103   STNIIFYNNKDIVFSQY  6153

 

$

 

>CYP71D293P CYP71D.85P

PGSC0003DMB000000558

6154-6310 (+) strand

6154   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  6258

6260   STNIIFYNNKDIVFSQY  6310

 

$

 

>CYP71D294P CYP71D.86P

PGSC0003DMB000000558

6311-6467 (+) strand

6311   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  6415

6417   STNIIFYNNKDIVFSQY  6467

 

$

 

>CYP71D295P CYP71D.87P

PGSC0003DMB000000558

6468-6624 (+) strand

6468   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  6572

6574   STNIIFYNNKDIVFSQY  6624

 

$

 

>CYP71D296P CYP71D.88P

PGSC0003DMB000000558

6625-6781 (+) strand

6625   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  6729

6731   STNIIFYNNKDIVFSQY  6781

 

$

 

>CYP71D297P CYP71D.89P

PGSC0003DMB000000558

6782-6938 (+) strand

6782   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  6886

6888   STNIIFYNNKDIVFSQY  6938

 

$

 

>CYP71D298P CYP71D.90P

PGSC0003DMB000000558

6939-7095 (+) strand

6939   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7043

7045   STNIIFYNNKDIVFSQY  7095

 

$

 

>CYP71D299P CYP71D.91P

PGSC0003DMB000000558

7096-7252 (+) strand

7096   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7200

7202   STNIIFYNNKDIVFSQY  7252

 

$

 

>CYP71D300P CYP71D.92P

PGSC0003DMB000000558

7253-7409 (+) strand

7253   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7357

7359   STNIIFYNNKDIVFSQY  7409

 

$

 

>CYP71D301P CYP71D.93P

PGSC0003DMB000000558

7410-7566 (+) strand

7410   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7514

7516   STNIIFYNNKDIVFSQY  7566

 

$

 

>CYP71D302P CYP71D.94P

PGSC0003DMB000000558

7567-7723 (+) strand

7567   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7671

7673   STNIIFYNNKDIVFSQY  7723

 

$

 

>CYP71D303P CYP71D.95P

PGSC0003DMB000000558

7724-7880 (+) strand

7724   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7828

7830   STNIIFYNNKDIVFSQY  7880

 

$

 

>CYP71D304P CYP71D.96P

PGSC0003DMB000000558

7881-8037 (+) strand

7881   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  7985

7987   STNIIFYNNKDIVFSQY  8037

 

$

 

>CYP71D305P CYP71D.97P

PGSC0003DMB000000558

8038-8194 (+) strand

8038   ELCTTPIAVISSPTIAQEILRTQNLAFAHRPQFVY  8142

8144   STNIIFYNNKDIVFSQY  8194

 

$

 

>CYP71D306P CYP71D.98P

PGSC0003DMB000000558

8118-8418 (+) strand

89% to CYP71D.46, 86% to scaffold05575 tomato

8198   DSFIPKRFENSSVDFMGN  8249

8263   FIPFGAGRRMCPGIQFGLANVGLPLAQLLRHFEWELPYGVNPKDLDMTETHG  8418

 

$

 

>CYP71D307P CYP71D.99P

PGSC0003DMB000000558

13732-13988 (+) strand

77% to CYP71D.45, 75% to scaffold05575 tomato

13732   VISSPTIAQEILRTQNLAFADKATI  13806

13815   STNIIFYNNKDIVFSQYGNYRRHMHKIYIVELLSVKMVKSFSKTRQDKLSNLISSIRS  13988

 

$

 

>CYP71D202P CYP71D.100P

PGSC0003DMB000005472

2-644 (-) strand

84% to CYP71D.27P, 92% to CYP71D202 tomato

644   QVPTVVISSPSMAKQVLKTHDLAFVNRPQLTSTNIIFYNNKDIAFSQYGDYWRQMRKTCT  465

464   LELLSTKMVKSYGAVREDELSSLISSIRSTMGNTINMTQIIFLFSNSIICRSAFGKIC  291

290   KKRDEFLTILKEVLLLGAGFFVGDLFPSWKLL & 195

192   HNLRGEKTRMVNAHKKVDAVMEEILNEH & 109

106   RNKAAGKKGNGEFGDEDLVDVLLRVKENAELQYPI  2

 

$

 

>CYP71D308P CYP71D.101P

PGSC0003DMB000013317

3-221 (-) strand

93% to CYP71D.46, 91% to scaffold05575

221   VLRNLSQRYGPIMYLQLGQVPTVVISSPIIAQEILKTHDLAFANRPQFVSTNIIFYNNKDV  39

 38   SFSQYGDYWRQM  3

 

$

 

>CYP71D309P CYP71D.102P

PGSC0003DMB000000079

1474388-1474767 (-) strand

74% to CYP71D.37P, 74% to scaffold02597

1474767   INGCTMLAKATVLVNIWAMRRYPEV*EDPENFISVSFENCPIEYLGNNYE  1474618

1474617   YLLFCA*KRICPGMQFGLANVKNPLARLLYHFNWGLPCGTSTPKDLYMSE  1474468

          KKGLSAEKEKALYLIAKMNQSFDVML* 1474388

 

$

 

>CYP71D310P CYP71D.103

PGSC0003DMB000012109

3-176 (+) strand

90% to CYP71D.8P

  3   MRKICLLELLSAKNVKSFSSIRQDEVLHMIEFFRSSSGETVNATKRIYQFSSSMICRS  176

177   AFG  185

 

$

 

>CYP71AH9 ortholog CYP71AH.1

iTAG gene:chr06.2861 99%

PGSC0003DMB000000128

419110-422756 (-) strand

93% to scaffold06019 tomato, 76% to CYP71AH1 tobacco

422756   MLASFFLFLFILFSFTKKKNKGKKLL

422678   PSPRKLPIIGNLHQLGKLPHRSLQKLSNEYGDLIFLQLGSIPTLLVSSADVAKEIFR  422508

422507   VHDVAFAGRPPLYAAKRLSYNCCNVSFAPYG n 422415

422013   YWREARKILALELLSAKRVESFSSIRDEEVSRLIQEIGKSLNSSINISAL  421864

421863   ALTLSNNVVCRVAFGKGSDDESGYDNGGKKFHEILYDTQELLGEFNVADYFPKMAWIN  421690

421689   KFNGLDERLEKNFRELDKYYDKVIEDHVDSRNWIKEKDDEDLVDVLLRIQKDPNRD  421522

421521   VPLQDSHIKGLLA (0)  421483

         DIFIAGTDTSATTIEWIMAELML

419652   NPKVMKKVQQEVRQVAKGKQKVQETDLYKLEYMKLVIKESLRLHPPAPLLIPRVTTSSCK  419473

419472   IMDYEIPENTRVLINATAIGTDPKYWENPLTFIPERFLNKDIDYRGQNYEFLPFGAGRRG  419293

419292   CPGINFSVPLVELAIANLLFHYDWTLPQGLKAKDLDMEEALGITMHKKIPLCLAASYYDL*  419110

 

$

 

>CYP71AT30 CYP71AT.1

iTAG gene:chr09.2461 96% missing region around a frameshift and N-term 22 aa

PGSC0003DMB000000280.1

136952-138717 (+) strand, one frameshift

75% to scaffold01891 tomato

136952   MIFFLFSISLPIILIFLLHKNKMSRKTILPPGPLGLPFIGNLHQFDCLNPRLYFW  137116

137117   KLYQKYGKIFSLKIGSVTMVVISSAKLAKEVTQIQDLTFCSRPSFVGQQKVSYNGSDICF  137296

137297   SPYNDYWREIRKICVVHLFSLKKEQLFRPIREDEVSRMIKKIYQQAAASQITNLSNILTS  137476

137477   LTSTIICRIAFGIRYDEEAHEKRRFDEHLALSQEMAATFFVSDYFPLLGWMDKLSGK  137647

137648   ISRLEKNFKILDEFYQELIDQHYNPNRPKSMEGDIIDILLELRKEQSTPFDLTLDNIKAILT (0) 137830

138005   DIFFGGTETSAVPIIWAMTMLIKNPKAMKKVQKEIRKTIGNKGIVNEDDVQNMPYLKAVI  138184

138185   KETFRLYPPSPLLMPRESIQKSTLEGYEIQPKTVVYVNT & 138301

138304   MIGRDPEIWENPEEFIPERFLNSDIDYFKGQNFELIPFGAGRRGCP (1)

         AVSLGVATVNLVLPNLLYAFDWELPYGIMKEEIDTTIMPGLGMHKKNDLCLVPKKYPYT*  138717

 

$

 

>CYP71AT31 CYP71AT.2

iTAG gene:chr09.2462 100% missing N-term 22 aa

PGSC0003DMB000000280.2

140394-142844 (+) strand

78% to scaffold01891 tomato

140394   MMFFLFSLALSIIFIFLLHKAKMSRKTFLPPGPLGLPFIGNLHQYDSLNPHLYFWK  140561

140562   LSQKYGKIFSLTIGSSTMIVISSAKLAKEVLKTQDLTFCSRPSFLGQQKLSYNGHDIAFA  140741

140742   PYNEYWRKMRKVCVVHLFSLKKVQSFSLIREDEVSKVIKKISQQAAASQIINLSDIVISL  140921

140922   TNTIICKIAFGIRYDEETHEKRKFAELSTMAEELMTHFFFSDYFPMFGWLDKLFGNI  141092

141093   SRLEKNFNDLDEFFEELINQHLNPNRPKSMEGDIIDLLLQLRKEQSTSIDLTLDNIKGILM (0) 141275

141838   DILTGGTDTNAVAVIWSMTALMKNPEVMKKVQEEIRKSIRIKGIVNEDDIQNMPYFNAVIKEIF  142029

142030   RLYPPAPLLVPREAMEKSILEGYEIQPGTIIHVNSWAIARDPEIWENPEEFIPERFLNCD  142209

142210   IDFKGQNFELIPFGAGRRGCP (1)  142272

         GIALGVATINLILSNLLYAFDWELPHGMIKEDIDTDGLPGLAMHKKNALCLVPKNYTHT* 142844

 

$

 

>CYP71AT32P CYP71AT.3Pv1

iTAG gene:chr09.2464 76% not the same gene

PGSC0003DMB000000280.3

144313-146217 (+) strand

75% to scaffold01402 tomato

144313   VPPGPLGLPIIGNLHQFDSLTPHIYFWKLSKKYGKIFSLKFGSTSIVVVSSAKLAKEVMK  144492

144493   TQDLTFCSRPSIFSLNKLSYNGHDFAFAPFNEYWREMRKNCSAHLFSLKKVQSFSPIRED  144672

144673   EVLRMIKKISLQ & 144708

144711   ITNLSTILISLTSTIICRVAFGIRYDEEAHERRRFDELLIETQAMLASFFVSNYFPSLS*  144890

144891   IDKLTGLTNRLEKIFKDLDEFYEELVDQHVDPNRPKSMKGDILDLLVQLNNDKSLP  145058

145059   VDVTLEDIKALAM (0)  145097

145705   NMLVAGSETSAAAIVWAMTALMRNPRAMKKVQAEIR*SIGKKGIVNEDGGGI  145860

145861   *NSARNATTIYVNFWAIARDPEIWDNSNEFIPERF  145965

145966   LNSDIDFKGQNFELISFGAGRRGCPAITLGVAIVELALSNFL*AFNWKLPHGMRKEDIDT  146145

146146   TSRPGIAMHKKIDLCLIPTNYLWT  146217

 

>CYP71AT.3Pv2

PGSC0003DMB000048733

3-110 (+) strand

100% to CYP71AT.3P

3   DSLTPHIYFWKLSKKYGKIFSLKFGSTSIVVVSSAK  110

 

$

 

>CYP71AT33 CYP71AT.4v1

iTAG gene:chr09.2464 95% missing region around frameshift

PGSC0003DMB000000280.4

147016-148728 (+) strand

77% to scaffold01402 tomato

147016   MMLFLFSVALSISLIFLLLKAKISRNTS

147100   VPPGPLGLPIIGNLHQFDSLTPHIYFWKLSKKYGKIFSLKFGSTSIVVVSSAKLAKEVLK  147279

147280   TQDLVFCSRPSLIGQHKLSYNGHDIGFAPYNEYWREMRKICIVHLFSLKKVQSFSPIRED  147459

147460   EVSRMIKKISQQATTSQVTNLSTMLYSLTTTIICRVAFGIRYDEEAHERRRFDELLIETQ  147639

147640   AMMASFFVSNFFPSLSWIDKLTGLTDRLENNFKNLDNFYEELIEQHLNPKRPKSMEGDI  147816

147817   LDLLLQLKKEKSTPIDLTLEDVKALAM (0) 147897

148122   DVLVAGSDTSAAVIVWAMTALMRNPRTMKKVQAEIRQSIGKKGVVNEDDIQNMPYFKAVI  148301

148302   KETLRLYPSAPLFLPRESMKKSILEGYEIESGTTIYVNFWAIARDPEIWENSNEY & 148466

148468   PERFLNSDIDFKGQNFELIPFGAGRRGCPAITLGVAIVELALSNLLYAFDWKFPCGMRKE  148647

148648   DIDTTVRPGIVMHKKIDLCLIPTNYL*  148728

 

>CYP71AT.4v2

PGSC0003DMB000035582

3-122 (-) strand

100% to CYP71AT.4

122   WIDKLTGLTDRLENNFKNLDNFYEELIEQHLNPKRPKSME  3

 

$

 

>CYP71AT13a CYP71AT.5v1

iTAG gene:chr09.2466 85% not the same sequence

PGSC0003DMB000000280.5

150882-152699 (+) strand

90% to CYP71AT13 scaffold01402 tomato, 96% to CYP71AT.10

150882   MLFPLFLALVIFIILSFLLAKAKRNGKNILPPGPLGLPFIGNLHQFDDLTPHLYFWKLS  151058

151059   KKYGKIFSLKFGSTPVVVISSAKLAKEVMKTQDLAFCSRPSTLCQQKYSYNAQDIATSPY  151238

151239   NDNWKELRKICVGHLFTPKKVQSFIPIREDEVSRMIKEISQQAVTSRITNLSSILISLTT  151418

151419   TIICRVAFGIRYDEETHERRNFNELLKVTEEMLVSFFVSDFFPLLGWINNLSEKINI  151589

151590   LEKNFKDLDEFYGLIEQHLSPNRPKSMEEGDIIDLLLQLKKEKSTPIDLTLDNIKAIIM (0) 151766

152091   NMLVGGTNTSAATIIWAMTALIANPNAMKKVQAEIRESVGKKSMVNEDDVQTLPYFK  152261

152262   AVIKETLRLYPPAPLLVPRETMENSILEGYEIKPKTIIYVNAWAIARDPEIWENPEEFIP  152441

152442   ERFLNSDIDFKGQHFELIPFGAGRRGCPAMALGVANVELVLSNLLYAFDWELPCGMKRED  152621

152622   IDTDVLPGLTMHKKKPLCLVPQNYL*  152699

 

>CYP71AT.5v2

PGSC0003DMB000060396

2-100 (-) strand

100% to CYP71AT.5

100   LIEQHLSPNRPKSMEEGDIIDLLLQLKKEKSTP  2

 

>CYP71AT.5v3

PGSC0003DMB000061037

1-102 (-) strand

100% to CYP71AT.5

102   NEDDVQTLPYFKAVIKETLRLYPPAPLLVPRETM  1

 

$

 

>CYP71AT34 CYP71AT.6v1

iTAG gene:chr09.2466 98% does not match at intron boundary

PGSC0003DMB000000280.6

155155-156682 (+) strand

82% to scaffold01402 tomato, 96% to CYP71AT.33

155155   MFFPFFVALVIIIILSFLLPKVKKKEKNILPPGPLRLPFIGNLHQFDGLTPHIYFWKLSKIYGKI  155349

155350   FLLKLGSTPIIVISSAKLAKEVMKTQDLAFCSRPSILGQQKLSYNNQDIATSPYNDHWKE  155529

155530   LRKICVGHLFSLNKVQSFIPIREDEVSRMIKKISQQAVTSRITNLSSILISLTTTIICRV  155709

155710   AFGIRYDEETHERRNFNELLKVTEEMLAGFFVSDYFPLLGWIDKLSGKINKLEKNFKDLD  155889

155890   EFYEGLIEQHLNPNRPKSMEEGDIIDLLLQLKKEKSTPSDLTLDNIKAIGGY (0)  156045

156074   NMLVAGTDTSAATVIWAMTALMANPNSMNKVQAEIRESVGEKSIVNEDNVQNLPYFKAVI  156253

156254   KETFRLYPAVPLLVARETMQNSILEGYEIKPKTIVYVNAWAIGRDPEIWKNPEEFIPERF  156433

156434   LNNDIDFKGQDFELIPFGAGRRGCPGIALGVANVELVLSNLLYAFDWELPRGMKIKDIDT  156613

156614   DVLPGIIPHKKKPLCLVPRNYH*  156682

 

>CYP71AT.6v2

PGSC0003DMB000012119

2-247 (+) strand

100% to CYP71AT.6 and CYP71AT.33

  2   LEGYEIKPKTIVYVNAWAIGRDPEIWKNPEEFIPERFLNNDIDFKGQDFELIPFGAGRRG  181

182   CPGIALGVANVELVLSNLLYAF  247

 

>CYP71AT.6v3

PGSC0003DMB000005209

3-176 (-) strand

100% to CYP71AT.6

176   LPPGPLRLPFIGNLHQFDGLTPHIYFWKLSKIYGKIFLLKLGSTPIIVISSAKLAKEV  3

 

>CYP71AT.6v4

PGSC0003DMB000013134

102-224 (-) strand

100% to CYP71AT.6v1

224   LLYAFDWELPRGMKIKDIDTDVLPGIIPHKKKPLCLVPRNY  102

 

>CYP71AT.6v5

PGSC0003DMB000018287

1-168 (+) strand

100% to CYP71AT.6v1

1   KVQAEIRESVGEKSIVNEDNVQNLPYFKAVIKETFRLYPAVPLLVARETMQNSILE  168

 

$

 

>CYP71AT36 CYP71AT.7

iTAG gene:chr09.2466 81% not the same sequence

PGSC0003DMB000000280.7

158351-160262 (+) strand, one frameshift

88% to CYP71AT15 tomato

158351   MMFFPLSVALVIIIILTFLIPKAKRNGKCILPPGPLGLPFIGNLHQYDSLIPHLYFWK  158524

158525   LSRKYGKIFSLKLGSSTMVVVSSANLAKEVTQIQDLAFCSRPSLLGQQKLSYNGQDIGLS  158704

158705   PYNDYWRELRKICVVHLFSLKKVQYFSPIREDEVSRMIKKISQQAATSQITNLSNIVISL  158884

158885   TTTIICRIAFGVRYDEETPEGRKFNVLLKVTEEMLAGFFVSDYFPLLGWIDKLSGKINKL  159064

159065   EKNFKDLDEFYEGLIEQHLNPDMPKSMEGDIIDLFLRLKKEKSTPIDLTLENIKAIIM (0) 159238

159652   NMLVGGTDTSAAAVVWAMTALISKPNAMKKVQAEIREM & 159765

159776   KSVVNEEDIQNLPYFKAVIKETFRLYPPAPLLIARETMQNSILEGYEIKPKTIVHVN & 159946

159948   FWAIARDPEIWENPEEFIPERFLNSDIDIKGQNFELIPFGAGRRGCP  160088

160089   AMALGVATVELVLSNLLYAFDWELPCGMKKEDIDTDVLPGLTMHKKEPLCLVPRNYH*  160262

 

>FI033502.1 tobacco FH434438.1, FI006728.1, FH605148.1, FH346097.1, ET755410.1|

80% to scaffold03134 tomato, 55% to CYP82S.1

MDYHISFHFQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNI

PFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGY

KYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN

MQKVNISKWFEQLTLNIIVKTICGKRYSNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIP

FPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEF

KAYGFSQATVIKSTVL (0)

SLILDGNDTTAVH

LIWVMSLLLNNPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVPFL

LPHEAVQDCKVAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPERFLTSKANVDARGQN

FEFIPFGSGRRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKVNQV

EVLISPRLPSKLYVF*

 

$

 

>CYP71AT37Pa CYP71AT.8P

PGSC0003DMB000000280.8

161796-162684 (+) strand

80% to scaffold01402 tomato

161796   MILFPLFVALVIIIILSFLLPKAKRSGKNILPPGPLGLPFIGNLHQYDSLTPHLYFWK  161969

161970   LSQKYGKIFSLKLCSSTMIVVYSANLAKEVMKTQNLAFCSRPSLLGQQKLSYNGQVIAMS  162149

162150   PNNDYWKEIR & 162179

162181   KICVAHLCCLKKVQYFRPIPEDEVARMIKKLSVQAATSQITNLSNIMSSLTTTIIC  162348

162349   RVAFGIRYDGETREGRKFGELLKVAQEMLADFFVSDYFPLLGWIDKLSGKINKLEKNFKD  162528

162529   FDEFNEGLIEQHLNPNRP*SMEGDIIDLLLQLKKEKSTPIDLTLDNIKAIIM (0) 162684

 

$

 

>CYP71AT38Pa CYP71AT.9Pa

PGSC0003DMB000000280.9

162879-163291 (-) strand

91% to scaffold01402 tomato

163291   SFSYYSHFLLHKTKISRNTNLPPGPLDLPIIGNLHQYDSVTPHIYFWKLTKKYGKIFLLK  163112

163111   FGSTPVVVIFSAKLAKEVMKTQDLAFCSRPSTLCQQKLSYNSHDIVFSP & 162965

162962   DYWREIRKLCLLHLFSLKKVQS*LYDRV  162879

 

>CYP71AT39P CYP71AT.9Pb

PGSC0003DMB000000280.9

163661-168556 (+) strand

74% to scaffold01402 tomato

163661   FFPSLSWIDKLTGLTDRLENNFKNLDNFYEELIEQ  163765

167950   DVLVAGSDTRAAVIVWAMTALMRNPRAMKKVQAEIRQSIGKKGIVNEDDIQNMSYLKAVI  168129

168130   KETLRLYPSAPLLLPRESMKKSRLEEYEIESGTTIYVNFWAIARDPEIWENSNEY & 168294

168296   PERFLNSDIDFKGQNFELIPFGAGRRGCPTITLGVATVELALSNLLYAFDWKLPWSMRKE  168475

168476   DIDTTVRPGIVMHKKIDLCLIPTNYL*  168556

 

$

 

>CYP71AT13b CYP71AT.10

iTAGgene:chr09.2466 85% not the same sequence

PGSC0003DMB000000280.10

171354-181341 (+) strand

90% to CYP71AT13 scaffold01402 tomato, 96% to CYP71AT.5

171354   MLFPLFLALVIFIILSFLLAKAKRNGKNILPPGPLGLPFIGNLHQ & 171488

171508   FDGLTPHLYFWKLSKKYGKIFSLKFGSTPVVVISSAKLAKEVMKTQDLAFCSRTSTL  171678

171679   CQQKYSYNAQDIAASPYNDNWKELRKICVGHLFSPKKVQSFIPIREDEVSRMIKEISQQD  171858

171859   VTSRITNLSSILISLTTTIICRVAFGIRYDEETHERRNFNELLKVTEEMLVSFFVSD  172029

172030   FFPLLGWIDNLSEKINILEKNFKDLDEFYEGLIEQHLSPNRPKSMEEGDIIDLLLQL  172200

172201   KKEKSTPSDLTLDNIKAIIM (0) 172260

180733   NMLVGGTNTSAATIIWAMTALIENPNAMKKVQAEIRELVGKKSIVNEDDVQTLPYFK  180903

180904   AVIKETLRLYPPAPLLVPRETMKNSILDGYEIKPKTIIYVNAWAIARDPEIWKNPEEFIP  181083

181084   ERFVNSDIDFKGQNFELIPFGAGRRGCPAMALGVANVELVLSNLLYAFDWELPCGMKRED  181263

181264   IDTDVLPGLTMHKKKPLCLVPQNYH*  181341

 

$

 

>CYP71AT17a CYP71AT.11v1

iTAGgene:chr09.2473 100%

PGSC0003DMB000000280.11

194178-195974 (+) strand

93% to CYP71AT17 scaffold01891 tomato, 1 aa diff to CYP71AT.20 except C-term

194178   MIMIIFILLVTLPIVLNFLAKKGRKNVMPPGPLGLPFIGNLHQYDGLTPHIYFSKLSKK  194354

194355   YGKIFSLKLGSTPIVVISSAKLAKEVLKIQDLTFCSRPSFLGQQKLSYNGHDIAFAPYND  194534

194535   YWREMRKVCVVHLFSLKKVQSFSPIREDEVSRMITKISQQATASQITNLSTLVISLTSTI  194714

194715   ICRVAFGIRYDEEAHDKRRFDELLAVTQEMSARFFFTDYFPLFGWLDKLFGNISRLE  194885

194886   KNYKDLDEFYEDLIQQHLNSSKPKSMEGDIIDLLLQLKKAQLTPIDLTLDNIKAILM (0) 195056

195254   NIFVGGTDTSAATVVWAMTALIKNPKVMKKVQEEIRKSIGTKGFVNEDDVQNMPYLK  195424

195425   AVIKETFRLYPPAPLLVPRETMKKSTLEGYEIQPGTIIHVNSWAIARDPEIWENPKEFMP  195604

195605   ERFLNSDIDFKGQDFELLPFGAGRRGCP (1)  195688

         GIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGITMHNSSEFEENKFFFF* 195974

 

>CYP71AT.11v2

PGSC0003DMB000009266

3-330 (+) strand

100% to CYP71AT.11 CYP71AT.12P, CYP71AT.20

  3   FMPERFLNSDIDFKGQDFELLPFGAGRRGCP (1) 95

208   GIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGI  330

 

>CYP71AT.11v3

PGSC0003DMB000005885

134-583 (-) strand

100% to CYP71AT.11 and CYP71AT.20

583   IREDEVSRMITKISQQATASQITNLSTLVISLTSTIICRVAFGIRYDEEAHDKRRFDELL  404

403   AVTQEMSARFFFTDYFPLFGWLDKLFGNISRLEKNYKDLDEFYEDLIQQHLNSSKPKSM  227

226   EGDIIDLLLQLKKAQLTPIDLTLDNIKAILM (0) 134

 

>CYP71AT.11v4

PGSC0003DMB000020956

10-156 (-) strand

100% to CYP71AT.11

156   PHIYFSKLSKKYGKIFSLKLGSTPIVVISSAKLAKEVLKIQDLTFCSRP  10

 

>CYP71AT.11v5

PGSC0003DMB000020769

13-156 (+) strand

1 aa diff to CYP71AT.30P

13   PHIYFWKLSKKYGKIFSLKFGSIPVVVISSAKLAKEIMKTQDLAFCSR  156

 

>CYP71AT.1v6

PGSC0003DMB000033741

12-125 (+) strand

100% to CYP71AT.11

12   LSYNGHDIAFAPYNDYWREMRKVCVVHLFSLKKVQSFS  125

 

$

 

>CYP71AT17a-de2b CYP71AT.12Pv1

PGSC0003DMB000000280.12

196405-197132 (+)

94% to scaffold01891 tomato, 2 aa diffs to CYP71AT.20

196405   NIFVGGTDTSAATVVWAMTALIKNPKVMKKVQEEIRKSIGTKGFVNEDDVQNMPYLK  196575

196576   AVIKETFRLYPPAPLLVPRETMKKSTLEGYEIQPGTIIHVNSWAIARDPEIWENPKEFMP  196755

196756   ERFLNSDIDFKGQDFELLPFGAGRRGCP (1)  196839

         GIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGILMHKKNDLCLVPKKIFLD* 197132

 

>CYP71AT.12Pv2

PGSC0003DMB000026291

6-137 (-) strand

100% to CYP71AT.12P

137   KKSTLEGYEIQPGTIIHVNSWAIARDPEIWENPKEFMPERFLNS  6

 

>CYP71AT.12Pv3

PGSC0003DMB000013164

3-191 (-) strand

100% to CYP71AT.12P

191   PLDLIIL*NIFVGGTDTSAATVVWAMTALIKNPKVMKKVQEEIRKSIGTKGFVNE  27

 26   DDVQNMPY  3

 

$

 

>CYP71AT41Pv1 CYP71AT.13Pv1

PGSC0003DMB000000280.13

200067-200863 (+) strand

81% to scaffold01402 tomato

200067   MMLFPLFVALLIIIILTSLLPKAKRNG

200148   KNILPPGPLGLPFIGNLHQFDGLTPHLYFWKLSKKYGKIFSLKLGSSTMIVVSSANLAEE  200327

200328   VTKTQDLAFCSRPSLLGQQKLSYKVKILA & 200414

200414   LSPYNDYWREL*KICVVHLFSLKKVQYFSPIREDEVSRMIKKISQKAATSQITNLS  200581

200582   NIVISLTTTIICRIAWL*LFSLLGWIDKLSG  200674

200675   KINKLEKNFKDLDEFYEGLIEQHLNPNRPKSMEGDIIDLLLRLQKEKSTPIDLTLENIKAIIM (0) 200863

 

>CYP71AT.13Pv2

PGSC0003DMB000033457

3-122 (+) strand

100% to CYP71AT.13P

3   NLHQFDGLTPHLYFWKLSKKYGKIFSLKLGSSTMIVVSSA  122

 

>CYP71AT.13Pv3

PGSC0003DMB000020724

1-99 (+) strand

1 aa diff to CYP71AT.13P

1   KSMEGDIIDLLLRLKKEKSTPIDLTLENIKAII  99

 

$

 

>CYP71AT15v1 CYP71AT.14

iTAG gene:chr09.2476 95% missing N-term and some seq around stop codon

PGSC0003DMB000000280.14

202191-204158 (+) strand, one stop codon

87% to CYP71AT15 tomato

202191   MMLFPLFVAIVIFIIPSFLLPKGKRNGKNILPPGPLGLPFIGNLHQFDGLTPHLYFWK  202364

202365   LSKKYG & 202382

202385   IFSLKLGSSTMIVVSSANLAKEVTQIQDLAFCSRSSILGQQKLSYNGQDIGFSPYNDYWR  202564

202565   ELRKICVVHLFSLKKVQYFSPIREDEVSRMIKKIS*QAATSQITNLSNIVISLTTTIIYR  202744

202745   IAFGVRYDEETREVRRFNELLKVTEEMLAGFFVSDYFPLLGWIDKLSGKINKLEKNFKDL  202924

202925   DEFYEGLFEQHLNPNRPKSMEGDIIDILLRLKKEKSTPIDLTLDNIKGIIM (0) 203077

203550   NMLVGGTDTSAAAVVWAMTALISKPNAMKKVQAEIRESVGEKSIVNEDNVQNLPYFK  203720

203721   AVIKETFRLFPPGPLLIARETMQNSILEGYEIKPKTIIHVNVWAIARDPEIWENPEEFIP  203900

203901   ERFLNSDIDFKGQNFELIPFGAGRRGCPAVALGVTTVELVLSNLLYAFDWELPSGMKKED  204080

204081   IDTDVLPGLTMHKKEPLCLVPRNYH*  204158

 

$

 

>CYP71AT42Pv1 CYP71AT.15Pv1

iTAG gene:chr09.2466 78% not the same sequence

PGSC0003DMB000000280.15

205864-207531 (+) strand

85% to scaffold01402 tomato, exon 2 has only 1 aa diff to CYP71AT.31

205864   MLFPLVVALVIIIILSFLLPKAKRSGKNILPPGPLGLPFIGNLHQYDSLTPHLYFWK  206034

206035   LSKKYGKIFSLKLGYSTMIIVSSANLAKEVMKTQDLAFCSRPSLLGQQKLSYNGQDIAMS  206214

206215   PYNDYWRELRKICVVHLFSLKKVQYFSPICEDEVSRMIKKIS*QAATSQITNLSNIVISL  206394

206395   ATTII & 206409

         YRIAFGVRYDEETREVRRFNELLKVTEEMLAGFF

206510   VSDYFPLLGWIDKLSGKINKLEKNFKDLDEFYEGLIEQHLNPNRPKSMEG 206659

206922   NMLVGGTDTSAATVVWAMTALIAKPNAMKKVQAEIRESVGKKFIVNEDDIQDLP  207083

207084   YFKAVIKETFRLYPPGPLLVPRETMQNSILEGYEIQPKTIVHVNFLAIARDPEIWENPEE  207263

207264   FIPERFLNSDIDFKGQNFELIPFGAGRRGCPAMALGVTTVEL &

         VLSNLLYAFDWELPPGMNIEDIDTDVLLGLAVHKKEPLCLVPRNYH* 207531

 

>CYP71AT.15Pv2

PGSC0003DMB000012130

100% to CYP71AT.15P

243   QAEIRESVGKKFIVNEDDIQDLPYFKAVIKETFRLYPPGPLLVPRETMQNSILEGYEIQP  64

 63   KTIVHVNFLAIARDPEIWEN  4

 

>CYP71AT.15Pv3

PGSC0003DMB000058666

1-102 (-) strand

100% to CYP71AT.15P

102   SDIDFKGQNFELIPFGAGRRGCPAMALGVTTVEL  1

 

>CYP71AT.15Pv4

PGSC0003DMB000008505

4-129 (+) strand

100% to CYP71AT.15Pv1

4   NLLYAFDWELPPGMNIEDIDTDVLLGLAVHKKEPLCLVPRNY  129

 

$

 

>CYP71AT16v1 ortholog CYP71AT.16v1

iTAG gene:chr09.2479 100%

PGSC0003DMB000000280.16

208993-210254 (-) strand N-term is in a seq gap

94% to CYP71AT16 scaffold01402 tomato, 95% to CYP71AT.30P (6 aa diffs and indel)

210263   VISLTTTIICRVAFGIRFDEEAHEKRRFDELINESQDILASFFVSDFFPSLSWIDKLTGLKNK  210075

210074   LEKNFKCLDEFYEELIEQHHNPNRPKSMEGDIIDLLLQLRKEQSTQINLTLDNIKA  209907

209906   ILM (0)

         NLFLAGTDTSAITVIWAMTALMKNPK  209727

209726   AMKKVQEEVRKSVEKKGIVNEDDTQNMPYLKAVIKETFRLYPPAPILVARETMQNSILEG  209547

209546   YNIPPKTTIRVNYWAIARDSEYWENSEEFIPERFLNSNIDFKGQDFEFIPFGAGRRGCP  209364

         GQALGVATVDLILSNLLYAFDWELPFGMNIEDIDTESLRGITMHKKNDLCLVPKSYM* 208993

 

>CYP71AT.16v2

PGSC0003DMB000033358

2-118 (-) strand

100% to CYP71AT.16

118 NLFLAGTDTSAITVIWAMTALMKNPKAMKKVQEEVRKSV  2

 

$

 

>CYP71AT37Pb CYP71AT.17P

PGSC0003DMB000000280.17

211497-211733 (+) strand, 100% to CYP71AT.8P

211497   VSDYFPLLGWIDKLSGKINKLEKNFKDFDEFNEGLIEQHLNPNRP*SMEGDIIDLL  211664

211665   LQLKKEKSTPIDLTLDNIKAIIM (0) 211733

 

$

 

>CYP71AT38Pb CYP71AT.19P

PGSC0003DMB000000280.19

212014-212364 (-) strand

1 aa diff to CYP71AT.9P

212364   MMFFIFLVAFPIILIFLLHKTKISRNTNLPPGPLGLPIIGNLHQYDSVTPHIYFWKLT  212191

212190   KKYGKIFLLKFGSTPVVVIFSAKLAKEVMKTQDLAFCSRPSTLCQQKLSYNSHDIVFSP  212014

>CYP71AT.18P

PGSC0003DMB000000280.18

211928-212011 (-) strand

100% to CYP71AT.9P

212011   DYWREIRKLCLLHLFSLKKVQS*LYDRV  211928

 

 

$

 

>CYP71AT17b CYP71AT.20

iTAG gene:chr09.2480 100%

PGSC0003DMB000000280.20

225139-226935 (+) strand

93% to CYP71AT17 scaffold01891 tomato, 98% to CYP71AT.11v1

225139   MIMIIFILLVTLPIVLNFLAKKGRKNVMPPGPLGLPFIGNLHQYDGLNPHIYFSKLSKK  225315

225316   YGKIFSLKLGSTPIVVISSAKLAKEVLKIQDLTFCSRPSFLGQQKLSYNGHDIAFAPYND  225495

225496   YWREMRKVCVVHLFSLKKVQSFSPIREDEVSRMITKISQQATASQITNLSTLVISLTSTI  225675

225676   ICRVAFGIRYDEEAHDKRRFDELLAVTQEMSARFFFTDYFPLFGWLDKLFGNISRLE  225846

225847   KNYKDLDEFYEDLIQQHLNSSKPKSMEGDIIDLLLQLKKAQLTPIDLTLDNIKAILM (0) 226017

226215   NIFVGGTDTSAATVVWAMTALIKNPKVMKKVQEEIRKSIGTKGFVNEDDVQNMPYLK  226385

226386   AVIKETFRLYPPAPLLVPRETMKKSTLEGYEIQPGTIIHVNSWAIARDPEIWENPKEFMP  226565

226566   ERFLNSDIDFKGQDFELLPFGAGRRGCP (1)  226649

         GIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGITMHKKNDLCLVPKKYF* 226935

 

$

 

>CYP71AT1a CYP71AT.21

iTAG gene:chr09.2481 86% missing two sections of exon 1

PGSC0003DMB000000280.21

236971-238547 (+) strand

90% to scaffold01402 tomato

96% to CYP71AT1 not found in the genome assembly

236971   MLFLLFVALPIILIFLLPKAKKGAKNTQPPGPVGLPFIGNLHQFDSLTPHIYFWKLS  237141

237142   KKYGKIFSLKLGSTPMVVVSSAKLAKEVLKTQDLVYCSRPSILGQQKLSYNGRDIIFAPY  237321

237322   NDYWREMRKISVLHLFSLKKVQLYKPIREDEVSRMIKKISQHAASSQITNLSNLMISLTS  237501

237502   TIICRFAFGVRFDDEAHERKRFDYLLAETQAMMASFFVSDIFPILGWIDKLNGLTDRLEK  237681

237682   NLKKLDEFYEELIEQHQNPDRPKSMEGDIVDLLLQLKKEKSIPIDLTLEDIKGLLM (0) 237849

237939   DVLVAGSDTSAAGIVWTMTALMKNPKAMKKVQEEIRKSIGNKGIVNEDDIQNMP  238100

238101   YFKAVIKEAFRLYPPVPLLVQRESMKKSTLEGYEIQARTIVHVNSWAIARDPEIWENPEE  238280

238281   FIPERFLNSDIDYKGQNYELIPFGAGRRGCPGMTLGVASMELALSNLLYAFDWELPHGMK  238460

238461   KEDIDTNVRPGITMHKKNELCLIPKSYF*  238547

 

$

 

>CYP71AT20a CYP71AT.22

iTAG gene:chr09.2482 96% missing a small region around the frameshift

PGSC0003DMB000000280.22

239258-241107 (+) strand

85% to scaffold01402 tomato

239258   MMLFLLFVAFPIIVIFLLPKAKKSGKNNLPPGPIGLPFIGNLHQFDSLTPHIYFWKLT  239431

239432   KIYGKNFTLKFGSTPIVVISSAKLAKEVLKTQD & 239530

239532   LVFCSRPSLLGQQKLSYNGHDIGFAPYNDHWRERRKICVLHLFSLKKVQSFSPIREDEVS  239711

239712   RMIKKIYEQAINSKITNLSNLMISLTSTIICRIAFGVRFDEEGHERKRFDCLLAEAQAMS  239891

239892   VSFFVSDFFPSLSWIDKLTGLTNRLEKIFQDLDEFYEELIEQHQNPNRAKSMEGDI  240059

240060   LDLLLQLKKERSTSIDLTLDDIKGILM (0)  240140

240499   DVFVAGSDTSAAAVEWAMTALIKNPKIMKKVQKEIRETIGTKGIVNEDDIQNMSYFKSVI  240678

240679   KETFRLYPPAPLLIPRETMKKSTLEGYEIHPGTIIHVNSWAIARDPEIWENSEEFIPERF  240858

240859   LNSDIDFKGQNFELIPFGAGRRGCPGITLGVASMELALSNLLYAFDWELPYGMKKEDIDT  241038

241039   YVKPGTTMHRKNDLCLIPRKYF* 241107

 

$

 

>CYP71AT21 possible ortholog CYP71AT.23

iTAG gene:chr09.2483 100%

PGSC0003DMB000000280.23

246644-248778 (+) strand

95% to CYP71AT21 scaffold01402 tomato

246644   MILLLLFVAFPILLIFLLSGKRNLPPGPIGLPFIGNLHQYDSLTPHLYFLKLSKKYG  246814

246815   KFFSLKLGSSTMVVVSSAKLAKEVLKTQDLVFCSRPSLLGQQKLSYNGHDIAFAPYNDYW  246994

246995   REMRKICVLQLFSLKKVQSFSPIREDEVSRMIKKISQLAASSQITNLSSLMISLTSTIIC  247174

247175   RVAFGVRFDEEAHERKRFDYLLAEAQAMMATFFVSDFFPSLSWIDKLTGQTDRLERNFKN  247354

247355   LNEFYEELIEQHQNPNRPKSMEGDILDLLLQLKKEQSTPIDLTMEDIKGLLM (0) 247510

248170   NVLVAGSDTSAAVVVWAMTALMKNPKVMKKVQEEIRKSIGTKGIVNEDDIQNMSYLKAVI  248349

248350   KETFRLYPPDPLLIPRESMKKSTLEGYEIQQGTIVHINAWAIARDPEIWENPKEFIPERF  248529

248530   LNSDIDFKKEDYQLIPFGAGRRGCPGITLGITAIELALSNLLYAFDWELPYGSKKEDIDT  248709

248710   NVRHGITMHKKNDLCLIPNKYF* 248778

 

$

 

>CYP71AT22 CYP71AT.24

iTAG gene:chr09.2484 100%

PGSC0003DMB000000280.24

251569-256528 (+) strand

82% to scaffold01402 tomato

251569   MILFLLFVAFPILLIFLLSKAKKSSKNNLPPGPIGLPFIGNLHQFDSLAPHIYFWKLS  251742

251743   KKYGKIFSLKFGSTPIIVISSAKLAKKVLKTQDLVFCSRPSHLGQQKLSYNGRDIVFQRY  251922

251923   NDYWREMRKISVLHLFSHKKVKLFSPIREDEVSRMIKKISQQASVSQITNLSNLMISLST  252102

252103   TIICRVAFGIRFDEEAHEKRRFDELLEESATMLTSFYVSDFFPYLGWIDKFTGLTNRLEK  252282

252283   NFKDLDEFYEELVEKHVDPNRPKSMEGDILDLLLQLKRDKLTPIDLTLEDIKAIVM (0) 252450

255917   NVLLAGSDTSAAAVIWTMTALMKNPKAMKKVQEEMRKSFKKKRDILNEDDIQNLPYFKAV  256096

256097   IKESFRLYPSVPLLLPRESMEKSILEGYEIQPGTIINVNAWAIARDPEIWENPEEFIPER  256276

256277   FLNSDIDFKGQDFELIPFGAGRRGCPGIALGVASMELALSNLLYAFDWELPCGMKKEDID  256456

256457   TNVKPGITMHKKNDLCLIPKNYL*  256528

 

$

 

>CYP71AT43 CYP71AT.25

iTAG gene:chr09.2486 100%

PGSC0003DMB000000280.25

263138-264874 (+) strand

82% to CYP71AT23 scaffold01402 tomato

263138   MMFFLFFVAFPIILIFLLLKAKISGKNNLPPGPLGLPFIGNLHQFDSLTPHLYFWKLS  263311

263312   KKYGKIFSLKIGSTPIIVISSTKLAKEVLKTQDLVFCSRASILGQQKLSYNGRDIVFAPY  263491

263492   NDSWREMRKICVLHLFSLKKVQLFSPIREDEVSRLIKKISQQVVTSQITNLSNLMILLSS  263671

263672   KIMFRVAFGIRYDEESHESERFNFLLGESGELLTSFFISDFFPSLSLIDKLFGNISRLEK  263851

263852   NFKGFDEFYEKLIEQHLNPNRPKSMEGNILDILLQLKKEKSTPIDLTMEDIKAIVM (0) 264019

264266   NVLLAGSETSAATVIWTMTALMKNPKAMKKVQEEIRKSIGNKGIVNEDDIQNMSYFKAVI  264445

264446   KETFRLYPSVPTLIPRESMKKSTLEGYEIQPKTIVHVNSWAIARDPEIWENPEEFMSERF  264625

264626   LNSDIDFKGQDFELIPFGARRRGCPGMTLGIASVELALSNLLYSFDWELPYGMKKEDIDT  264805

264806   NVRPGITMHKKNVLCLIPKKYI* 264874

 

$

 

>CYP71AT23 possible ortholog CYP71AT.26

iTAG gene:chr09.2487 100%

PGSC0003DMB000000280.26

265720-267388 (+) strand

89% to CYP71AT23 scaffold01402 tomato, 79% to CYP71AT.27 potato

265720   MMLFLLFVAFPILLIFLLPKAKRIGKNNLPPGPKGLPFIGNFHQFDSLAPHIYFWKLS  265893

265894   KKYGKIFSLKFGSTPIIVISSAKLAKEVLKTQDLAFCSRASHLGQQKLSYNGRDIVFAPY  266073

266074   NDSWREMRKICVLHLFSQKKVQSSSLIREDEVSRMIKKISQHVVTSQITNLSNLMILLSS  266253

266254   SIIFKVAFGIRYDEESHESRRFYFLFEEAATMMTSFFVSDFFPSLNWIDKLTGLTNRLDK  266433

266434   NFKELDEIYEELIKQHLNPNRPKSMEGDILDVLLQLKKEKSTPIDLTLEDIKAIVM (0) 266601

266780   NVLLAGSETSAAAVVWTMTALIKNPKAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVI  266959

266960   KEAFRLYPSSPLLLPRETMKKSTLEGYEIQRGTIVQVNAWAIARDSEIWKNSEEFIPERF  267139

267140   LNSNIDFKGQDFEFIPFGAGRKGCPGMALGVASVELALSNLLYSFDWELPFGMKKEDIDT  267319

267320   DVKPGLTMHKKNDLCLIPKYYM* 267388

 

$

 

>CYP71AT1b CYP71AT.27

iTAG gene:chr09.2542 100%

PGSC0003DMB000000280

707491-709067 (+) strand

95% to CYP71AT.21

Inside a CYP76 gene cluster

88% to scaffold01402 tomato, 79% to CYP71AT2v2 tobacco DQ350350.1

707491   MMLFLLFVALPIILIFLLPKAKKGAKNTQP

707581   PGPVGLPFIGNLHQFDSLTPHIYFWKLSKKYEKIFSLKLGSTPMVVVSSAKLAKEVLKTQ  707760

707761   DLVYCSRPSILGQQKLSYNGRDIAFAPYNDYWREMRKISVLHLFSLKKVQLYKPIREDEV  707940

707941   SRMIKKISQHAASSQITNLSNLMISLISTITCRFAFGVRFDDEAHERKRFDYLLAETQA  708117

708118   MMASFFVSDIFPFLGWIDKLTGLTDRLEKNFKELDEFYEELIEQHQNPNRPKSMEGDIV  708294

708295   DLLLQLKKEKSIPIDLTLEDIKGLLM (0)  708372

708459   NVLVAGLDTSAAGIVWTMTALMKNPKAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVI  708638

708639   KESFRLYPPVPLLVPRESMKKSTIEGYEIQAGTIVHVNSWAIARDPGIWENSEEFIPERF  708818

708819   LNSDIDYKGQNYELIPFGAGRRGCPGITLGVASIELALSNLLYAFDWKLPHGMKKEDIDT  708998

708999   NVRPGITMHKKNDLWLIPKSYF*  709067

 

$

 

>CYP71AT20bP CYP71AT.28P

PGSC0003DMB000000280

711746-712542 (+) strand

83% to scaffold01402, 80% to CYP71AT

in the middle of a CYP76B gene cluster

93% to CYP71AT.22

711662   MMLFLLFVAFPIILIFLLPKAKKSGKNY

711746   VSPGPIGLPFIGNLHQFDSLTPHIYFWKLTKKYGKV & 711853

711855   SLKFGSTPIVVISSAKLAKEVLKTQDLVFCSRPSLLGQQQLSYTGHDIGFAPYNDHWREK & 712034

RKICVLHLFSLKKVQSFSPIREDEVSRMIKKIYEQAINSKITNLSNLMISLTSTIICRIV

FSVRFDEEGHERKRFDCLLAEAQAMSVSFFVYDFFPSLSWIDKLIGLTNRLKKIFQNLDE

FYEELIEQHQNPNRPKSMEGDILDLLLQLKKEQSTSIDLTLDDIKGILM 712542

 

$

 

>CYP71AT25P CYP71AT.29P

PGSC0003DMB000000102

207985-208440 (+) strand

84% to CYP71AT25P tomato, 80% to CYP71AT.24

207985   NMPYLKAVIKETLRLYPPTPLLLPR

208060   KSIEKSTLEGYEIQPGAIIHVNIWAIGRDSKIWENSEEFIPERFLNNNINFKGQDFELI  208236

208237   PFGAGRRGCPGITLGVAIVELALSNLLYAFDWELPC  208344

         GMKKEDIDTNGKPGIVMHKKIDLRLIPANHI* 208440

 

$

 

>CYP71AT16v2 CYP71AT.30P

iTAG gene:chr09.2487 73% not the same sequence

PGSC0003DMB000001387

1406-3186 (+) strand

90% to scaffold01402 tomato, small gap after RFDE

1406   MMFFIFLVAFPIILIFFFTKPK &

       TKISRNTNLPPGPLGLPIIGNLHQYDSVTPHIYFWKLSKKYGKIFSLK  1608

1609   FGSTPVVVISSAKLAKEIMKTQDLAFCSRPSTLCQQKLSYNSHDIVFSPYNDYWREIRKL  1788

1789   CLLHLFSLKKVQSFSPIREDEVSRMIKKISQQVAASQITNLSNIVISLTTTIICRVAFGI  1968

1969   RFDELINESQDILASFFVSD &

2058   FFPSLSWIDKLTGLKNKLEKNFKCLDEFYEELIEQHHNPNRPKSMEGDIIDLLLQL  2225

2226   RKERSTQINLTLDNIKAILM (0)

       NLFLAGTDT  2405

2406   SAITVIWAMTALMKNPKAMKKVQEEVRKSVGGKGIVSEDDTQNMPYLKAVIKETFRLYPP  2585

2586   APILVARETMQNSILEGYNIPPKTTIRVNYWAIARDSEYWENSEEFIPERFLNSNIDFKG  2765

2766   QDFEFIPFGAGRRGCP (1) 2813

       GQALGVATVDLILSNLLYAFDWELPFGMNIEDIDTESLRGITMHKKNDLCLVLKNYM* 3186

$

 

>CYP71AT42v2 CYP71AT.31v1

iTAG gene:chr09.2476 85% not the same sequence

PGSC0003DMB000001387

4539-6425 (-) strand

89% to CYP71AT.14, one aa diff to CYP71AT.15P exon 2

85% to scaffold01402 tomato, exon 2 has 1 aa diff to CYP71AT.15Pv1

6425   MMLFPLFVALLIIIILSFLLPKAKRNG

6344   KNILPPGPLGLPFIGNLHQFDGLTPHLYFWKLSKKYGKIFSLKLGSSTMIVVSSANLAKE  6165

6164   VTHIQDLAFCSRPSILGQQKLSYNGQDIGVSPYNDYWRELRKICVVHLFSLKKVQYYRPI  5985

5984   REDEGARMIKKIFLKAHTSQITNLSNIVISLATTIICRIAFGIRYGEQTREGRKFGELLK  5805

5804   VTEEMLAGFFVSDYFPLLGWIDKLSEKINKLEKNFKDLDEFYEGLIEQHLNPNRPKSMEG  5625

5624   GIIDLLLQLKKEKSTPIDLTLDNIKALIM (0) 5538

5148   NMLVGGTDTSAATVVWAMTALIAKPNAMKKVQAEIRESVGKKFIVNEDDIQDLP  4987

4986   YFKAVIKETFRLYPPGPLLVPRETMQNSILEGYEIQPKTIVHVNFVAIARDPEIWENPEE  4807

4806   FIPERFLNSDIDFKGQNFELIPFGAGRRGCPAMALGVTTVEL &

       VLSNLLYAFDWELPPGMNIEDIDTDVLLGLAVHKKEPLCLVPRNYH* 4539

 

>CYP71AT.31v2

PGSC0003DMB000037378

1-120 (-) strand

1 aa diff to CYP71AT.31

120 QITNLSNIVISLATTIICRIAFGIRYGEETREGRKFGELL  1

 

$

 

>CYP71AT15v2 CYP71AT.32v1

iTAG gene:chr09.2466 82% not the same sequence

PGSC0003DMB000001387

7088-9149 (-) strand

89% to CYP71AT.7, 88% to scaffold01402 tomato

9149   MFFPLFVTLLIIIILSFIFPKAKKNG

9071   KNILPPGPLGLPFIGNLHQFDGLTPHLYFWKLSKKYGNIFSLKLGSTTMIVVSSANLAEE  8892

8891   VTKTQDLAFCSRPSLLGQQKLSYNGQDIAMSPYNDYWKEIRKICVVHLFSLNKVQYFSPI  8712

8711   REDEVSRMIKKISQQASTSQITNLSNIVISLATTIICRIAFGIRYDEETREGRKFGELLK  8532

8531   VTQEMLAGFFVSDYFPLLGWIDKLSGKINKLEKNFKYLDEFYEGLIEQHLNPNRPKSME  8355

8354   GDIIDLLLQLKKEKSTPIDLTLENIKAIIM (0) 8265

7693   NMLVGGTDTSAAAVVWAMTALIAKPNAMKKVQAEIREIVGKKSIVNEEDIQNLPYFKAVI  7514

7513   KETFRLFPPGPLLIARETMQNSILEGYEINQNIIHVNVWAIARDPEIWENPEEFIPERF  7337

7336   LNSDIDFKGQNFELIPFGSGRRGCPAMALGVATVELVLSNLLYAFDWELPCGMKKEDIDT  7157

7156   DVLPGLAMHKKEPLCLVPRN* 7094

 

>CYP71AT.32v2

PGSC0003DMB000033184

3-125 (+) strand

100% to CYP71AT.32

3 VNEEDIQNLPYFKAVIKETFRLFPPGPLLIARETMQNSILE  125

 

$

 

>CYP71AT41v2 CYP71AT.33v1

iTAG gene:chr09.2466 96% not the same sequence, exon 2 has 1 aa diff

PGSC0003DMB000001387

10467-12326 (-) strand

96% to CYP71AT.6, 83% to scaffold01402 tomato, 96% to CYP71AT.6v1

12326   MFFPFFVALVIIIILSFL &

12273   SLKVKKNEKNILPPGPLRLPFIGNLHQFDGLTPHIYFWKLSKKYGKIFLLKLGSTPVIVVSSAKLAK  12073

12072   EVMKTQDLAFCSRPSILGQQKLSYNNQDIATSPYNDHWKELRKICVGHLFSLKKVQSFIP  11893

11892   IREDEVSRMIKEISQQAVTSRITNLSSILISLTTTIICRVAFGIRYDEETHERRNFNELL  11713

11712   KVTEEMLAGFFVSDYFPLLGWIDKLSGKINKLEKNFKDLDEFYEGLIEQHLSTNRPKSME  11533

11532   GDIIDLLLQLKKEKSTPIDLTLDNIKGIIM (0) 11443

NMLVAGTDTSAATIIWAMTALMANPNSMNKVQAEIRESVGEKSIVNEDNVQNLPYFKA

VIKETFRLYPAVPLLVARETMQNSILEGYEIKPKTIVYVNAWAIGRDPEIWKNPEEFIPE

RFLNNDIDFKGQDFELIPFGAGRRGCPGIALGVANVELVLSNLLYAFDWELPRGMKIKDI

DTDVLPGIIPHKKKPLCLVPRNYH* 10467

 

>CYP71AT.33v2

PGSC0003DMB000007282

362-454 (-) strand

100% to CYP71AT.33

454 MEGDIIDLLLQLKKEKSTPIDLTLDNIKGII  362

 

>CYP71AT.33

PGSC0003DMS000004288 scaffold

10826-10581 (-) strand (region in contig)

 

CYP71AT.33

PGSC0003DMO000063194 contig (C-term)

85% to tomato (scaffold07184 60% to CYP71AT7)

2 LEGYEIKPKTIVYVNAWAIGRDPEIWKNPEEFIPERFLNNDIDFKGQDFELIPFGAGRRG

CPGIALGVANVELVLSNLLYAF 247

 

$

 

>CYP71AT24 ortholog CYP71AT.34

iTAG gene:chr01.1103 100%

PGSC0003DMB000000697

118956-120574 (+) strand

93% to scaffold02618 tomato

118956   MLLLFLVAIPFIVIFLVKLGYTHNHPPSPPGLPLLG

119064   NLYQLNQESPHIYLWKLSKKYGPLMFMKLGFSQLVVISSARIAKEVLKTHDFAFSSRPSY  119243

119244   LGQRKLSYNGLDVAFSPYNNYWREMKKICTLHLFSPKKVQSFRPIREDEVSRMINRVTEL  119423

119424   ASSSKLVNLSEIMSSLSSNISCIVGFGKRYDEKGYESKRFSKLLCEAQAMIGGSFLSDH  119600

119601   FPIFGHWIDCIVTRKATRLEKIYNELDLFYQELIDEHLSSTRPKSMDGDIVDMLIVLK  119774

119775   DQNLSSSSLNLTWDHIKAVLM (0) 119837

119945   DIFIAGTDTNAAALVWAMTALMKEGGSAMRKLQEGIRELVGKKGRVDEDDIQNLPYLRAV  120124

120125   IKETLRLYPPTPLIPRETIEKCSIDGYEIKQNTPISINAWAIGRDPECWENPDEFIPER  120301

120302   FCNVNNKDIIDYKSGEFEMIPFGGGRRGCPGISLGVATVELALANLLYAFDWELSYGMVK  120481

120482   EDIDIDTLPGMTMHKKNPLCLVAKAYYNNS*  120574

 

$

 

>CYP71AT49P CYP71AT.35P

iTAG gene:chr09.2482 80% not the same sequence

PGSC0003DMB000000019

3137926-3139786 (+) strand

82% to CYP71AT.22, 81% to CYP71AT20P tomato

3137926   MILFLLFVALPLFFIFLLS

3137983   KAKRSGKTNLPQGPIGLPFIGNLHQFDS*TPHIYFWELSKKYGKIFSLKFDSTPIIVI  3138156

3138157   SSAKFAKEVLKTQDLVFCSRPSLLGQQKLSYNGHDIGFAPYNHHWRERRKICVLHLFSLK  3138336

3138337   KVQSFSPICEDEVS*MIKKIDEQAANTQITNLTNLMISLTSTIICRVAFGVRFDEEGHER  3138516

3138517   KRFDYLLPEVQAMSVSFFVSNFFPSLYWIDKFTGLTGKLEKIFHDLDDFYKELIEQHKKP  3138696

3138697   HRPKSMEGDIIDLLLQLKKEQSTPIDLTLDDIKGILM (0) 3138807

          NVFAVGSDTSAATIE*SK

3139256   IMKKFQEEIRKAIGTKGIVNENDIQNMSYFKAVIK*TFRLYPPAPFLIPRETMKKSTLDR  3139435

3139436   YEIQPGTIIHVNTWAIARDLEIWENPEEFIPERFLDSDINFKGQHFELIPFGAGRRGCPG  3139615

3139616   ITLGVASMELALSNLLYAFDWELPYGIKKEDIDTYVKPGTTMHRKNDLCLIAKKYF*  3139786

 

$

 

>CYP71AT49P-de1b CYP71AT.36P

PGSC0003DMB000000019

3142028-3142321 (+) strand

83% to CYP71AT.24, 81% to scaffold01402 tomato

3142028   MILFLLFVAFPILLIFLLH

3142085   KHKKSGKTNLPQGPIGLPFIGNLHQFDSLTPHIYFLKLFKKYGKIF*LKLGSTPIVVV  3142258

3142259   SSVKLAKQMLKTRDLVFCSRP  3142321

 

$

 

>CYP71AT50P CYP71AT.37P

PGSC0003DMB000000019

3187266-3187814 (+) strand

87% to CYP71AT.24, 83% to scaffold01402 tomato

3187266   GRDIVFQRYNNYWRQMRKISVLHPFSHKKVKLFSPIHEDEV*RMIKKISQQASASQITNL*N  3187451

3187452   LMISLSTTIICRVAFGIRFDEEAHEKRKFDELLEESATMLTSFYDSFLYLDWIDKFIG  3187625

3187626   LTNRLVKNFKKYDEFYEELIEKH  3187694

          LDPNSPKSIEGDILDLLLQLKKDKLTPIDLTFEDIKATVM (0) 3187814

$

 

>CYP71AT27a CYP71AT.38

iTAg gene:chr11.617 99% missing C-term

PGSC0003DMB000000549

180376-181955 (+) strand

Ends in a seq gap

92% to CYP71AT27 tomato

180376   MIFFLLFVVIPICLIFLLL

180433   KAKRSGKNKLPPGPIGLPFIGNLHQFDSLAPHIYFWKLSKKYGKIFSFKLSSHVSIIV  180606

180607   VSSAKLAKEVLKTQDLVFCSRPSLVGQQKLSYNGHDIGFAPYNDYWREMRKICVLHLFSL  180786

180787   KKVQLFSPIREDEISRMINKIYQQVDNSQVTNLSNLMISLNSTIICRVGFGVRFDEEAHE  180966

180967   RKRFNYILAEAQAMLASFFVSDFFPSLSWIDKLTGLTDRLEKNFKDLDEFYEELIEQHHN  181146

181147   PNRPNSMEGDIIDLLLQLKKEQLTPIDLSLEDIKGILM (0)  181260

         NVLIAGSDTSAAVVVWAMTILI

181572   KNPKTMKKVQEEIRNLIGNKGIVNEDDIQNMSYLKAVIKETLRLFPPAPLLIPRESMKIS  181751

181752   TLEGYEFQPRTIVYVNAWAIARDPEIWENPEEFMPERFLNSDIDFKGQDYELIPFGAGRR  181931

181932   GCPGLALG  181955

 

$

 

>CYP71AT27b CYP71AT.39

iTAg gene:chr11.617 91% not the same sequence

PGSC0003DMB000000549

183505-185553 (+) strand, one frameshift

88% to CYP71AT27 tomato

183505   MMFFLLFVVIPICLVFLLP

183562   KVKRGRKNKLPPGPIGLPFIGNLHQFDSLTPHIYFWKLSKMYGKILSLKLASVQIVVV  183735

183736   SSAKLAKAVLKTQDLVFCSRPSLVGQQKLSYNGHDIGFAPYNDYWREMRKICVLHLFSLK  183915

183916   KVQLFGPIRKDEVSRMIKKVYQLAVNSQVTNLSNLMISLNSTIICRVAFGVRFDEEAHER  184095

184096   KRFDHIMVEAEAMLASFFVSDFFPSLSWIDKLTGLTDRLEKNFKDLDDFYEELIEQHHNP  184275

184276   NRPNSMEGDIIDLLLQLKKEKLTPIDLSLEDIKGILM (0) 184386

         NVLVAGSDTSASVIIWAMTILIKNPKAMKKVQEEIRNLMGNKNIVK &

185080   NEDDIQNMPYFKAVIKETLRLFPPAPLLIPRASIKISTLEGYEFQPRTIVYVNAWAIARD  185259

185260   PEIWENPEEFMPERFLNSDIDFKGQDYEFIPFGAGRRGCPAMALGVASVELALSNLLYAF  185439

185440   DWELPYGLKKEDIDINGRPGITMNKKNDLCLIPKKYF*  185553

 

$

 

>CYP71AT27b-de2b CYP71AT.40P

iTAg gene:chr11.617 85% not the same sequence

PGSC0003DMB000000549

186366-186758 (+) strand

94% to CYP71AT27 tomato, 93% to CYP71AT.3

186366   NVLLAGSDTSASVIIWAMTILI

186432   KNPKAVKRVQEEIRNLIGNKGIVNEDDIQNMPYFKAVIKETLRLFPPAPLLIPRESMKIS  186611

186612   TLEGYEFQPRTIVYVNTWAIARDPEIWENPEEFMPERFLNSDIDFKGQD  186758

 

$

 

>CYP71AT27b-de2c CYP71AT.41P

PGSC0003DMB000000549

187390-187999 (+) atrand

89% to CYP71AT27 tomato, 95% to CYP71AT.39

187390   NVLVAGSDTSASVILWAMI

187448   LCVKNPKDMKKVQEEIRNLMGNKNIVNEDDIQNMPNFKAVIKETLRLFPPAPLLIPRASIKIS  187636

187637   TLEGYEFQPRTIVYVNAWAIARDPEIWENPEEFMPERFLNSDIDFKGQDYEFIPFGAGRR  187816

187817   RCPAMALGVASVELALSNLLYAFDWELPYGLKKEDIDINGRPGITMNKKNDLCLIPKKYF*  187999

 

$

 

>CYP71AT46 CYP71AT.42

iTAG gene:chr11.617 85% not the same sequence

100% to chr11.955 exon 1 also 100% to chr06.2104 duplicate in assembly

100% to chr11.954 exon 2 also 100% to chr06.2103 duplicate in assembly

PGSC0003DMB000000133

483250-485756 (-) strand

87% to CYP71AT27 tomato, missing beginning of exon 2

485756   MIFFLLFVAIPICLIFLLP

485699   KAKRGGKNKVPPGPLGLPFIGNLHQFDCLAPHIYFWKLSKKYGKVFSLKLASVPIVVV  485526

485525   SSAKLAKEVLKTQDLVFCSKPSLVGQQKLSYNGHDIVFAPYNDYWREMRKICVLHLFSLK  485346

485345   KVHLFGPIRKDEVSRMIKKIYQQAANSQVTNLSNLLISLNSTIICRVAFGVRFDEEAYER  485166

485165   KRFNHIVDEGEAMLASFFVYDFFSSLNWIDKLTGQTDRLEKSFKDLDEFYEELIEQHHN  484989

484988   PNRPKSMEGDIIDLLLQLKKEQLTPIDLSLEDIKGIIMVIF (0) 484866

483792   KNPKDMKKVQEEIRNLMGNKNIVNEDDIQNIPYFKALIKETLRLFPPVPLLIPRESMKIS  483613

483612   TLEGYELQPRTIVYVNAWAIARDPEIWENQEEFMPERFLNSDIDFKGQDYEFIPFEASRR  483433

483432   GCPAMALGVASVELALSNLLYAFDWELPYGLKKEDIDINDRPGITVNKKNDLCLIPKKYF*  483250

 

$

 

>CYP71AT45P CYP71AT.43Pv1

PGSC0003DMB000000133

490000-490461 (-) strand

81% to scaffold07184 tomato

490461   NVLFAGSDTSASVIIWAMAILI

490395   KNPKAMKKVQEEIRYLIGNKGIVKEDDIQNISYLKAVIKETLRLFPPAPLLIPRESMKIS  490216

490215   TLEGYEFQQRTLVYVNA*AIGRGPEIWENLEEFMPERFLNNDIDCKEQYYELIPFGVRKR  490036

490035   GCPGLALGVASV  490000

 

>CYP71AT.43Pv2

PGSC0003DMB000000138

97242-97355 (-) strand

100% to CYP71AT.43P

97355   NVLFAGSDTSASVIIWAMAILIKNPKAMKKVQEEIRST  97242

 

$

 

>CYP71AT44P CYP71AT.44P

PGSC0003DMB000000133

494240-494674 (-) strand

91% to scaffold07184 tomato

494674   VIKETLRLFPLTPFLIPRESMKISTLEGYKFQPRTIVYVNAWAIGRDPEIWENPEEFMSE  494495

494494   RFLNNDIDFKGQDHELIPFGAGKRGCPGLALGVASVQLALSNLLYAFDWELPYGLKKEDI  494315

494314   DINGRPRITVNKKNDLCLIPKKYF*  494240

 

$

 

>CYP71AT51P CYP71AT.45P

iTAG gene:chr09.2466 81% not the same sequence

PGSC0003DMB000000263

262050-264252 (+) strand

86% to CYP71AT.14, 82% to CYP71AT15  tomato

262050   MMLFPLFVALLIIIILSFLLP

262113   KAKRNGKNILPPGPLGLPFIGNLHQFDSLTPHIYLWKLSKKYGKIFSLKHGFTTMIVF  262286

262287   SSANLAKEVTQIQDLTFCNRPSILGQQKLSYNGQDIAMSPYNDYWRELRKICVVHLFSLK  262466

262467   KMQYFSPIHKDEVSRMIKKISQQATTSQITDLSSIVISLTTTIICRIAFGVRYDEETHER  262646

262647   RKLDELLKVTEEMLACFFVSDYFPLFGWMDKLSGKINRLEKI & 262772

         NFKDLDEFYEELIEQHLNPNRPKSMEGDIIDVLLQLKKEKST &

         SIDLTIDNIKAIIM (0)

         NMLVGGVNTSAATIIWAMTALIAK

263716   PNAMKKVQAEIREFVGKKSIVNEEDIQNLPYFKLVIKETFRLYPTTTLLLPRETMQNSIL  263895

263896   EGYEIKPKTIIYVNVWAIARDPEIWENPEEFIPERFLNSDIDFKGQNFELLPFGAGRRGC  264075

264076   PAIALGVATVELVLSNLLYAFDWELPRGMNKEDIDTDVLPGLTMHKKKPLCLVSRNYH*  264252

 

$

 

>CYP71AT47 CYP71AT.46

iTAG gene:chr01.1631 100% missing the N-term 22 aa

PGSC0003DMB000000035

1413647-1416002 (-) strand

83% to CYP71AT31 potato, 76% to CYP71AT17 tomato

1416002   MMFFLFSVSLSIILIFLLHKAKMSRTTF

1415918   LPPGPVGLPFIGNLHQYDSLNPHIYFRKLSKKYGKIFSLKIGSATMVVISSAKLAKEV  1415745

1415744   TQIQDLTFCSRPSFLGQQKISYNGHDIAFAPYNDYWREMRKLCVVHLLSLKKVQSFRSIR  1415565

1415564   EDEVLRMIKKISQQITASQIINLSNILITLTRTITCRIAFGIRYDEEAHEKRKFDELLTM  1415385

1415384   TQDMMTHFFFSDYFPLFGWLDKLFGNIQKLEKNFKDLDEFFEELINQHLNPNRPKSMEG  1415208

1415207   DILDLLLQLRKEQSTSTGLTLDNIKAIFM (0) 1415121

          DILTGGSDTIAVTVIWSMTALM

1414783   KNSKVMKKVQEEIRQSIGNKGVVNEDDIQNMPYFKAMIKETFRLYPPGPLLGPRKSMKKS  1414604

1414603   NLEGYEIQSGTIIHVNSWAIARDPEIWKNSEEFIPERFLNSDIDFKGQNFELIPFGAGRRGCP (1)  1414415

1413826   GISLGVTTVNLILSNLLYAFDWELPYGMMKEEIDTDGLPGLIMN  1413695

1413694   KKTALCLVPKNYLYT*  1413647

 

$

 

>CYP71AT48 CYP71AT.47

iTAG gene:chr02.31 95% missing N-term and region around frameshift

PGSC0003DMB000000183

1230704-1232570 (+) strand

78% to CYP71AT13 tomato, 86% to CYP71AT41Pv2 potato

1230704   MFFPFVIIIILSFLLPKEKSI

1230767   LPPDPLRLPFIGYLHQFDSLTPHIYFWKLSKKYGKVL & 1230877

1230879   LKLGSTPIIVVSSTKLAKKVMKTYDLAFCGRPSILGKQKLSYNNQDIATSPYNDHWKELR  1231058

1231059   KICVSHLFSLKKVQSFIPIREDEVSRMIKEISQQAVTFRITNLSSIMISLTTTIICRVAF  1231238

1231239   GIRYDEETREMRNFNELLKVTQEMLTAFFVSDYFPLLGWIDKLFGKTSRLEKNFKDLDEF  1231418

1231419   YEGLIEKHLNPNRPKSMEEDIIDLLLQLKKEKSTPIDLTLDNIKVIIM 0) 1231562

          NMLVAGTDTTASTIIWAMTALIA

1231991   NPNAMKKVQAEIRESVGKNSIVNEDNVQKLQYFKAVIKETFRLYTPAPLLLPRE & 1232152

1232151   RQSSILEGYEIKPKTTVYVNAWAIGRDPEIWKNSKEFIPERFLNNDNIDFKGQDFELIPF  1232330

1232331   GAGRRGCLAIALGVANVELVLSNLLYTFDWELPRGMKREDIDTDSLPGITPHMKKHLCLV  1232510

1232511   PRNYHYSQEIKQDQPNSSI* 1232570

 

$

 

>CYP71AT52P CYP71AT.48P

PGSC0003DMB000027366

2-136 (+) strand

93% to CYP71AT.32

2 AAAVVWAMTALISKPNAMKKVQAEIREMVGKKSVVNEEDIQNLPY  136

 

$

 

>CYP71AT53P CYP71AT.49P

PGSC0003DMB000000102

203935-204339 (+) strand

74% to CYP71AT.21

203935   NPDRPKSMEGDILDLLLQLKKEKSTPIDLYFGGYKST

         NVLVAGSDTNASTIVWEMIALMKNPKAMKKVQSEIRTLV  204294

204295   GKKGFVNEDNIQNMP  204339

 

$

 

>CYP71AT28P CYP71AT.50P

PGSC0003DMB000000280

119178-122677 (+) strand

53% to CYP71AT.35P

119178   KIWSFHSFSLKKVRLFSPICKNEGSMMIKKMVQQATT*QFTIL  119050

122778   ANH*TNLTNIVISLTSIIIRRVNFDISYDKDAHE  122677

 

$

 

>CYP71AT29P CYP71AT.51P

PGSC0003DMB000000280

122781-122849 (-) strand

60% to CYP71AT.24

122849   FSSIRENESSIMIKKITQQKAIT  122781

 

$

 

>CYP71AT35P CYP71AT.52P

PGSC0003DMB000000280

156851-157000 (-) strand

55% to CYP71AT.12P

157000   GIALGVATVLELMLLYAFDWKLTFVIKITDILLGIITHKKNAFLFIFPRY  156851

 

$

 

>CYP71AT40P CYP71AT.53P

PGSC0003DMB000000280

197880-197942 (-) strand

80% to CYP71AT.29P

197942   TFGVAMVDLTLSNLLYAFDWE  197880

 

$

 

>CYP71AT54P CYP71AT.54P

PGSC0003DMB000000133

487331-487472 (-) strand

91% to CYP71AT.44P

487472   SMELALSNLLYAFDWEL  487422

487423   YGLKKEDIDINGRPRITVNKKNDLCLIPKQY  487331

 

$

 

>CYP71AT55P CYP71AT.55P

PGSC0003DMB000000019

3188171-3188356 (+) strand

66% to CYP71AT.26

3188171 NVLLAESYTSAAALLWTVTAFMKNPKAMKTVQEEIRKSVKKGGILNEYEIQNLPYFYSSISD  3188356

 

$

 

>CYP71AU32 ortholog CYP71AU.1 syntenic

iTAG gene:chr11.1917 96% missing a small region around stop codon

PGSC0003DMB000000055

1164880-1166388 (-) strand no introns, one stop codon

94% to CYP71AU2 tomato, 93% to scaffold02749

1166388   MISSFAVFSFLFLFSCGLLSFFRLSSKKCKKNLPPSPPKLPFIGNFHQLGLQPHRSLQKL  1166209

1166208   TNEFGPMMMLQFGSVPVLIASSAESASQIMKIQDLGFANN*PKSIIPSKLFFGPKDVAFT  1166029

1166028   PYGEYWRNARSVCMLQLLNNKRVQSFSKIREEETSLLLRKINHSIDNSQVVDLTELFVTM  1165849

1165848   TNDVLCRVALGRKYCDGEEGKKFKSLVIELVELLGVINIGDYMPWLAWVNRFNGFNAKVD  1165669

1165668   KVAEEFSAFLEGVIEEHKEKIKIDEKLEEGSADFVDILLQVQKENKSGFKVEMDSIKA  1165495

1165494   IIMDMFAAGTDTTSTLLEWTMNELIRNPNTLRKLRDEVRQVTQGKSDVTEEDLENMPYLI  1165315

1165314   AVMKESLRLHSPVPLLPREAIKDTKVLGYDVAAGTQVFVCPWAISRDPTIWENPEEFQP  1165138

1165137   ERFLDSCVDYKGLNFELIPFGAGRRGCPGITFAKVVNELALARMLFHFEFSLPNGAKAED  1164958

1164957   LDVDEALGITVRRKFPLLVVATPRI*  1164880

 

$

 

>CYP71AU2 ortholog CYP71AU.2 syntenic

iTAG gene:chr11.1918 100%

PGSC0003DMB000000055

1173288-1174787 (+) strand

96% to CYP71AU2 tomato

1173288   MISLFAVFPFLIFLAFILLSFFQLSSKKSKKNLPPSPPKLPFIGNFHQLGQQPHRSLQKL  1173467

1173468   TNEYGPMMMLQFGSVPVLIVSSAEAASQIMKTQDLGFANKPKSIIPSKLFFGPKDVAFT  1173644

1173645   PYGDYWRNARSVCMLQLLNNKRVQSFSKIREEETSLLLRKINHSIDNSQVVDLTDLFVSM  1173824

1173825   TNDVLCRVALGRKYCDGEEGRKFKSLLLEFVELLGVFNIGDYMPWLAWVNRFNGLNAKVD  1174004

1174005   KVAEEFSAFLEGVIEEHKEKIKIDDKEDGSADFVDILLQVQKENKSGFKVEMDSIKAII  1174181

1174182   MDMFSAGTDTTSTLLEWTMNELIRNPNTLRKLRDEVRQVTQGKSDVTEDDLEHMPYLIAV  1174361

1174362   MKESLRLHSPVPLLPREAIKDTKVLGYDVAAGTQVFVCPWAISRDPTIWENPEEFQPERF  1174541

1174542   LDSSVDYKGLHFELIPFGAGRRGCPGITFAKVVNELALARMLFHFEFSLPNGAKAEDLDV  1174721

1174722   DEALGITVRRKFPLLVVATPRI  1174787

 

$

 

>CYP71AU33 ortholog CYP71AU.3

iTAG gene:chr03.1814 100%

PGSC0003DMB000000127

30376-33342 (+) strand

94% to scaffold03823 tomato, 67% to CYP71AU4 Vitis

30376   MFTSLQWLENCTYLSYVLALSLLISFVVMSLLMTKSKTKKNLPPSPPKLPL

30529   IGHMHKLGVYPHHSLHKLAQQYGPLMFLKLGSVNTLVVSSAEAASEIMKTHDLVFCDRPK  30708

30709   SNVNKKLLYDFKDVSVAPYGEYWRQMRSICVLQLLSTKRVQGFRVVREEETALLVKKIKE  30888

30889   RSPEAVDLSELFMTLTNDIVSRAAFGRKYSGGESGEKFRKLMKEFVGILGGFDFGTFLPS  31068

31069   LAWIDRVSGLEAKVDRVAKEMDEFLEGVVEEHLDSHKRVKELLGDKVENENREDFVDVLL  31248

31249   GIYKQNMVDGFSIDRDGIKALIV (0) 31317

32728   DIFAGGTDTTYTVLEWAMTELLRHPGAMNKLQNEAREITKAKNETLSEDDLDKMHYLKAV  32907

32908   IKETLRLHPPIPLLVPRQARQDVKVMGYDVAAGTMVITNGWAIGRDPEIWDDAEEFKPER  33087

33088   FLNSSIDFKGHDFGLIPFGAGRRGCPGISFAMATNELVLANVVREFDWKLPNGAKGDDLD  33267

33268   MTECTGLTIHRKVPLFAVATSNTA*  33342

 

$

 

>CYP71AX14P CYP71AX.1P not in tomato

PGSC0003DMB000000055

1176048-1176401 (+) strand

80% to scaffold03823 tomato, 86% to CYP71AX.7

1176048   QFLRHPRAMETLLNEVRGLAQGKTEITEDDLGNMHYLKSVIKETLRLHPPGPLLVPREST  1176227

1176228   EDIKLLGYQIPAKTQVIINAWAIGRDPLSWENPEDYRPERFLNSNIDFKGLNFELMSY  1176401

 

$

 

>CYP71AX15 CYP71AX.2 not in tomato

iTAG gene:chr11.1920 92% missing regions around frameshifts and C-term

PGSC0003DMB000000055

1185397-1187051 (+) strand

74% to CYP71AX4P tomato, 92% to CYP71AX.7

1185397   MDLTWYSLLIPL

1185433   FFFLHKCLFSTSNKLSPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPLML  1185588

1185589   LHFGSKPVLVASSVEAARDIMKTHDLVCSSRPKSSMADRLFYGSKDVGFSPYGEYWRQI  1185765

1185766   KSIVMFHLLSNKRVRSYRDIREEETSNMIEKIRQERNSNSSNSVIDLRDHFCFMTDNIIS  1185945

1185946   RVALGRIYNKRESGIDAKAILAEFVQLLGTFNVGDFIPWLEWVNKX & 1186080

1186086   GLDTKVEKVAKKLDTFLESVIEEHIIRNNKEEYSTGEAKDFVDVLLEIQ NGKET 1186232

          XXXXXXXXXXXXXX

1186435   DIFAAGTDTTYTTLEWIMAELLRHPRAMETLQKEVRVLAQGKAEITEDDLGNMHYLKAVI  1186614

1186615   KETLRLHPPAPLLIPRESTEDIKLLGYQIPAKAQVIINAWTVGRDPLSWENPEDYRPERF  1186794

1186795   LNSDIDFEGLNFELIPFGAGRRGCPGTAFAVVINVLALARLSTSSIFH & 1186938

          LPEGLKPEDLDMTENNGITIQRKSPLLAVATPCSTYY*  1187051

 

>CYP71AX.2v2

PGSC0003DMB000021267

3-143 (+) strand

2 aa diffs to CYP71AX.2

3   SLHKLSKKYGPLMLLHFGSKPVIVASSVEAARDIMKTHALVCSSRPK  143

 

>CYP71AX.2v3

PGSC0003DMB000015150

33-191 (+) strand

100% to CYP71AX.2

33   DIFAAGTDTTYTTLEWIMAELLRHPRAMETLQKEVRVLAQGKAEITEDDLGNM  191

 

>CYP71AX.2v4

PGSC0003DMB000028544

3-128 (+) strand

100% to CYP71AX.2

3   DDLGNMHYLKAVIKETLRLHPPAPLLIPRESTEDIKLLGYQI  128

 

$

 

>CYP71AX16 CYP71AX.3v1 not in tomato

iTAG gene:chr11.1921 100%

PGSC0003DMB000000055

1189489-1191111 (+) strand

87% to scaffold03823 tomato, 91% to CYP71AX.16

1189489   MDLTWYYLLIPL

1189525   FFFLHKCFFSTSNKLSPPSPTKLPIIGNLHQLGSLPYRSLHKLSKKYGPLML  1189680

1189681   LHFGSKPMLIASSVNAARDIMKTHDLVWSNRPKSSMADGLFYGSKDVAFSPYGEYWRQV  1189857

1189858   RSVTVLHLLSNKRVQSYRHVREEEISNMIDKIRQECDSVIDLRDVLSCMTNNIISRVT  1190031

1190032   IGRTYNEGESGIAVKALLEELLVLVGTFNIGDYIPWIKWINKINGLDSRVKKVAKDLDAF  1190211

1190212   LESVIEERVIRNKKAEYSGGEAKDFVDVLLETQNGKETGFPLQRDSLKAILL (0)  1190367

          DAFVAGTDSTYTVLEWTMTELLRH  1190571

1190572   PRVLEKLEDQVRELGQGKTEITEDDLGNMHYLKAVIKESLRLHAPVPLLAARESMEEVKL  1190751

1190752   LDYDIPVRTQAIINVWAIGRDPLLWENPEEFRPERFLNSDIDVKGLNFELIPFGAGRRGC  1190931

1190932   PGIPFAIMVNELALANLMYRFNFALPEGIKGEDLEMTECNGLAVRRKLPLFVVATPLSS*  1191111

 

>CYP71AX.3v2

PGSC0003DMB000022359

3-146 (-) strand

100% to CYP71AX.3 and CYP71AX.16

146   NFELIPFGAGRRGCPGIPFAIMVNELALANLMYRFNFALPEGIKGEDL  3

 

$

 

>CYP71AX17P CYP71AX.4P not in tomato

iTAG gene:chr11.1927 82% not the same sequence

PGSC0003DMB000000055

1192458-1199365 (+) strand

77% to scaffold02749

1192458   LSKKYGPVMLLHFGSKPVIVASSVEAARDIMKTHDLVCSSRPKSSMADRLFYGSKDVGF  1192634

1192635   SPYGEYWRQIKSIVVLHLLSNKRVRSYRDIREEETSNMIEKIRQECNSNSSNSVIDLRDH  1192814

1192815   FCFMTGNIISRVALGRIYNKRESGIDAKNILAEFLHLLGTFNVGDYIPWLEWVNKIFGLD  1192994

1192995   TKVEKVAKKLDTFLETVIEEHIISNKKREYRVGETKDFVDVLLEIQNGKETDFLLQRDSLKAIIL (0) 1193189

1198541   TTYTTLEWIMTELLRHPRAMEKLQNEVRGLAQGKAEVTEDDLRNMQYLKAVIKETFKLHP  1198720

1198721   PDPLLVPRETTEDIKLLGYHIPAKTQVIINAWAVGRDPLSWDDPEEYRTERFLNS () 1198885

1199132   SNIDFKGLNFELIPFGAGRMGCPGTAFAFVIIELALARIVHKFNFALPQDWDMTE  1199296

1199297   RSGVIVRRKSPLLVVATPYSSS*  1199365

 

$

 

>CYP71AX18P CYP71AX.5Pv1 not in tomato

chr11.1926 88% missing region around frameshift,last 2 aa dont match

PGSC0003DMB000000055

1209978-1211539 (+) strand

77% to scaffold02749

1209978   MDLPWYSLLVPLFFFLFFLNQCFFTTSSN

1210065   QKKLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPVMLLHFGSKPVLVASSVEAARDI  1210244

1210245   MKTHDLVCSSRPKSSLADRLFYGSRDVGFSPYGEYWRQIKSIVVLHLLSNKRVRSYRDI  1210421

1210422   RIEETSNMIEKIRQECNSNSSNSVIDLRDHVCFMTGNIISRVALGRIYNERESGIEAKAI  1210601

1210602   LAEFVQLLGTFNVGNFIPWLEWVNKSL & 1210682

1210682   GLDTKVEKVAKKLDTFLESVIEEHIIRNNKEEYSTGEAKDFVDVLLEIQ  1210828

1211138   LVPRESIEDIKLLGYQIPAKAQVIINAWTVGRDPLSWENPEDYRPERFLNSDIDFEGLNF  1211317

1211318   ELIPFGAGRRGCPGTTFAVVINELALARLMHKFNFSLPEGLKPEDLDMTEDNGITIHRKS  1211497

1211498   PLLAVTTPCSSYY*  1211539

 

>CYP71AX.5Pv2

PGSC0003DMB000012798

79-213 (-) strand

100% to CYP71AX.5P

213   LALARLMHKFNFSLPEGLKPEDLDMTEDNGITIHRKSPLLAVTTP  79

 

$

 

>CYP71AX19P CYP71AX.6Pv1 not in tomato

PGSC0003DMB000000055

1211833-1212234 (+) strand

79% to scaffold02749, 95% to CYP71AX.8

1211833   LVPRESIEDIKLLGYQIPAKTGVIINAWSIGRVPLSWENPEEYRPERFLNSNIDVKGLNF  1212012

1212013   ELIPFGAGRRGCPGTGFAIVVIELALARIVHKFNLALPEVLKPEDLDMTEGSGIIIRRIS  1212192

1212193   PMLAVATPCCSYY*  1212234

 

>CYP71AX.6Pv2

PGSC0003DMB000000116

811549-811743 (-) strand

100% to CYP71AX.6P

811743   RRGCPGTGFAIVVIELALARIVHKFNLALPEVLKPEDLDMTEGSGIIIRRISPMLAVATPCCSYY  811549

 

$

 

>CYP71AX20 CYP71AX.7 not in tomato

iTAG gene:chr11.1927 100%

PGSC0003DMB000000055

1225420-1227092 (+) strand

80% to scaffold02749

1225420   MDLTWYSLLIPL

1225456   FFFLHKCFFSTSNKLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPVML  1225608

1225609   LHFGSKPVLVASSVEAARDIMKTHDLVCSSRPKSSMADRLFYGSKDVGFSPYGEYWRQI  1225785

1225786   KSIAMLHLLSNKRVRSYRDIREEETSNMIEKITQECVSSNSVIDLRDHVCFMTGNIISRV  1225965

1225966   ALGRIYNERESGIDAKAILAEFVQLLGTFNVGDFIPWLEWVNKITGLDTKVEKVAQKLNT  1226145

1226146   FLESVIEEHIIRNNKEEYSTGEAKDFVDVLLEIQNGKETGFPLQRDSLKAILL (0) 1226304

1226475   DIFAAGTDTTYTTLEWIMAELLRHPRAMETLQKEVRVLAQGKAEITEDDLGNMHYLKAVI  1226654

1226655   KETLRLHPPAPLLIPRESTEDIKLLGYQIPAKTQVIINAWTVGRDPLSWENPEDYRPERF  1226834

1226835   LNSDIDFEGLNFELIPFGAGRRGCPGTAFAVVINELALARLMHKFNFSLPEGLKPEDLDM  1227014

1227015   TEDNGITIHRKSPLLAVTTPCSSYY*  1227092

 

$

>CYP71AX2 ortholog CYP71AX.8 syntenic

iTAG gene:chr11.1927 81% not the same sequence

PGSC0003DMB000000055

1234535-1236253 (+) strand, one stop codon

83% to CYP71AX2P over 147 aa

1234535   MDLPWYSLVIPLFFFIHQCFFTTSSNQKKLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKK  1234714

1234715   YGPLMLLHLGSKPVLVASSVEAAREIMKTHDLVCSSRPKSSLADRLFYGSRDVGFSPYG  1234891

1234892   EYWRQIKSIVVLHLLSNRRVQSYRDIRQEETSNMIDKIRQECGSSSSMIDLRDHFCFLTC  1235071

1235072   NIISRVALGRKYDEGESGMNAKVTLDELAELFGTFNIGDYIPRLEWVNKLTGLDTKVEKV  1235251

1235252   AKSLDTFLECVIEEHIIKNNKGEYSTGEAKDFVDVLLEVQNGKETGFPLQRDSLKAIIL (0) 1235428

1235636   DIFSGGTDTTYTALEWVMTELLRYP*VMEKLQNEVRGLAQGKAEVTEDDLGNMQYLKAVI  1235815

1235816   KESLRLHPPIPLLVPRESIEDIKLLGYQIPAKTGVIINAWSIGRDPLSWENPEEYRPERF  1235995

1235996   LNSNIDVKGLNFELIPFGAGRRGCPGTGFAIVVIELALARIVHKFNLALPEGLKPEDLVM  1236175

1236176   TEGSGITIRRISPMLAVATTCSSYY*  1236253

 

$

 

>CYP71AX3 possible ortholog CYP71AX.9

iTAG gene:chr03.2134 99%

PGSC0003DMB000000055

1244819-1246544 (+) strand

92% to CYP71AX3 scaffold02749, 84% to CYP71AX4P

1244819   MDLIWYALLIPL

1244855   FFFLHKCFFSTSNKLPPSPTKLPIIGNLHQLGSLPHRSLHQLSKKYGPVML  1245007

1245008   LHFGSKPVIVASSVDAARNIMKTHDLVWSNRPKSSIADRLFYGSKDVAFSPYGEYWRQI  1245184

1245185   KSVTVLHLLSNKRVQSYRDIREEETSNMIVKIRQECESNSSSSVIDLRDCLSSLTNNIVS  1245364

1245365   RVALGRKYNEEGQGGMNAKVTLHEFGELLGTFSIGDYIPWLEWISKINGLANKVEKVAKE  1245544

1245545   LDTFLESVIEEHVSRKNKGEDSTGEAKDFVDVLLEIQNGKETGFLLQRDSLKAIIL (0) 1245712

1245942   DNFAAGVDTTYTALEWIMTELLRHPRVMKKLEDEVRELGQGKTEITEDDLRNMHYLKAVI  1246121

1246122   KETLRLHPPIPLLIPRESTEDIELLGYHIPAKTQVIINAWAIGRDPLSWDDPEEYRPERF  1246301

1246302   LNSNIDVKGLNFELIPFGAGRRGCPGTGFAIVVIELALARLVHKFNFSLPEELDM  1246466

1246467   TEASGVAVRRKSPLLALATPYSTYY*  1246544

 

$

 

>CYP71AX4 CYP71AX.10

iTAG gene:chr11.1930 100%

PGSC0003DMB000000055

1254379-1256026 (+) strand

88% to CYP71AX4P scaffold02749, 86% to CYP71AX3

1254379   MEFPWYSIVVPLCVFIFFLPNCLFTTSNNNKKLPPSPTKLPIIGNLHQLGSLPHRSLHQL  1254558

1254559   SKKYGPVMLLHFGSKPVIVASSVDAARNIMKTHDLVCSNRPKSSIAERLFYGSKDVAFS  1254735

1254736   PYGEYWRQIKSVTVLHLLSNKRVQSYRDIREEETSNMIVKIRQECDSNSSSSVIDLRDCF  1254915

1254916   CSLTNNIVSRVALGRKYNEEGQGGMNAKVTLHEFGELLGTFSIGDYIPWLEWISKINGLA  1255095

1255096   NKVEKVAKELDTFLESVIEEHVSRKNKGEDSTGEAKDFVDVLLEIQNGKETGFLLQRDSL  1255275

1255276   KAIIL (0) 1255290

1255424   DIFAAGTDTTYTALEWIMTELLRHPRAMEKLQNEVRGLAQGKAEVTEDDLRNMQYLKAVI  1255603

1255604   KETFRLHPPDPLLVPRESTEDIKLLGYHIPAKIQVIIDAWTIGRDPLSWENPEDYLPERF  1255783

1255784   LDSTIDLKGLNFELIPFGAGRRGCPGITFAIVVIELALARLVHKFNFSLPEELDM  1255948

1255949   TEASGVTIRRKSPLLAVATPWPTYY*  1256026

 

$

 

>CYP71AX7 ortholog CYP71AX.11 syntenic

iTAG gene:chr11.1934 82% not the same sequence

PGSC0003DMB000000055

1258699-1260367 (+) strand

88% to scaffold02749

1258699   MEFPWYSVVVP

1258732   LFVFIFFLHNCLFTTFNNTNKKLPPSPRKLPIIGNLHQLGLHPHRSLHELSKRYGA  1258899

1258900   VMLLHLGSKPVLVASSVDVVRDILKTHDLVWSTRPKSSIADGLLYGSKGVAFSNYSEYW  1259076

1259077   RQIRSVMVLQLLSNKSVQSYRHVREEETSNMIDKIRQQCDSVMDLRDVLSCMTNNIIN  1259250

1259251   RVTIGRTYNEGETGIAVKALLQELLALLGTFNIGEYIPWLKWVDKINGLDNRVKKVAKDL  1259430

1259431   DAFLDSVIEERVIRNNKGEYSAGEAKDFVDVLLEIQNGNETGFPLQRDSLKAILL (0)  1259595

1259756   DSFIAGVDSIYTTLEWIMIELLRNPRAMEKLQNEVRGLAQGKAEITEDDLGNMQYLKAVI  1259935

1259936   KETLRLNPPFPLPVPRESMEDVKLLDYDIPAKTQVLINVWAMGRDPLSWDDPEEYRPERF  1260115

1260116   LNSDIDFRGLNFELIPFGAGRRGCPGIPFAIVIIELALARLVHKFNFALPQGIKKEDLDM  1260295

1260296   SECTGISIRRKLPLLAVATPCGI*  1260367

 

$

 

>CYP71AX8P ortholog CYP71AX.12

iTAG gene:chr11.1932 100% missing the C-term

PGSC0003DMB000000055

1261020-1263029 (+) strand

80% to CYP71AX7 scaffold02749, 78% to CYP71AX5, 89% to CYP71AX8P N-term

cyan region is long and usually there are no introns here. Probable pseudogene

1261020   MELPWYYIAVP

1261053   LFVFIFFLHNCFTTSNNNKKIPPSPTKLPIIGNLHQLGSHPHRSLHKLSKKYSPVMLL  1261226

1261227   HLGSKPVIVVSSAEVARDIMKTHDLVWSNRPKSSIADELLYGSTDMTFSPYGEYWRQIR  1261403

1261404   SIAVLHLLSNKRVQSYCHVREEETSNMIEKIRQECNSVIHMRVVLSCMTNNIISRVNI  1261577

1261578   GRTYYEGESGIAVKALEEEILELLGTFNVGDYISWLKWVNKINGLDTRVKKVAKDMDEFL  1261757

1261758   ESVIEERVIRSKKAEYSAGEAKDFVGVLLEIQNGKETGFPLQRDSLKALLL (0)  1261910

1262283   DLFTAGTDSIYTTLEWIMIELLRNPRAMEKLQNEVRELVQGKAEVTEDDLGNMQYLKAVI  1262462

1262463   KESLRLNPPFPLLVPRESMEDVKLLDYDIPAKTQVLINAWAIGRDPLSWDDPEEYRPERF  1262642

1262643   LNSNIDFRGLNFELILLKNDKSPTSV (0)

1262820   IPFRAGTRGCPGINFAIMVIELALAKIVHKFNLALPQGMKKEDLDMSECTGISIRRKLPLL  1263002

1263003   AVATPCAT*  1263029

 

$

 

>CYP71AX21 CYP71AX.13 not in tomato

iTAG gene:chr11.1934 100%

PGSC0003DMB000000055

1265222-1266833 (+) strand

81% to scaffold02749 tomato

1265222   MEFPWYSVIVPLFVFIFFLQRFFFTTSNNN

1265312   KKLPPSPRKLPIIGNLHQLGSHPHRSLHKLSKKYGPVMLLHLGSKPVLVASSVDAARDIM  1265491

1265492   KTHDLVWSSRPKSSIADGLLYGSTDVPFSPYGEYWRQIRSIAVLHLLSNKRVQSYRDIR  1265668

1265669   EEETSNMIEKIRQGGDSSNSVIDMRDVLSCMTNNIISRVTTGRTSNGGDSGIPVKALLEE  1265848

1265849   LLILLGIFSIGDYIPWLKWVDKMNGLDSRVKKVAKDLDAFLESAIEEGVIRNKKAECSAG  1266028

1266029   EAKDFVGVLLEIQDGKETGFPLQRDSLKAILL (0) 1266124

1266231   DSFTAGTDSIYTTLEWIMTEFLMHPRAMETLQNEVRGLAQGKAEVTEDDLGNMQYLKAVI  1266410

1266411   KETLRLHPPFPLLVPHESMEDVKLLDYHIPAKTQVLINAWAIGRDALSWDDPEEYQPERF  1266590

1266591   LNSDIDFRGLNFELIPFGAGRRGCPGITFAIMVIEVALAKIVHKFNFALPKEEDLDM  1266761

1266762   TECTGITIRRKSHLLAVATPCST* 1266833

 

$

 

>CYP71AX9 possible ortholog CYP71AX.14

iTAG gene:chr11.1935 100%

PGSC0003DMB000000055

1268827-1270396 (+) strand

90% to scaffold03823 tomato

1268827   MDLPLYCVVVPFFVFTFF

1268881   LYKCFFTTSNNQNKLPPSPRKLPIIGNLHQLGSHPHRSLHKLSKKYGPVMLLHF  1269042

1269043   GSKPVIVASSVDAARDIMKTNDLVWSNRPKCKMADRLLYDSKDVSFSPYGEYWRQIRSV  1269219

1269220   TVLHLLSNKRVQSYRHVREEETSNMIDEIRKRCDSVIDLRDVLCCMTNNIINRVALGR  1269393

1269394   KYNDGESGIDAKATLNKFVELLGTFNVGDYIPWLEWVNRITGLDNKVAKELDTFLEL  1269564

1269565   VIEEHMLRNEKGENRAGEAKDLVDVLLKIQNGNETGIPLQRDSLKALLL (0) 1269711

1269794   DTFSAGTDTIYTALEWTMTELLMHPRAMEKLQNEVRGLAQGKAEVTEDDLGNMHYLKAVI  1269973

1269974   KETFRLHPPVPLLVPRESMEEVKLLGYHIPAKTQVIINAWTIGRDPLSWDDPEDYRPDRF  1270153

1270154   LNSNIDIKGLNFEVIPFGAGRRGCPGTVFAIVAIELALARIVQKFNLALPKEEELDM  1270324

1270325   TECTGLTIRRKSPLLALATPYST*  1270396

 

$

 

>CYP71AX22P CYP71AX.15P not in tomato

iTAG gene:chr11.1936 96% missing region around frameshift

PGSC0003DMB000000055

86% to scaffold03823 tomato, one frameshift with small deletion. Possible pseudogene

1271060-1272653 (-) strand

1272653   MEYFLLVPLLVFIFFFHKCFFSP

1272584   SNTQKRLLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPLMLLHFGSKPVLIASSVDA  1272405

1272404   ARDIMKIHDLVWSNRPKSSIADGLLYDSKDVSFSPYGEYWRQIRSVTVLHLLSNKRVQS  1272228

1272227   YRHVREEETSNMIDKIRQECDSVIDLRDVLSCMTNNIISRVNIGRTYNEGESGIALKA  1272054

1272053   YLEEILLLAGVFNIGDYIPWLKWLNKINGLNSRVKKVAKGLDAFLESVIEERVIRNKNAE  1271874

1271873   YSAGEAKDFVDVLLEIQNGKETGFPLQRDTLKALLL

          DAFVAGTDSTYTVLEWTMTELLRHPRVLKKLEDEMRVLGQGKTEIT  1271514

1271513   EDDLRNMQYLKAVIKESLRLHAPVPLLLPQESMEEVKLFDYDIPAKTEVLINAWAIGRDP  1271334

1271333   LSWDDPEVYLPERFLNSDIDVKGLNFELIPFGAGRRGCPGITFAIVAE & 1271190

1271191   LLYKFNFALPKGIKGEDLDMTECNGLAVRRKLPLLVVATPLSS*  1271060

 

$

 

>CYP71AX23 CYP71AX.16 not in tomato

iTAG gene:chr11.1921 91% not the same sequence

PGSC0003DMB000000968

1790-3420 (-) strand

91% to CYP71AX.3, 89% to scaffold03823 tomato, 80% to CYP71AX12

3420   MEYFLLVPLLAFI

3381   FFLHQCFFSPSNTQKRLSPPSPRKLPIIGNLHQLGSLPYRSLHKLSKKYGPLMLL  3217

3216   HFGSKPMLIASSVNAARDIMKTHDLVWSNRPKSSMADGLFYGSKDVGFCPYGEYWRQVR  3040

3039   SVTVLHLLSNKRVQSYRHVREEETSNMIDKIRQQCDSSNSVVIDLRDVFSCMTNNIISRV  2860

2859   NIGRTYNEGESGIAVKALLEELLVLVGTFNIGDYIPWLKWINKINGLDSRVKKVAKDLDA  2680

2679   FLESVIEERVIRNKKAEYSGGEAKDFVDVLLEIQNGKETGFPLQRDSLKAILL (0)  2521

2389   DAFVAGTDSTYTVLEWTMTELLRHPRVMKKLEDQVRELGPGKTEITEDDLGNMHYLKAVI  2210

2209   KESLRLHAPIPLLAARESMEEVKLLEYNIPAKTEVLINAWGIGRDPLSWDDPEEYKPERF  2030

2029   LNSNIDVKGLNFELIPFGAGRRGCPGIPFAIMVNELALANLMYRFNFALPEGIKGEDLEM  1850

1849   TECNGLAVRRKLPLFVVATPLSS*  1790

 

$

 

>CYP71AX24P CYP71AX.17P not in tomato

iTAG gene:chr11.1936 85% not the same sequence

PGSC0003DMB000000968

7770-14461 (-) strand

82% to scaffold03823 tomato

14461  MEYFLLVPLLVFIFFFHKCFFSP

14392  SNTQKRLLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPLMLLHFGSKPVLVASSVDA  14213

14212  ARDIMKTHNLVWSNRPKSSIADGLFYGSKDVAFSNYSEYWRQIRSVTVLHLLSNKRVQS  14036

14035  YRHVREEEISNMINKIRQQCDSVIDLRDVLSGMTNNIISRVNIGRTYNEGNGIALKAL & 13862

13853  EILLLAGVFNIGDYIPWLKWLNKINGLDNRVKKVAKGLDAFLE & 13725

8624   ESVIEERVIRNKKAEYSAGEAKDFVDVLLEIQNGKETGFPLQRDTLKALIL (0)  8472

       NAFVAGTNLTYTVLEWTMTELLRHPKVLKKLE  8265

8264   DEV*GLAQGKTEITEDDLRNMHYLKTVIKETLRLHAPVPLLVPRESMEELKLLDYDIPAK  8085

8084   TQVFINAWAIGRDPLSWDDPEVYLPERFLTSDIDVKGQNIELIPFGAGRRGCP*MTFAII  7905

7904   INELALARIVHKFNLALPKEEDLDMTGLGVRRKLPLLAVATRWSS  7770

 

$

 

>CYP71AX10 ortholog CYP71AX.18 syntenic

iTAG gene:chr11.1921 86% not the same sequence

PGSC0003DMB000000968

28127-29764 (-) strand

89% to CYP71AX10 scaffold03823 tomato, 81% to CYP71AX12

29764   MEYFLLAPLLVFIYFLHQW

29707   FFSPSNTKNKLSPPSPRKLPIIGNLHQLGSLPHRSLHKLSKKYGPLMLLHFGSKPVLIA  29531

29530   SSVDAARDIMKTHDLVWSNRPKSSMADGLFYGSKDMAFSPYGEYWRQIRSVMVLHLLSN  29354

29353   KRVQSYRYVREEETSNMIDKIRRQCDFVIDLRDVFSGMTNNIISRVAIGRTYNEGESG  29180

29179   IDLKTLLEETLMLVGTFNVWDYIPWLKWLNKIKGLDTKVKKVAKDLDAFLDSVIEERVIR  29000

28999   NKKAEYSAGEAKDFVDVLLEIQNGKETGFPLQRDSLKALLL (0)

        DAFVAGTDSTYTVLEWTMTELLRHPRVLKKLED  28640

28639   QVRELGQGKTEITEDDLGNMHYLKAVIKESLRLHAPVPLLVARESMEEVKLLDYNIPAKT  28460

28459   EVLINAWGIGRDPLSWDDPEEYKPERFLNSNIDVKGLNFELIPFGAGRRGCPGIPFAIMV  28280

28279   NELALANLVHKFNFALPKGIKGEDLDMTECNGLAVRRKSPLLVVATPWSS*  28127

 

$

 

>CYP71AX11 possible ortholog CYP71AX.19

iTAG gene:chr03.1809 88% not the same sequence

PGSC0003DMB000000968

35334-37331 (-) strand

83% to scaffold03823 tomato, 92% to CYP71AX11, 83% to CYP71AX12

37331   MEYFLLVPLLAFIYFLHQWFFSPSNTQKRLLPPSPRKLPIIGNLHQLGSLPHRSLHKLSKKYGPVMLL  37128

37127   HFGCKPVLIASSVDAARDIMKTHDLVWSNRPKSSITDGLFYGSKDVAFTSYGEDWRQIK  36951

36950   SIVMFHLLSNKRVQSNRHVREEEISNMIDKIRQQCDSVIDLRDVLSCMTNNIISRVTI  36777

36776   GRTYNEGESGIAVKALLQELLVLTGTFNIGDYIPWLKWLNKINGLDSRVKKVAKDLDAFL  36597

36596   ESIIEERLIRNKKGECSMGEAIDFVGILLEIQNGKETGYTLQRDSLKALLL (0)  36444

35936   DAFVGGTESVYISLEWTMTELLMHPRVLKKLEDEVRELGQGKTEITEDDLGNMHYLKAVI  35757

35756   KESLRLHPPNPLLLPRELREDVKLLDYDIPAKTQGLINAWAMGRDPLLWDDPEEYRPERF  35577

35576   LNSDIDVKGQNFELIPFGAGRRGCPGMTFAIIINELALARIVHKFNFALPKEEDLDM  35406

35405   TECNGLGVRRKLPLLAVATPWSS*  35334

 

$

 

>CYP71AX25 CYP71AX.20 not in tomato

iTAG gene:chr03.1809 100%

PGSC0003DMB000000127

7115-8941 (-) strand

87% to CYP71AX11 scaffold03823 tomato, 84% to CYP71AX12

8941   MEYFLLVPLVAFILFLHWW

8884   FFSPSNTQKRLLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGPVMLLHFGSKPVLVA  8708

8707   SSVDAARDIMKTHDLVWSGRPKSSMTDGLFYGSKDVAFTPYGEYWRQIRSITVLHLLNN  8531

8530   KRVQSYRRVREEEISNMIDKVRQQCDSVIDLRDILSCMTNNIISRVNIGRTYNEGESG  8357

8356   IAVKALLEQLLVLTGTLNIGDYIPWLKWVNKINGLNSRVKKVAKDLDAFLESVIEEGMIR  8177

8176   NKKGECNVGEAIDFMGVLLEIQNGKETGYTLQRDSLKAILL (0)  8054

7720   DAFVAGTESTYTALEWTMTELLRHPRVLKKLEDEVRELGQGKTEITEDDLGNMQYLKAVI  7541

7540   KESLRLHPPNPLLVPHESMEDVKLLDYHIPAKTEVLINAWAIGRDPLLWDDPEEYRPERF  7361

7360   LNSDIDFKGLNFELIPFGAGRRGCPGITFAIIINELALARIVHKFNLALPKEEEELDM  7187

7186   TECHGLAVRRKLPLLAVATSWSS*  7115

 

$

 

>CYP71AX12 possible ortholog CYP71AX.21

iTAG gene:gene:chr03.1810 100%

PGSC0003DMB000000127

15611-17713 (-) strand

88% to CYP71AX12 scaffold03823 tomato,

17713   MEYFLLVPLLGFILFLHLCFFSPSNNQKRLLPPSPTKLPIIGNLHQLGSLPHRSLHKLSK  17534

17533   KYGPLMLLHFGSKPVIVASSVDAARNIMKTHDLVWSNRPKSSITDRLFYGSKDVAFSPYG  17354

17353   EYWRQIRSITVLHLLSNKRVQSYRRVREEEISNMIDKIRQQCDSSNSVVIDLRDVFSCMT  17174

17173   NNIISRVAIGRTYNEGESEIAVKALIEELLILIGTFNIGDYIPWLKWLNKINGLNTRVNK  16994

16993   VAKDLDAFIESVIEERKIRNKKVECSAGEAKDFVSVLLEIQNGKETGFPVQRDSLKALVL (0) 16814

16204   DAFVAATESTYTALEWIMTELLRHPRVMKNLQDEVRELAQGITEDDLGNMQYLKAVI  16034

16033   KETLRLHTPAPLLIPRESMEDVKLLDYHIPAKTQVIINAWAIGRDPLSWDDPEEYRPERF  15854

15853   LNSDIDVKGLNFELIPFGAGRRGCPGTAFAIVVIELALAKIVHNFNFALSKEEELDMTE  15677

15676   CHGITVSRRSPLLAVATPCYT*  15611

 

$

 

>CYP71AX13 possible ortholog CYP71AX.22

iTAG gene:chr03.1811 100%

PGSC0003DMB000000127

19856-21465 (+) strand

86% to scaffold03823 tomato

19856   MDLPCPWYSLLIPLFFFIFLLIHHCFFTTSNTQNILLPPSPSKLPIIGNLHQLGSHPHRSLHKLSKK  20056

20057   YGPVMLLHLGSKPVIVASSVDAARDIMKTHDLVWATRPKSSIIDRLFYGSKDVGFSPFGE  20236

20237   YWRQVRSIVVLHLLNNKRVQSFRYVREEETANMIEKIRQGCDSSSSVINLGDHLCSLTNN  20416

20417   IISRVALGRIYNERESGIDAKTILAEFLQLLGTFNVGDYIPWLEWVNKITGLNTKVEKIA  20596

20597   KKLDTFLESVIEEHIIRTKEKEYSAAEAKDFVDVLLEIQNGKETGFPLQRDSLKAILL (0) 20770

20860   DSFAAGTDTIYTALDWTMAELLRQPRAMKTLQNEVQGLTQGKSEVTEDDLKNMEYLRAVI  21039

21040   NESLRLHPPNSLLVPRESMEDVKLLGYYHIPVRTQAIINVWAIGREPLLWENPEEFRPER  21219

21220   FLNSDIDVKGLNFELIPFGAGRRGCPGSSFAIAVIELALARLVHKFNFALPKEEYLDMT  21396

21397   ECTGITTRRKSPLLVVATPCSS*  21465

 

$

 

>CYP71AX26 CYP71AX.23

iTAG gene:chr03.1812 99% missing N-term and C-term

PGSC0003DMB000000127

24314-25860 (+) strand (missing the PIIGNL region at the N-terminal)

73% to scaffold03823 tomato

24314   MDLPCYFLLLPLFVFIFFLHKWLFTNFNTSKKLPPSLHKLSKKY  24445

24446   GPVMLLHLGSKPVLVASSAEASRDIMKTHDLVCSSRPKSRMADKLLYGSKDVAFSPYGEY  24625

24626   WRQIRSVTVLHLLSNKRVRSYSDIREEETSNMIEKIKQGCDSSSSVIDLRDVFSCMTNNI  24805

24806   ISRVALGRKYDEVNKSGMNAKAIIEKLLSLLGTLNIGDYIPWLEWVNRITGLDTKVDKVA  24985

24986   KELDIFLESVFEEHIIRNTKGEYHAGEAKDFVDVLLEIQNGKETGFPLQRDSLKAVL (0)  25150

25258   DSFAAGTDTTHTALEWTMTELLRHPRAMETLQNEVRRLVQGKAEIKEDDLGNMHYLKAAI  25437

25438   KESLRLHPPIPLLIPRESIKDVKLLGYHIPAKTQVIINAWSIGRDPLLWENPEEFRPERF  25617

25618   LNSDIDVKGQNFELIPFGGGRRGCPGSTFAIMVNELALARIVHKFNLALPKEEELDMTE  25794

25795   CTGITIRRKSPLLAIATPCSD*  25860

 

$

 

>CYP71AX26-de1b CYP71AX.23-de1b

PGSC0003DMB000000127

26857-27064 (+) strand

26857   LPPSPSKLPVIGNLHQLG & 26910

26915   TFQMLSKKYGPLMLLQLGKIPALVVSSADAAYEILKTHDLIFSNRAKTSV  27064

 

$

 

>CYP71AX27P CYP71AX.24P

iTAG gene:chr11.1926 63% not the same sequence

PGSC0003DMB000000437

54687-59979 (-) strand

72% to CYP71AX.8, 69% to scaffold02749 tomato

59979   MDLPWYALLISLFLFIFFIHQCFHT

59904   TTNNKKKLPPSPRKLPIIGNLNQRRLLPHRSLHKLSKKNGPVMLLHLGSKPVFVASS  59734

59733   VEDARAIMKTHDVVCTSRPKSSITDIFFYGSKDVSFSPYGEYWR*IRSATVLYLIINKRL  59554

59553   QSYRHVREKKISNMIEKIKKKCY  59485

        SSSSMIDLRDCFCSLTNNIVSGVALGRKYNERKGGMNSKVTI &

        LRSLLGTFSIGDYIPWLEWVNTITCL

55184   NMIYLKAMIKETLLLPPPIPLLVPRESVKDENLLGYHIATVTQVIINSWTIGRDALPWENPEE  54996

54995   HRSERFLNSTIDVKGLNFEFIPFGAGRMGCSGTAFAVVINELALARLVHKFNYVLQEGLK  54816

54815   LEDLDMTEGSGITIRKK*PLLALATTWSSQVLLVVNTPSVQQ* 54687

 

$

 

>CYP71AX28P CYP71AX.25P

PGSC0003DMB000000097

1585830-1586086 (+) strand

55% to CYP71AX.4P

1585830   KVTLDEFAKLLGTFIII

1585883   DYIPCLEWVN*ITGKVEKVAKELDIQNRS*MGQLNHWSKDFTDVLLEIQNR  1586035

1586036   KKIDFLLERDSLKVILL (0)  1586086

 

$

 

>CYP71AX29P CYP71AX.26P

PGSC0003DMB000000097

1664430-1664722 (+) strand

65% to CYP71AX.4P

1664430   SAKVTLDEFAKLLSTFII

1664486   GDYIPCLERVN*ITGLDTKKEKVAKELDTFLDNVIEELNSGNRKGKYSTKNFIDVLLEIHN  1664668

1664669   RKEIDFLLERDLLEAILL  1664722

 

$

 

>CYP71BE17 ortholog CYP71BE.1

iTAG gene:chr02.2576 100%

PGSC0003DMB000000441

349723-351568 (-) strand

93% to scaffold01656 tomato, 53% to CYP71D4, 51% to CYP71D7, 51% to CYP71D6

56% to CYP71BE6 Vitis

351568   MEIQHSNFPMLIAFLLFVAIALKLWKKSKIQYKLPPGPRKLPLIGNLHQLSNSLPHHTLK  351389

351388   NLSNKYGPMMHLQLGEVSAVIVSSPQVAKEVLKTHDIIFANRPQLLSVQILSNNSPTLSF  351209

351208   SPYGANWRQLRKVCVLELLSAKRVQSFESIREEEVENLIEAISFIQPQVPIDISEMLFSM  351029

351028   TNNITARAAFGKKCKHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVRSALEKVH  350849

350848   QNVDKIFEDIIQEHKANKRDMLYKEDLVDVLLRVQESGDLEIPISRNTLKSVIL (0) 350687

350346   EIFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVRRVFKGKSKITESEIQKLDYMKL  350173

350172   VIKETLRMHPPAPLLLPREAIEKCDIGGYEIPAKTKVIINAWAIGRHPEHWKNAECFEPE  349993

349992   RFQDSDLDFIGTNLEYIPFGGGRRICPGTLFGIANVELPLAKLLFHFDWKLPDGIEASNL  349813

349812   DMTETFGATVGRKNDLYLVAKPYISKSQD*  349723

 

$

 

>CYP71BE.2P

PGSC0003DMB000000378

450516-450828 (-) strand

78% to scaffold01656, 55% to CYP71BE8P Vitis

450828   MLTSPQVSKEVMKSHDLIFANRPQLVSVQIIR* &

DNIPSLSFSPSGDS &

WRQLRKVCILEILS  450661

450660   AKRIQSFELIR & 450628

450623   EEVKNLIEAISLTQPQVPIDISKMIFSMTNNITARA  450516

 

$

 

 

>CYP71BL1 ortholog CYP71BE.3

iTAG gene:chr02.2041 100%

PGSC0003DMB000000443

58239-60022 (+) strand

91% to scaffold00226 tomato, 56% to CYP71BE6 Vitis, 52% to 71BE.1 potato

borderline between CYP71D and CYP71BE

58239   MELQHFPLFLATFLTILLLIFTLKLLSKKILAKKPTLN

58353   LPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGPLMHLQLGEIPTIVISSPRVAQEVL  58532

58533   KTHDIAFTNRPELLSVKVLTYNCSDIAFAPYGNYWRQMRKLCTLELLSAKNVVSFASIRE  58712

58713   EEALNLVQYVESKSGSIINLTEKIYALTNAVICRAAFGKRRKEESVYFMSLIKELSLMVS (1) 58892

        GLDISEV  59072

59073   FPSLKFLQVITGTKEKLLKLHKKFDKVLDMIIEEHKHKYDEEESSRKNDLVNLLLK  59240

59241   LQESGTLDFSFTADNIKAVIL (0) 59303

59396   DMFLAGTETSATVLDWAMVEMMRNPKVMEKAQTELRRILKGKNRVTEIDLKEVSYLKL  59569

59570   VIKETLRLHPPLPLLLPRECREHCVINGYDIPIKTKVIVNAWAINRDAEFWENAESFSPE  59749

59750   RFINCASNSLEFIGQNFEYLPFGGGRRMCPGISFGLSNVELPLAQLIYHFNWKLPNGMKP  59929

59930   EDVDVTETPGSSCSRKYNLCVIATSNDHRV*  60022

 

$

 

>CYP71BE.4P

iTAG gene:chr02.2043 98% missing N- and C-terms

PGSC0003DMB000000443

63325-71053 (-) strand

90% to 71BE.3

86% to scaffold00226 tomato, 50% to CYP71BE.1, 53% to CYP71BE6 Vitis

71053   IELQHFPLFLATFLTILLLIFTVKLL &

        ILAKKPTLNLPPGPWKLPFIGSIHHLITSQPPHHT & 70858

70856   LRDLAQKHGPLMHLQLGEIPTVVISSPPVAQEILKTQDLAFTNRPELLSIKISTYNYSNI  70677

70676   AFAHYGNYWRQMRKLCTLELLSAKNVVSFASIREEEALNLVQYVESKSGSIIKLTEKIYA  70497

70496   LTNAVICRAAFGKRRKEESVFDRGILTNDNRFgpy (?) 70401

70197   LDISEVFPSLKFLQVITGTKEKLLKLHKKFDNVLDMIIEEHKHKYDEEESSRKNDL  70030

70029   VNLLLKLQESGTLDFSFTTDNIKAVIL (0)  69949

69856   DMFLAGTDTSATVLDWAMVEMMRNPKVIEKAQRELRRILKGKNVVTESDLKEV  69698

63789   YLKLVIKETLRLHPPLPLLLPRECREQCVINGYDIPIKTKVIVNAWAINRDAEFWENAES  63610

63609   FTPERFINCAGNSLEFIGQNFGYLPFGGGRRMCPGISFGLSNVELPLAQLIYHFNWKLPN  63430

63429   GMKPEDVDVTETPGSSCSRKYNLCVIDTSNDHGV* 63325

 

$

 

>CYP71BE.5P

PGSC0003DMB000000443

71620-72369 (+) strand

83% TO scaffold00226 TOMATO

71620   DMFLAGTETSADVLEWAMTEMMKNTKVMEKAQ  71823

71824   TELRRIPQGKKKSNRD*FERS*LPKISN*RNCEVTSTTSFVTSK  71955

71956   RIQGAMCN*WI*HDIPIKTKVIVNAWAINRDAEFCEDSESFTLERFINCGSSSSNNLKFI  72135

72136   GHRFEYLPFGGGRRMCPGISFGLSNVELPLAQLIYYFNWKMPDGMKPEDVDVTET  72300

        PGASCSRKCYLCLLATCNDLGI* 72369

 

$

 

>CYP71BE18 ortholog CYP71BE.6

iTAG gene:chr10.1128 100%

PGSC0003DMB000000027

170954-172614 (-) strand

94% to scaffold07200 tomato, 61% to CYP71BE.1

172614   MELPFSQFSIFLSFLVFLVIAIKLISESM

172527   RGKGANLPPGPRKLPLIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSA  172354

172353   EAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQ  172174

172173   SFESLRQEEVKDLIKTISLNPAGTTINLSQMIFTLTNNIIARAAFGRKLENQDEFIATL  171997

171996   RKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKAARKLA  171826

171825   INREDKEDLVDVLLRVQESGDLEVPITTDTIKAVIL (0)  171718

         ETFIAGTDTSSTALEWAMAELM

171511   KNPQVMEQAQAEVRQAFKGKSMITEFEVQQLDYLRLVIKETLRLHAPVPLLVPRVARQRC  171332

171331   ELGGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTLDFKGNNFEFIPFGAGRR  171152

171151   ACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFGETVRKKTNLHVIGIPY  170975

         GNTSDY* 170954

 

$

 

>CYP71BM1 CYP71BE.7

iTAG gene:chr08.1575 100% missing exon 1 and part of exon 2

PGSC0003DMB000000303

262988-265002 (-) strand

86% to CYP71BM1 Pscaffold00777 tomato, 56% to CYP71BE7 Vitis

265002   MYFFASLLFILVILKIRSSHAAASSSSS

264918   KLPPGPWKLPIIGNLHQLAAGGHLVHKVLRDLSKKHGPIMHMQLGHVSTILVSTPETAKQ  264739

264738   VMKTHDIVFASRFQPLAAKIISYDSANIGFAPYGDYWRQMRKICVLDLLSTKRVQSFRSL  264559

264558   REEEFS (1) 264541

264150   GLARLLASHAGSPVNLTQLLHSTMLAFTSRAAVGKKFKNQERFISILCELLKVGTGFNIADFYPS  263956

263955   IKWLQHITGLRSKLEKLHHEVDRLLDEIIDDHIDVDNNTTIMHEDLVDVLLRVQN  263791

263790   DGNYEITRKNIKAVIL (0) 263743

         DMFAAGTDTSATTVEWTMAEML

263539   KNPSVLEKAQEEARRVFGEKGYVDESNFDQLKYLKAVIKETLRLHPPAPLLLPRLSREKC  263360

263359   NIDGYEIPHKTQVLVNVWTIGRDSRYWEDAECFKAERFLDSSIDFNGNNFEYIPFGAGRR  263180

263179   MCPGMSFGLANVEHPLALFLYHFDWKLPNGMKHEELDMSEVYFGVTVRRKLNMHVIPIVSKPV* 262988

 

$

 

>CYP71BG1 ortholog of CYP71BG2

iTAG gene:chr09.764 100%

PGSC0003DMB000000307

390166-392758 (-) strand

98% to CYP71BG1 Solanum tuberosum, 7 aa diffs, 91% to CYP71BG2 tomato

392758   MEASILQLLLLLSLTSCTILFYKIRGRRRWRWPPSPPSLPIIG

392629   HLHLLTDMPHHTFFHLSQKLGPIIHLQLGQIPTLIISSPRLAELILKTNDHIFCSRPQII  392450

392449   AAQYLSFGCSDITFSPYGPYWRQARKICVTELLSSKRVNSFQFIRNEEINRMIQLISSHF  392270

392269   DSELSSELDLSQVFFALANDILCRVAFGKRFIDDRLKDKDLVSVLTETQALLAGFCLGDF  392090

392089   FPDWEWVNWLSGMKKRLMNNLKDLREVCDEIIDEHLMKKRDDDQNGDGSEDFVDVLL  391919

391918   RVQKRDDLQVPITDDNLKALIL (0) 391853

         DMFVAGTDTSAATLEWTMTELA

390726   RHPSVMKKAQDEVRKIAANKGKVEEFDLQHLHYMKAVIKETMRLHPPVPLLVPRESIEKC  390547

390546   TLDDYEIPAKTRVLINTYAIGRDPEYWNNPLDYNPERFMEKDIDFRGQDFRFLPFGGGRR  390367

390366   GCPGYALGLATIELSLARLLYHFDWKLPTGVEAQDVDLSEIFGLATRKRVALKLVPT  390196

         INKLYLLSG* 390166

 

$

 

>CYP71BG.2P

PGSC0003DMB000000307

418176-418434 (-) strand

69% to CYP71BG1

418434   LYSIHHLSL*SITFMSSLVSSPPPKAFFYLSQKLGPIIHPQLGQIPTLIL  418285

418265   ILKIHDHIFSSRPKIIAAQYLSLGCSDITF  418176

 

$

 

>CYP71BP3 ortholog CYP71x.1v1 probable CYP71D member

iTAG gene:chr08.851 100%

PGSC0003DMB000000070

280172-284054 (+) strand

83% to CYP71BP3P

85% to scaffold02932 tomato, 56% to CYP71D.75, 54% to CYP71D4 potato

54% TO CYP71BE6 AND CYP72BE5 OF Vitis. 54% to CYP71D51v3 tobacco

280172   MLFTSSLLLFLPILVILI

280226   IKYYKISNPYQKLAPGPWKLPIIGNLLQMGSLPHISLANLATKHGPLMHLKLGQLSA  280396

280397   IVISSPQLAKEMMKTHDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKICVMELL  280576

280577   STKNITSFFPMMVDETYLLVNSIKAMSERPINISEKMYLLTSAIICRASIGRTCKDQE  280750

280751   SVIMLMKQVASFAGVFNVVDLFPSLKILHFISGTNRKLLQLHRKVDPVLERIINEHETEQ  280930

280931   LATEHVGEDLVDVLLRLQNNNEFQIPITRNNIKAIIL (0) 281041

         DMFVAGSATSSTVLEWAMSELL

282987   KNPSMMEKAQAEVREAFNGKTTIDQTDLKKLKYLKMVIKETLRFHPPGPLSIPRESRQQC  283166

283167   HINGYTIPNKTI (1) 283202

283713   GIVNMWALGRDSEYWEEAEKFEPERFNENPLDVSGNHFQFIPFGAGRRICPGINFSMASME  283895

283896   LCLAQLLCHFDWKLVNGVSPQQLDMTVNFGNVASRKNSLYLLASPFVKQDAR*  284054

 

>CYP71x.1v2

PGSC0003DMB000000254

599621-600754 (+) strand

100% to CYP71x.1

599621   DMFVAGSATSSTVLEWAMSELL

599687   KNPSMMEKAQAEVREAFNGKTTIDQTDLKKLKYLKMVIKETLRFHPPGPLSIPRESRQQC  599866

599867   HINGYTIPNKTI (1) 599902

600413   GIVNMWALGRDSEYWEEAEKFEPERFNENPLDVSGNHFQFIPFGAGRRICPGINFSMASME  600595

600596   LCLAQLLCHFDWKLVNGVSPQQLDMTVNFGNVASRKNSLYLLASPFVKQDAR* 600754

 

$

 

>CYP71BN1P CYP71y.1P

chr08.322 missing end of exon 1, short region near EXXR and C-term

PGSC0003DMB000000341

24855-26709 (+) strand

52% to CYP71x.1, 90% to scaffold02156 tomato

24855   MEVSSSIFTIFLIFLPLLLAIV

24921   KNHNNSKKLPPGPWKLPIIGNLHQLGISRPYITLKELSKKYGPLMHLKLGERSTIVIS  25094

25095   SYKILKELLKTSDTILSHRPELLVSKTVAYNGGDIAFAPYGDYWKQMRKICTSELLSTKR  25274

25275   IHSNYPLMEEEISRLVKNIKESSSKGTLINVYECLNSLSCDIICRATVGTTCNDSDSLI  25451

25452   STIRKITPLVGLFNISDLFPSLKFLDRYITGSNQKLLKMHHELCDRLLEEIVHVHEESI  25628

 

25678   IREKESHKFQIPITRDNIKAIIL (0) 25746

        DMFIGGTDTTSILVEWALAELL

26175   KNPNMMKKAQFEVRGVLK  26228

        GKKKVDYID

26257   VQNLKYLKLIVKETLRLHPPGPLAIPRESIEEIAINGYVIPNKTIVLMNLYAMGRDPEYW  26436

26437   RDPEKFIPNRFNNYVDNDVDDVKMIKGSSNVPMEFLGFGFG*RVCPGMLFATASSELTLA  26616

26617   RLLYHFDWKLPNGMNPEHLDMTEGFGCYTI*  26709

 

$

 

>CYP71z.1P

PGSC0003DMB000000361

92495-92915 (-) strand

43% to CYP71D.11P, 64% to scaffold02156 tomato

92915   GKTIIDHIVIKNNLKYLKLVVKETLNLPFLLGSK*SSVLRPTDPLSLLRESTIMNM  92748

92747   HAH &

MGRDPEYWGDSEKF &

LPNQFNNYVDNDDHVKIKGS*NLPMEFLAFGFGKRICLGMLFG  92568

92567   AASIELTLARLLYHF  92523

LYLIASPYD* 92495

 

$

 

>CYP72A182 POSSIBLE ortholog CYP72A.1

iTAG gene:chr07.1746 100% match

PGSC0003DMB000000102

819191-821815 (-) strand

94% to CYP72A182 scaffold05390 tomato, 56% to CYP72A15 Arab.

821815   MDCVQFIVISSCSAIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKE  821636

821635   LSLRIKEVTSKSMSLYDDDIAQRSMPFFLDTIKKY (1)  821531

820743   GKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLVREEGDKWAKHR  820564

820563   KIINPAFHLEKLK (0) 820525

820448   HMLPAFCLSCTEMLSKWEDIVSVERAYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRI  820275

820274   FELQTEQAQYFIEAVRSVYIPGWS (2)

820079   FLPTKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIE  819915

819914   QHGDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGN  819735

819734   RKPDFDGLNHLKV (0)  819696

819616   VTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGEDAKKF  819437

819436   NPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLSSSYAH  819257

819256   APHSVITTQPQYGAPLILHRL*  819191

 

>CYP72A182-ie1b CYP72A.1-ie1b

PGSC0003DMB000000102

821155-821217 (-) strand

821217   YDDNIAPRLMPFFLDTINKYG  821155

 

$

 

>CYP72A218P CYP72A.2P

iTAG gene:chr07.1760 best match 89% not the same sequence

PGSC0003DMB000000102

926245-932380 (-) strand

87% to scaffold05390 tomarto

932380   MEISYNRIIEAICEAVLLVYTRKVLNWAWFKPKKLE & 932273

932271   KSGLKGNPYKLFYGVLNELTNKLNEVRSKPINFSDDIAQRLTPFFLDSINKNG  932113

931814   GKSSFVWHGPYPIVLITDPEHVKEIFTKNYVYQKETHRNPFSKLLAIGLAQLEKNKWAKH  931635

931634   RKIINPAFQAEKLK (0) 931593

931220   HMLPAFYQSCREMISKWEEIIPKETSFELDVWPDLVLMTA*VISRTAFGSSYEEGRI  931050

931049   VFELQNEQAEYVTDINRSIYIPGSR (2) 930975

         FLPTKRYKRMLEIEKQVQTTIRRIIDKRLRAME  930770

930769   AGETSKKDVLGILLESNMKEIEQHGSKDFGMTTNEVIEECKFFYFAGQETTAVLLVWTMI  930590

930589   LLCLHPEWQAHAREEALQVFGNEKPNLEGLSRLKI (?)  930485

926670   VTMILHETLRLFPPVPTYRRRKKYEVKLGELSLPAGVLLFIPTILIHYDKELWGEDAKEF  926491

926490   KPERFSEGLSKATKGQVSFIPFGWGPLLCIGQNFAMMEAKMAIAMILQNFSFELSPFYAH  926311

926310   APFAIITIHSQYGAPLLMRKL*  926245

 

>CYP72A218P-de1b CYP72A.2P-de1b

PGSC0003DMB000000102

934760-934927 (-) strand

934927   LVYTWRMLNWAWLKPKKLEKY*RKSGPKGNPYK*LLYGDFNELTKSVIEAKSNPIN  934760

 

$

 

>CYP72A181 POSSIBLE ortholog CYP72A.3

iTAG gene:chr07.1760 100%

PGSC0003DMB000000102

945205-947627 (-) strand

90% to scaffold05390 tomato

947627   MKISYNRIIEAICVAVLLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFT  947448

947447   NKLNEAKSKPINFSDDIAQRLIPFFCDSINKN  947352

947069   GKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETHPNPFSKLLAIGLAKLEEDKWAKH  946890

946889   RKIINPAFQTEKLK (0) 946848

946618   HMLPAFYQSCSEIISKWEEIIPKETSFELDVWPDLQLMTAEVISRTAFGSSYEEGRI  946448

946447   VFELQNEQAEYVTDINRSIYIPGSR (2) 946373

946277   FLPTKRYKRMLEIEKQVQTTIKRIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGS  946101

946100   KDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPN  945921

945920   LEGLSRLKI (0)  945894

945630   VTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLVIPAILIHYDKELWGEDAKEF  945451

945450   KPERFSEGVSKATKGRISFIPFTGGPRVCIGQNFAMMEAKIGIAMILQKFSFELSPSYAH  945271

945270   APFATITIHPQYGAPLLMRKL*  945205

 

$

 

>CYP72A180 POSSIBLE ortholog CYP72A.4

iTAG gene:chr07.1761 100%

PGSC0003DMB000000102

950024-952818 (-) strand

94% to CYP72A180a scaffold05390 tomato

952818   MEISYNTIITAIYVAVLLVYTWKLLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELT  952639

952638   DKLNEAKSKPINFSDGIAQRINPFFANAINKN (1) 952543

951970   GKSSFMWLGPYPVVLITDPEHVKEILTKNYVYQRQTHPNPFAKKLALGLAKLEEDKWAKH  951791

951790   RKIIQPAFQLEKLK (0) 951749

951500   HMLPAFYQSCSEMISKWEEIIPKETSFELDVWPDLQLITAEVISRTAFGSSYEEGRI  951330

951329   VFELQKEQAEYVINIIRSVYIPGTR (2)  951255

951148   FLPTKRNKRMLEIEKQVQTTIRRIIDKRLRAMEAGETSKDDLLGILLESNMREIEQHRS  950972

950971   KDFGITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEWQARAREEVLQVFGNEKPN  950792

950791   SEGLSHLKI (0)  950765

950449   MTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVLLIIPTILIHYDKELWGEDAKEF  950270

950269   KPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTH  950090

950089   APLVTINIHPQYGAPLLLRKL*  950024

 

$

 

>CYP72A217 CYP72A.5

iTAG gene:chr07.1762 100%

PGSC0003DMB000000102

954943-957205 (-) strand

85% to scaffold05390 tomato

957205   MEFYYNIIIAAILLVI

957157   YTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELTKSVIEAKSKPINFSDDVP  956981

956980   QRLIPFFCDSINKN (1)  956939

956783   GKSSFVWLGPYPVLLITDPEHIKEIFTKNYVYQKETHPNPFSKLLAIGLAKLEEDKWAKH  956604

956603   RKIINPAFQVEKLK (0) 956562

956413   HMLPAFYQSYSEMISKWEEIIPKETSFELDVWPDLQLMTAEVISRTAFGSSYEEGRI  956243

956242   VFELQREQAEHVIDISRSVYIPGTR (2) 956168

956060   FLPTKRNKRMLEIKKQVQTTIKLIIDKRLRAMEAGEPSKNDLLGILLESNMKEIEQHGS  955884

955883   KDFGMTTIEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQARAREEVLQVIGNEKPN  955704

955703   FEGLSHLKI (0)  955677

955368   VTMILHETLRLFPPVPTYRRRNKDEVKLGDLSLPVGVLLFIPTVLIHYDKELWGEDAKEF  955189

955188   KPERFSEGVSKATKGHFSFIPFSGGPRVCIGQNFAMIEAKMAIAMILQKFSFELSPSYTH  955009

955008   APVASFTIRPQYGAPLLMRKL*  954943

 

$

 

>CYP72A216P CYP72A.6

iTAG gene:chr07.1763 89% correct seq, assembly is not right

PGSC0003DMB000000102

965395-967863 (-) strand, two frameshifts

86% to scaffold05390 tomato

967863   MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  967684

967683   NKLNEAKSKPIHFSGDVPQRLIPFFCDSINKN (1)  967588

967450   GKNLFVWLGPYPVVLITEQEHVKE & 967379

967379   ILTKNYVYQKQIHPNPFSKILALGLSKLEEDKWAKHRKIISPAFQVEKLK (0) 967230

966868   HMLPAFYQSCSETISKWEEIIPKETSFELDVWPDFQLMTSEVISRTAFGSSYEEGRI  966698

966697   VFELQREQAEHVTDISRTVYIPGTR (2) 966623

966516   FLPTKRNKRMLEIKKQVQTTIKLIIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGS  966340

966339   KDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVIGNEKPN  966160

966159   FEGLTRLKI (0)  966133

965821   VTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLFIPTVLIHYDKELWGEDAKEF  965642

965641   KPERFSEGVSKATK & 965600

965598   GHLSFIPFSGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPVASFALRP  965431

965430   QYGAPLLMHKL*  965395

 

$

 

>CYP72A179 POSSIBLE ortholog CYP72A.7v1

iTAG gene:chr07.1764 90% missing part of exon 2

PGSC0003DMB000000102

971261-973451 (-) strand

94% to CYP72A179 scaffold05390 tomato

973451   MEISYNRIIAAICVAILLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELT  973272

973271   NKLNEARSKPINFNDDIAQRLIPFFLDSINKN (1)  973176

972858   GKNSFVWLGPYPIVLITDPEHVKVIFTKNYGYQKQAHPNPFAKLLAIGLALLEEDKWAKH  972679

972678   RKIINPAFHVEKLK (0) 972637

972500   HMLPAFYQSCSEMISKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRI  972330

972329   VFELQKEQAEYVIDITRSVYIPGSR (2)  972255

972148   FLPTKRNKRMLAIEKQVQTTIRRIIDKRLRAMEAGETSKNDLLGILLESNMKE  971990

971989   IEQHGSKEFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEWQVRAREEVLQVF  971810

971809   GNEKPNLEGLSRLKI

         MTMILHETLRLFPPVPTYR  971630

971629   RRNKHEVKLGELSLPSGVLLFIPTVLIHYDKELWGEDAKEFKPERFSEGVSKATKGQVSF  971450

971449   IPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFKLSPSYTHAPVAIITTQPQYGAPLLMRKL*  971261

 

$

 

>CYP72A.7v2

PGSC0003DMB000054167

5-106 (+) strand

1005 to CYP72A.7 and CYP72A.9

5   KETSVELDVWPDLQLMTGEVISRTAFGSSYEEGR  106

 

$

 

>CYP72A178 POSSIBLE ortholog CYP72A.8

iTAG gene:chr07.1765 97% missing a small piece at the frameshift

PGSC0003DMB000000102

975280-977522 (-) strand

94% to scaffold05390 tomato, 96% to CYP72A178

977522   MEILYNTIIATICVAILLVYIWRVLNWAWFRPKKLENFLGQRGLKGNPYKLLYGDLNELT  977343

977342   KSIVEAKSKPINISDDITQRLIPFFLDSINKN (1)  977247

976938   GKSSFMWLGPYPTVLITNPEHVKEILTKNYVYQKQTHPNPFAKLLAQGLVLVEEDKWAKH  976759

976758   RKIINPAFHVEKLK (0)

         HMLPAFYMSCSEMIS  976579

976578   KWEDIVSKETSYELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIMDISR  976402

976401   SIYIPGSR (2) 976378

976291   FLPTKRNKRMLEIEKQVQTTIRHIIDKRLRAMEAGETNKDDLLGILLESNMKEIEQHGSK & 976112

976112   SFGLTTTEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNEKPD  975936

975935   LEGLSRLKI (0) 975909

975705   VTMILYETLRLFPPLPVFSRTNKEEVKLGELYLPAGVILIIPAIFIHYDKEIWGEDAKEF  975526

975525   KPERFSEGVSKVTKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFELSPSYTH  975346

975345   APFAIITIHPQYGAPLLMRKL*  975280

 

$

 

>CYP72A177 POSSIBLE ortholog CYP72A.9

iTAG gene:chr07.1766 100%

PGSC0003DMB000000102

980505-982816 (+) strand

90% to scaffold05390 tomato

980505   MEISYNRIIEAICVAILLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELT  980684

980685   NKLNEARSKPINFSDDIAQRLIPFFLDSIYKN (0)  980780

981049   GKSSFVWLGPYPAVLITDPEHVKEIFTKNYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKH  981228

981229   RKIINPAFHFENLK (0)

         HMLPAFYQSCS  981408

981409   EMISKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYVM  981585

981586   DMTHSVYIPGSR (2)  981621

981732   FLPTKRNKRMKEIEKQIQTTIRRIINKRLRAMEAGETSKNDLLGILLESNMKE  981890

981891   IEQHGNKDFGMTTIELIEECKLFYFAGQEGNSVLLIWTMILLCLHPEWQVRAREEVLQVF  982070

982071   GNEKTNLEGLSRLNI (0)  982115

982391   VTMILNETLRLFPPVATFRRRIKEEVKLGDLSLPAGVQLFIPTVLIHYDKELWGEDAKEF  982570

982571   KPERFSEGVSKATKGEASFFPFGRGPRICIGQNFAMMEAKMAIAMILQNFSFELSPSYTH  982750

982751   APLAIVSTQPQYGAPLLMRKL*  982816

 

>CYP72A176cP CYP72A.10Pv1

iTAG gene:chr07.1768 93% not the same sequence

PGSC0003DMB000000102

987831-990109 (-) strand

88% to scaffold05390 tomato with a small deletion after FYF

990109   MSIGRSPKKLEKYLRKSGLKGNPYKLLYGDLKELTNKLNEAKSKPINFSDDVPQRLIPFFCDSINKM (0) 989912

989343   GKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEEQKWAKY  989164

989163   RKIINPAFHFEKLK (0) 989122

989048   HMVLAFYQSCSEMLSKWEEAVPKETSVELDVWPHFQLMTGEVISRTAFGSSYE  988884

988883   EGRIVFELQKEQAEYVMEQVFSIYIPGSR (2) 988797

988714   FFPSKKKKRMLEIEKEIQTTIRCIIDKRLMAMQAGETNNEDLLGILLESNTKEIEQHGS  988538

988537   KDFGLTITEVIEECKLFYF & 988481

988479   MILLCLHREWQVRAREAVLNVFGNEKPDFEGLSRLKI (0)  988369

988289   VTMILYETLRLFPPALIYGRRNKDEVKLGELSLPAEVLLVIPAILVHYNKELWGEEAKEF  988110

988109   KPERFSEGVSKATNGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFTFELSPSYTH  987930

987929   APVEVVTIHPQYGAPLLMRQTFKNSCSLVNLY* 987831

 

$

 

>CYP72A.10Pv2

PGSC0003DMB000037058

2-121 (+) strand

100% to CYP72A.10P

2   AKMAIAMILQKFTFELSPSYTHAPVEVVTIHPQYGAPLLM  121

 

$

 

>CYP72A176bP CYP72A.11P

iTAG gene:chr07.1768 99% (4 aa diffs, all in one exon HMV)

PGSC0003DMB000000102

990922-992431 (-) strand, missing the first exon

The space between CYP72A.11P and CYP72A.12P is too small for these exons

91% to scaffold05390 tomato

992431   GKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEEQKWAKY  992252

992251   RKIINPAFHFEKLK (0) 992210

992130   HMVLAFYQSCSEMLSKWEEAVPKETSVELDVWPHFQLMIGEVISRIAFGSSYE  991972

991971   EGRKVFELQKEQAEYVMEQVFSIYIPGSR (2)  991885

991808   FLPSKKKKRMLEIEKEIQTTIRRIIDKRLMAMQAGETNNEDLLGILLESNTKEI  991647

991646   EQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEWQVRAREEVLNVFG  991467

991466   NEKPDFEGLSRLKI (0)  991425

991347   VTMILYETLRLFPPAPIYGRRNKDEVKLGELSLPAEVLLVIPAILVHYNKELWGEDAKEF  991168

991167   KPERFSEGVSKATNGQVSFIPFGWGPRICIGQNFAMMEAKMAITMILQKFSFELSPSYTH  990988

990987   APVAVVSIHPQYGAPLLMRKL*  990922

 

$

 

>CYP72A176aP CYP72A.12Pv1

iTAG gene:chr07.1768 99% 1 aa diff

PGSC0003DMB000000102

992555-994540 (-) strand, missing the C-term

The space between CYP72A.11P and CYP72A.12P is too small for these exons

92% to scaffold05390 tomato

994540   MIATTCVAILLVIYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELT  994367

994366   NKLNEAKSKPINFSDDVPQRIIPFFCDSINKN (1)  994271

993753   GKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEEQKWAKY  993574

993573   RKIINPAFHFEKLK (0) 993532

993436   HMVPAFYQSCSEMLSKWEEAVPKETSVELDVWPHFQLMTGEVISRTAFGSSYEEGRIV  993263

993262   FELQKEQAEYVMEQVFSIYIPGSR (2)  993191

993150   FLPSKKKKRMLEIEKEIQTTIRCIIDKRLMAMQAGETNNEDLLGILLESNTKEI  992953

992952   EQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEWQVRAREEVLNVFG  992773

992772   NEKPDFEGLSRLKI (0)  992731

992653   VTMILYETLRLFPPAPIYGRRNKDEVKLGELSL  992555

 

$

 

>CYP72A.12Pv2

PGSC0003DMB000036799

1-120 (-) strand

100% to CYP72A.12P

120   GNPYKLLYGDLKELTNKLNEAKSKPINFSDDVPQRIIPFF  1

 

$

 

>CYP72A175P CYP72A.13P

iTAG gene:chr07.1769 100% from MWLG (missing N-term)

PGSC0003DMB000000102

997074-1000496 (-) strand

88% to scaffold05390 tomato

1000496  MLRIMITTICVAF*

1000454  LIYTWKVLNWAWFKPKKLEKYLRKSGLKGNQYKLLYGDFKEFTESITEAKSKPINFSDD  1000278

1000277  IAQRLIPFYLDSINKN (1)  1000230

999546   GKNSFMWLGPYPVVLITDPEHVKEIFTKNYAYLKQNHPNPMTKLLAQGLANIEGDKWAKH  999367

999366   RKTINPAFHVEKLK (0) 999325

998482   HMLPAFYVSCSEMLSKWEEIVPKGTSLELDVWPDLQIMSSEVICRTSFGSSYEEGRT  998312

998311   VFELQNEQAEYVIRIARSIHIPGSR (2) 998237

998085   FLPTKMNRRMLKIEKEIQTTIRRIIDKRLRAIEGGETSKDDLLGILLESNMKEIELHGR  997909

997908   KDFGMTRSDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLHVFGNNKPD  997729

997728   LEGLNRLKI (0)  997702

997499   VTMILYETLRLFPPLPSSGRRTEAEVKLGELNLPAGVQLIIPAILIHYDKEIWGEDAKEF  997320

997319   KPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMAIAMILQRFSFELSPSYTH  997140

997139   APFAVVTIHPQYGAPLLMHKL*  997074

 

$

 

>CYP72A175P-de1b CYP72A.13-de1b

PGSC0003DMB000000102

1000489-1000656 (-) strand

1000656 MEMLRSMITTICVAFLLVYTWKVLN*AWFKPKKLEKYLRKSGLKGNPYKLLYGDVE  1000489

 

$

 

>CYP72A215 CYP72A.14v1

iTAG gene:chr07.1770 86% last two exons 100% match,

first three exons not a match

PGSC0003DMB000000102

1007311-1010080 (-) strand, one frameshift

88% to scaffold05390 tomato

1010080   MEILSNTIIATICVAILLVFTWRVLNWAWFRPKKLENILRQRGLKGNPYKLLYGDLNEFT  1009901

1009900   KSIVEAKSKPINFSDDIAQRLIPF &

          FLISINKN (1)

1009484   GKSSFVWLGPYPTVLITDPEHVKEIFTKNYVYVKQRHVNPMTKLLADGLSAIDGDKWAKH  1009305

1009304   RKIINPVFHVEKLK (0) 1009263

1008835   HMLPAFYVSCSEMLSKWEEIVPKGTSFELDVWPDLQIMASEVISRTAFGSSY  1008680

1008679   EEGRTVFELQKEQAEYVIEKGRSIYIPGSR (2)  1008590

1008485   FLPTKRNKRMLEIEKQVQTTIRCIIDKRLRAMEAGEPSKDDLLGILLESNMKEIEQHGS  1008309

1008308   KDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLHVFGNNKPD  1008129

1008128   LERLNRLKI (0)  1008102

1007736   VTMILYETLRLFPPLPVIGRMNKEEVKLGELNLPAEMQLIIPAILVHYDKEIWGEDAKEF  1007557

1007556   KPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTH  1007377

1007376   APFAIVTIHPQYGAPLLMRKL*  1007311

 

$

 

>CYP72A215-de4b CYP72A.14-de4b

PGSC0003DMB000000102

1011197-1011268 (-) strand

1011268   ECKLFYFAGQEATSVLLVCTMILL  1011197

 

$

 

>CYP72A.14v2

PGSC0003DMB000024626

3-143 (-) strand

100% to CYP72A.14 and CYP72A.22P

143   NWAWFRPKKLENILRQRGLKGNPYKLLYGDLNEFTKSIVEAKSKPIN  3

 

$

 

>CYP72A174P ortholog CYP72A.15P

iTAG gene:chr07.1765 84% not the same sequence

PGSC0003DMB000000102

1013843-1017065 (-) strand

18 aa deletion after KEIEL

77% to scaffold05390 tomato

97% to CYP72A174

1017065   MEMLSNIIATICVAILLIYTWKVLNWAWFRPKKVEKYFIQNGLKGNPYKLLYGDLNELT  1016889

1016888   KSIVEAKSKPINFSDDIAQRLIPFFLDSINKN (1)  1016793

1016374   GKSSFMWLGPYPVILITDPEHLKEIFTKNYVYLKQNHPNPMTKLLAQGLPNIEGDKWAKH  1016195

1016194   RKIINPVFHIEKLK (0) 1016153

1015606   HMLPAFYMSCSEMLSKWEEIVPTGTSFELDVWPDLQIMTSEVISRTAFGSSYEEGRT  1015436

1015435   VFELQKEQAEYVIEKGQSIYIPGSR (2) 1015361

1015215   FLPTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGETSKDDLLGILLESNLKEIEL & 1015048

1015045   VFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNNKPDLEGLNRLKI (0)  1014884

1014268   VMMILYETLRLFPPLPIFGRRTEEEVKLGELNLPAGVLLVIPTILVHYDKEIWGEDAKEF  1014089

1014088   KPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMAIAMILQRFSFELSPSYTH  1013909

1013908   APFAVVTIHPQYGAPLLMHKL*  1013843

 

$

 

>CYP72A173 POSSIBLE ortholog CYP72A.16v1

iTAG gene:chr07.1771 100% missing the C-term after frameshift

PGSC0003DMB000000102

1019101-1021896 (-) strand

97% to CYP72A173 scaffold05390 tomato

1021896   MEISYNIIIATISVAILLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELT  1021717

1021716   KSIVEAKSKPINFSDDIAQRLIPFFLNSINKN (1)  1021621

1020740   GKSSFIWLGPYPIVLITNPEHVKEIFTKNYVYLKQTHPNPFTKLLAKGLVSVEEDKWTKH  1020561

1020560   RKIINPAFHVEKLK (0)

          HMLPAFYVCCSEMISKWEE  1020384

1020383   IVPKETSTEIDVWPDLEMMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSR (2) 1020195

          FLPTKRNKRMLEI  1020024

1020023   EKDIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTIEVIEEC  1019844

1019843   KLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDKPDLEGLGRLKI (0)  1019679

1019527   VTMILYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYDKEIWGEDAKEF  1019348

1019347   KPKRFSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMAIAMILQRFSFELS & 1019183

1019181   PSYTHAPFAVVTIHPQYGAPLLRRKL*  1019101

 

$

 

>CYP72A.16v2

PGSC0003DMB000013263

6-221 (+) strand

1 aa diff to CYP72A.16 (allele?)

  6   FSEGVSKATKGQFSFIPFGGGPRICIAQNFAMMEAKMAIAMILQRFSFELSPSYTHAPF  182

183   AVVTIHPQYGAPL  221

 

$

 

>CYP72A172 ortholog CYP72A.17v1

iTAG gene:chr07.1772 100%

PGSC0003DMB000000102

1024002-1026908 (-) strand

95% to CYP72A172 scaffold05390 tomato

1026908   METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  1026729

1026728   KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKY (1)  1026630

1026498   GKKCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWAKH  1026319

1026318   RKILKPAFHMEKLK (0) 1026277

1025878   LMLPAFYLSCIEMLKEWEKIVPDERSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFE  1025699

1025698   LQKEQAEIIMKQFNSIYIPGSR (2)  1025633

1025249   FLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNSNEIEEQGS  1025073

1025072   KEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDWQAKAREEVLQAFGSDQPA  1024893

1024892   FDELSRLKI (0)  1024866

1024427   VTMILYESLRLYPPLATRIRRTNEETRLGNLYLPNGSLIFIPTILLHHDKEIWGEDAEEF  1024248

1024247   KPERFKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMAVALILQRFVFELSPSYTH  1024068

1024067   VPHCIVALQPKFGAPLLLQRL*  1024002

 

$

 

>CYP72A172-de1b2b CYP72A.17-de1b2b

PGSC0003DMB000000102

1027610-1028241 (-) strand

1028241   METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  1028062

1028061   KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKY (1)  1027963

1027831   GKKCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWAKH  1027652

1027651   RKILKPAFHMEKLK  1027610

 

>CYP72A172-de1c2c CYP72A.17-de1c2c

PGSC0003DMB000000102

1034351-1035620 (-) strand

1035620   METLNNIIIATIFVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  1035441

1035440   KSIKEAQAKPINNLSNDIAPRIIPYFIQTISKY (1)  1035342

1034572   GKKCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWAKH  1034393

1034392   RKILKPAFHMEKLK  1034351

 

$

 

>CYP72A.17v2 fragment

PGSC0003DMB000012805

30-230 (-) strand N-term

100% to CYP72A.17-de1b2b, 100% to CYP72A.17, 100% to CYP72A.20P

230   WAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFSKSIKEAQSKPIDNLSNDIAPRIIPYF  51

 50   IQTISKY (1) 30

 

$

>CYP72A.17v3

PGSC0003DMB000041633

1-87 (+) strand

100% to CYP72A.17

1   ARGIANYEEDKWAKHRKILKPAFHMEKLK  87

 

$

 

>CYP72A171 POSSIBLE ortholog CYP72A.18

iTAG gene:chr07.1777 100%

PGSC0003DMB000000102

1043258-1046266 (+) strand

92% to CYP72A171 scaffold05390 tomato

1043258   MEIVAYYLVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  1043437

1043438   KSFEDANSKPLKVSDDDICPRIVPYFVDTIKKH (1) 1043536

1043792   GKNCFIWIGPKPMVLVREPEVIRDVFNKYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHR  1043971

1043972   KILNPAFHMEKIK (0) 1044010

1044533   SMVPAVHLSCTEMVSQWEESISTKGTSCEIDIWPYLQRLTSDVISRTAFGSNYEEGRKIF  1044712

1044713   ELQKELAQHVIEATRTLYIPGSR (2) 1044781

1045370   FLPTKKNRRMKEIDKKVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHGN  1045546

1045547   KDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGKLE  1045726

1045727   FDGLNRLKI (0)

          VTMILNETLRLYPPVDATSRKT  1045906

1045907   TTNTKLGELSLPAGVMLLLPIILLHHDKEIWGEDATEFKPERFSEGVSKATKGQMTFFPF  1046086

1046087   GGGPRICIGLNFAMIEAKMALAMILQHFSFELSPSYTHAPQSVITIQPQYGAPLILHRL*  1046266

 

$

 

>CYP72A214P CYP72A.19P

iTAG gene:chr07.1984 55% not the same sequence

PGSC0003DMB000000102

1046559-1054009 (-) strand

56% to scaffold07408 tomato

insertion in exon 1 and odd end to exon 3

1054009   MEIILTSIAISICAIFLGICAWRFLNWLWLKPKKLEKYLRQQGLNGNSY (?) 1053863

1051589   HKLFFGDLKEGYMISKEAKSKPMNFSHDITQRVSPLLHKTFTKY (1)  1051458

1050853   GKIAFTWFGPRPVVLINDAEMVKDIFSKPYIFVKPENYHIIKLLIKGLATANKDIWSRHR  1050674

1050673   KIINPAFHLEKLK (0) 1050635

1049631   IIVPIFYSCCYDMVSKWEKIVTENGSYELDLWPNLEILTSNALSKAAFGSNYEEGKKLFD  1049452

1049451   LQMELSEVMKSFPLPGAR (2) 1049398

1048737   LLPTKTNRRVKEIAKEVRSSIEGIITKRLKAMERENAGISYDDLLGVLLESNSRQIKEGV  1048558

1048557   NKNLGMSIEEVIEECEFFYFAGHESTSVLIMWALILLSKHLDGQERARQEILQVLGGKKP  1048378

1048377   DFDDLSRLKI (0)

1046996   VNMILLETLRLYPPGVTFARVLGETTKLGNITLPCGVQVNIPTLFVHRDQEIWGNNANEF  1046817

1046816   NPERFSEGVASSTNGKFGYFPFGFGPRVCIGQNFAMLEAKVALAMFLQHFTFEISPSYVH  1046637

1046636   VPYLVVTLQAQYGAQVILRKVVKSE*  1046559

 

$

 

>CYP72A.20P

iTAG gene:chr07.1772 89% not quite the same seq. 12 aa diffs in aligned region

PGSC0003DMB000000384

65233-70526 (+) strand

top part 94% to CYP72A172

65233   METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  65412

65413   KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKY (1)  65511

66760   GKNCFVWFGPKPMILIMESEQIREIFAKNYVYQKPHHSNPVANLLARGIANYEEDKWVKH  66939

66940   RKILKPAFHMEKLK (0) 66981

67692   FAMLPAFSLSCVEMLKEWAQIVPDEGSKELEIWPQFQKLTSDMISRTAFGSSYEEGRRIFE  67874

67875   LQKEQAEIIMKQFNSIYIPGSR (2)  67940

68320   FLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLD  68463

        (deletion and &)

68462   ILLSRHQDWQAKAREEVLQAFGSDQPAFDELSRLKI (?)  68575

70101   VTMILYESLRLYPPLATRIRRTNEETKLGNLYLPNGSLLFIPTILLHHDKEIWGEDAEEF  70280

70281   KPERFKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMAVALILQRFVFELSPSYTH  70460

70461   VPHCIVALQPKFGAPLLLQRL*  70526

 

$

 

>CYP72A.21P

iTAG gene:chr09.1976 96% frameshift defect at the heme region

PGSC0003DMB000000384

71354-74838 (+) strand

Heme region frameshifted

96% to scaffold05390 tomato

71354   MEISYNIIIATISVAILLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELT  71533

71534   KSIVEAKSKPINFSDDIAQRLIPFFLNSINKN (1) 71632

73085   GKSSFIWLGPYPIVLITNPEHVKEIFTKNYVYLKQTHPNPFTKLLAEGLVSLEDDKWAKH  73264

73265   RKIINPTFHVEKLK (0) 73306

73387   HMLPAFYVCCSEMISKWEEIVPKGSSTEIDVWPDLQMMASEVISRTAFGSSYEEGRI  73557

73558   VFELQKEQAEHVMEVARSIYIPGSR

73765   FLPTKRNKRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNM  73917

73918   REIEQHGSKDFGMTTIEVVEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVHAREEVLQ  74097

74098   VFGNDKPDLEGLGRLKI (0) 74148

74413   VTMILYETLRLFPPLPTFGRTNKQEVKLGGLNLPAGVILIVPTILVHYDKEIWGE  74577

74578   DAKEFKPERFSEGVSKATKGQFS &

        LIPFGGGPRICIAQNFAMMEA &

        KMAIAMILQRFSFELS  74757

74758   PSYTHAPFAVVTIHPQYGAPLLMRKL*  74838

 

$

 

>CYP72A.22Pv1

iTAG gene:chr07.1771 84% not the same sequence

PGSC0003DMB000000384

78060-80477 (+) strand, two frameshifts in exon 1

88% to scaffold05390 tomato

78060   MEILSNII &

78085   STISVSILLVYTWRVLNWAWFRPKKLENILRQRGLKGNPYKLLYGDLNEFTKSIVEAKSKPINLSDD  78288

78289   IAQRLIPF & 78312

        FLNSINKN (1)

78655   GKSSFVWLGPYPTVLITDPEHVKEIFTKNYVYVMQRHANPMTKLLADGLSIIDGDKWAKH  78834

78835   RKIINPVFHVEKLK (0) 78876

79069   HMLPAFYVSCSEMLSKWEEIVPKGTSLELDVWPDLQIMSSEVICRTSFGSSYEEGRT  79239

79240   VFELQNEQAEYVIRIACSIHIPGSR (2)  79314

79466   FLPTKMNRRMLKIEKEIQTTIRRIIDKRLRAIEGGETSKDDLLGILLESNMKEIELHGR  79642

79643   KDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLHVFGNNKPD  79822

79823   LEGLNRLKI (0)  79849

80052   VTMILYETLRLFPPLPSSGRRTEEKVKLGELNLPAGVQLIIPAILVHYDKEIWGEDAKEF  80231

80232   KPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTH  80411

80412   APFAIVTIHPQYGAPLLMRKL*  80477

 

$

 

>CYP72A.22Pv2

PGSC0003DMB000005316

3-675 (+) strand

Runs off the ends

2 aa diffs to CYP72A.22P (possible allele?)

  3   KWEEIVPKGTSLELDVWPDLQIVSSEVISRTSFGSSYEEGRTVFELQNEQAEYVIRIAC  179

180   SIHIPGSR (2)  203

355   FLPTKMNRRMLKIEKEIQTTIRRIIDKRLRAIEGGETSKDDLLGILLESNMKEIELHGR  531

532   KDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARE  675

 

$

 

>CYP72A.23Pv1

iTAG gene:chr07.1768 91% inserted some intron seq after SINKM

iTAG gene:chr09.1978 100% after HSNP

two sequences on diff chr are identical from HSNP on

PGSC0003DMB000000384

82333-84087 (+) strand, missing N-term

98% to CYP72A.10, 92% to scaffold05390 tomato

82333   KYNYGDLKELTNKLNEAKSKPINFSDDVP &  82467

        QRLIPFFCDSINKM (?)

82670   HSNPFAKLLVRGLVTLEEQKWAKYRKIINPAFHFEKLK (0) 82783

82879   HMVPAFYQSCSEMLSKWEEAVPKETSVELDVWPHFQLMTGEVISRTAFGSSYEEGRIV  83052

83053   FELQKEQAEYVMEQVFSIYIPGSR (2)  83124

83201   FLPSKKKKRMLEIEKEIQTTIRRIIDKRLMAMQAGETNNEDLLGILLESNTKEI  83362

83363   EQHGSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEWQVRAREEVLNVFG  83542

83543   NEKPDFEGLSRLKI (0)  83584

83662   VTMILYETLRLFPPAPIYGRRNKDEVKLGELSLPAEVLLVIPAILVHYNKELWGEDAKEF  83841

83842   KPERFSEGVSKATNGQVSFIPFGWGPRICIGQNFAMMEAKMAITMILQKFSFELSPSYTH  84021

84022   APVAVVSIHPQYGAPLLMRKL*  84087

 

$

 

>CYP72A.23Pv2

PGSC0003DMB000024866

5-142 (+) strand

5 NFAMMEAKMAITMILQKFSFELSPSYTHAPVAVVSIHPQYGAPLLM  142

 

$

 

>CYP72A.23Pv3

PGSC0003DMB000033878

2-124 (-) strand

100% to CYP72A.23 and CYP72A.11P

124   VHYNKELWGEDAKEFKPERFSEGVSKATNGQVSFIPFGWGP  2

 

$

 

>CYP72A.23Pv4

PGSC0003DMB000016019

100% to CYP72A.23 and CYP72A.12P

185   RKIINPAFHFEKLK (0) 144

 48   HMVPAFYQSCSEMLSK  1

 

$

 

>CYP72A204 CYP72A.24

iTAG gene:chr06.1142 100%

iTAG gene:chr04.2844 100% duplicate sequence

PGSC0003DMB000000315

373356-376499 (-) strand

86% to scaffold07408 tomato, 89% to CYP72A204P

376499   METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTRMIKEAN  376302

376301   SKPMNMSDHDLAPRMMPFFLETINKY (1)  376218

375485   GKKCFTWMGPKPQVLIMDPELIKEVLSKTYLYQKPGGNPLGSLFVQGLVSYEKDKW  375294

375293   AKNRKIINPAFHLEKLK (0) 375243

374586   HMLPAFYLSCSEMLSKWEDVEGSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRKI  374416

374415   FELQNEQVPHFIEAMRSVYIPGWR

         FLPT  374236

374235   KRNRRMKEIKKDVRSLIRGIIDKRLKAMEAGDADNEDLLGILLESNFKEIEQQGGNKDFG  374056

374055   MSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQAREEVLQVFGSRKPDFNGL  373876

373875   NRLKV (0)  373831

373781   VTMILYESLRLYSPVTTLTRLAIEDITLGEVSLPAGVLVSLPTVILHHDKEIWGEDANKF  373602

373601   NPERFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALSMILQTFSFELSPSYTH  373422

373421   APQYSVTVQPQYGAPLIFHKL*  373356

 

$

 

>CYP72A186 POSSIBLE ortholog CYP72A.25

iTAG gene:chr07.1973 100%

PGSC0003DMB000000096

840537-844247 (-) strand

94% to scaffold07408 tomato

844247   MDKIQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLNDFIGMIREATSKP  844032

844031   MNLSDDIAPRLVPFFLETIKKY (1)  843966

843178   GKKCFIWLGPKPQVIIMDPKLIKEVLSKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHR  842999

842998   KIINPAFHLEKLK (0) 842960

842356   HMLPAFHLCCTEMLGKLEDAIPVGSSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKI  842183

842182   FELQKEQAQNFIDAVREVYVPGRR (2) 842111

841817   FLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNEDLLGILLESNFKEIEQHGN  841641

841640   KDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEVLQVFGSRKPD  841461

841460   FDGLNHLKV (0)  841434

840962   VTMILYESLRLYPPLITLNRQVNEDIVLGELSLPAGVLVSLPVILLHHDEEVWGEDANKF  840783

840782   NPERFREGLSSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTH  840603

840602   APKAIVTMQPQFGAPLILHKL*  840537

 

$

 

>CYP72A185 POSSIBLE ortholog CYP72A.26

iTAG gene:chr07.1974 100%

PGSC0003DMB000000096

845135-849205 (-) strand

90% to scaffold07408 tomato

849205   MEKIQILVTACCCA

849163   ITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRLLYGDMKDLSGMIKEANSKPMN  848984

848983   LSDDITSRLVPFFLETIKKY (1)  848924

848113   GKKSFIWLGPKPQVLIMDPELIKEVFSKNYLYQKPHGNQFAELLVKGVSTYEEDKWAKHR  847934

847933   KITNPAFHLEKLK (0) 847895

847366   HMLPAFHLSCSEMLSKWEDAVTVEGSCEIDVWPHLQQLTCDVISRTAFGSSYEKGRKI  847193

847192   FELQREQAKHYIDAARSVNIPGWR (2)

846903   FLPTKRSRRMKEIKNEVRTSIKGIIDKRMKAMKAGDADNEDLLGILLESNFKEIEQHGN  846727

846726   KNFGMSIEEVIEECKLFYLAGQETTSVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPD  846547

846546   FDGLNHLKV (0)  846530

845560   VTMILYESLRLYSPLITHNREVTEDIVLGELSLPAGVLVSLPDSLLHHDKDIWGEDANKF  845381

845380   NPERFREGIASATKGQVTYFPFSWGPRICIGQNFAMLEARMAVSMILQSFSFELSPSYTH  845201

845200   APQPILTIQPQYGAPLIFHKL*  845135

 

$

 

>CYP72A213 CYP72A.27

iTAG gene:chr07.1984 85% not the same sequence

PGSC0003DMB000000096

850339-863727 (-) strand, one frameshift

84% to scaffold07408 tomato

863727   MDKIQILVTVCCCVITITLFVCLWKILNWVWFRP & 863626

863626   KLLRKQGLNGNSYKILYGDMKDFSGMIKETNSKPMNLSDDDLAPRIVPFFLEIIKKY (1)  863456

853040   GKKSFIWMGPRPQVFIMNLELIKEVFSKIYVYQKPGVNPLGALLVRGLVSYEKDKWAKHR  852861

852860   KIINPAFHLEKLK (0) 852822

852059   HMFPAFYLSCSEMLSKWEDVVPVEGSHEIDVWPHLQQLSCDVISRTAFGSSYEEGRKM  851886

851885   FELQKEQAQHVLAAIRSVYIPGWR (2) 851814

851727   FLPTRRNRRMKEIKKDVWSSIRGIIDKRLKAMKDGDADNEDLLGILLESNFKEI  851566

851565   EQQRNKDFGMSIEDVIEKCKLFYLAGAETTSVWLLWTLVLLSRYQDWQARAREEVLQVFG  851386

851385   CRKPDFDGLNHLKV (0)  851354

850764   VTMILYESLRLYPPITALTRRVNEDITLGELSLPAGVLVSLPVILLHREEEVWGEDVNKF  850585

850584   NPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTH  850405

850404   APQSILTMQPQYGAPLIFHKL*  850339

 

$

 

>CYP72A212P CYP72A.28Pv1

iTAG gene:chr07.1984 79% not the same sequence

PGSC0003DMB000000096

866673-873127 (-) strand

76% to scaffold07408 tomato

873127   MTISNFQ &

873105   FFIVISTYTMLQLKWVWFRPKKLEKLLRKQALKGNSYRILYGDVKDFSRMIKE  872947

872946   ANSKTMNISDDYLAPRTVPFFLEIIKKY (1?)  872863

871644   KKFYMDGSKTTSIYHGSELIKEVFSKIYVYQKPGTNPLRALLVLATYEEDNWAKHRKIIN  871465

871464   PSFHLEKLK (0) 871438

870836   HMLPAFYLSCSEMLSKWEDVVPVEGSHEIDVWPHMQQLSCDVISRIAFGRSYEEGRKI  870663

870662   FELQKEQVQHLIEAVCTVYIPGWR (2) 870591

870513   FLPTKKNRRMKEIKRDVQSSIRGIIDK & 870433

870433   RLKPMESGDANNEDLLGILLESNFKEIEQHGNKHFGMSIEEVIEECKLFYLAGAETTSAW  870254

870253   LLWTMELLSRYQDWQARAREEVLQVFGSQKPDFDGLNRLKV (0)  870131

867101   VTMILYELLRLYSPTTVLIRRVYEDITLGEVSLPAGVLVSLPMILLHHEIKIYGVKMQTS  866922

866921   SIQRDLDKEYQVQQKGQVTYFPFSWSPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYT  866742

866741   HAPQSLVTTQPQYGAPLIFHKL*  866673

 

$

 

>CYP72A.28Pv2

PGSC0003DMB000032543

39-128 (+) strand

100% to CYP72A.28P

39 FLPTKKNRRMKEIKRDVQSSIRGIIDKRLK  128

 

>CYP72A.28Pv3

PGSC0003DMB000000216

590893-591132 (-) strand

100% to CYP72A.28Pv1

591132   FIVISTYTMLQLKWVWFRPKKLEKLLRKQALKGNSYRILYGDVKDFSRMIKEANS  590968

590967   KTMNISDDYLAPRTVPFFLEIIKKY  590893

 

$

 

>CYP72A211P CYP72A.29P

PGSC0003DMB000000096

876733-878735 (-) strand

88% to scaffold07408 tomato

878735   KVLNWVWFNPKKLENLLRKQGLNRNSFKILYGDLND* & 878625

878623   EATSKPMNLSDDIAPRLVPFFLETIKKY (1) 878540

877538   KKCFIWLGPKPQVKIMDPELIKEVLSKTYLYQKLGGNSFAALLVQGLATYEE  877383

877382   DKWAKHRKIINPAFHLEKLK (0) 877323

877030   ILLHHDKDIWGEDANKFNPERFREGISSAT & 876941

876939   KGQVTYFPFAWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQSLVTTQLQYG  876760

876759   APLIFHKL*  876733

 

$

 

>CYP72A210P CYP72A.30P

PGSC0003DMB000000096

879697-887759 (-) strand

88% to scaffold07408 tomato

887759   YQMPYANPFAPLLVQGLATYEEDKWAKHRNIINPTFHLEKLK (0) 887634

882026   HILPAFHLSCSEMLSKWEDVVPVEGSCEIDVWPHLQ*LTCNIISRTAFGS  881877

881876   SYEEGRKIFELQREQAQHFIDTVRSVNIPGWR (2)

881506   FLPTKRNRRMKEIKNEVRTSIKGIIIKIMKAMKARDADNEDLLGILLESNFKEIEQHGN  881330

881329   KSFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEVLQVFGSRKPD  881150

881149   FDGLNHLKV (0)  881133

880122   VTMILYESLRLYSPLMTHN*KANEDIVLGELCLPAGVLVLLPMILLHHDKDIWGEDANKL  879943

879942   NPERFREGIASVTKGQVAYFPFSWGPRICIGQNFAMLEAKMTLSMILQSFSFELSPSYTH  879763

879762   APQSIITTQPQYGAPLIFHKL*  879697

 

$

 

>CYP72A209 CYP72A.31v1

iTAG gene:chr07.1984 89% not the same sequence

PGSC0003DMB000000096

889712-898929 (-) strand

84% to scaffold07408 tomato

898929   MDKIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFSG  898741

898740   MIKEANSKPMNISNDDLSPRLVPFFLEIIKKY (1)  898645

892293   GKKSFIWMGPRPQVFIMDPELIKEVFSKISVYQKPGTNPLSALLVRGLTTYEEDKWAKHR  892114

892113   KIINPAFHLEKLK (0) 892075

891465   HMLPALYLSCSEMLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRAAFGSSYEEGRK  891295

891294   IFELQQEQVQHVIEAVRTVYIPGWR (2)  891220

891140   FANKEEQKNERKIKKDVQSSIRGIIDKRLKAMEAGDADNEDLLGILLESNFKEIEQHGNK  890961

890960   HFGMSIEEVIEECKLFYLAGAETTSAWLLWTMVLLSRYQDWQARAREEVLQVFGSRKPDV  890781

890780   DGLNRLKV (0)  890767

890137   VTMILYELLRLYSPTTALIRRVYEDITLGEVSLPAGVLVSLPMILLHHDKEIWGEDANKF  889958

889957   NPERFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTH  889778

889777   APQSLVTTQPQYGAPLIFHKL*  889712

 

$

 

>CYP72A209-de1b2b CYP72A.31-de1b2b

PGSC0003DMB000000096

899111-900549 (-) strand

84% to scaffold07408 tomato

900549   MEKIQILVTVCCSA

900507   IAITLFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRLLYGDMKDLSGMIKEANSKPMN  900328

900327   LSDDITPRLVPFFLETIKKY (1)  900268

899272   GKKSFIWLGPKPQVLIMDPELIKEVFSKNYLYQKPYANPFAPLLVQGLATYEED  899111

 

$

 

>CYP72A209-de1c CYP72A.31-de1c

PGSC0003DMB000000096

902618-902767 (-) strand

80% to scaffold07408 tomato

902767   MDKIQILVTICCCVIAVSLFVCLWKVLNWVWFRPKKLEKLLRKRQFLNNS  902618

 

$

 

>CYP72A.31v2

PGSC0003DMB000023229

100% to CYP72A.28P and CYP72A.31

148   GILLESNFKEIEQHGNKHFGMSIEEVIEECKLFYLAGAETTSAWLLWTM  2

 

$

 

>CYP72A184b CYP72A.32v1

iTAG gene:chr07.1984 100%

PGSC0003DMB000000096

903703-907034 (-) strand

93% to scaffold07408 tomato

907034   MDKIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFSG  906846

906845   MIKEANSKPMNISNDDLSPRLVPFFLEIIKKY (1)  906750

905790   GKKCFTWMGPRPQILIMDPELIKEVLSKTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHR  905611

905610   KIINPAFHLEKLK (0) 905572

905004   HMLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKI  904831

904830   FELQQEQTQHFLEVTRSVYIPGWR (2) 904759

904646   FLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHGN  904470

904469   KDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDWQARAREEVLQVLGSRKPD  904290

904289   FDGLNHLKV (0)  904273

904128   VTMILYESLRLYSPITVLTRRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKF  903949

903948   NPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTH  903769

903768   APQSLVTTQPQYGAPLIFHKL*  903703

 

$

 

>CYP72A.32v2

PGSC0003DMB000016791

2-181 (+) strand

100% to CYP72A.31 and CYP72A.32

2   LEKLLRKQGLKGNSYRILYGDMKDFSGMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYG  181

 

$

 

>CYP72A.32v3

PGSC0003DMB000050918

3-107 (+) strand

100% to CYP72A.32 and CYP72A.33

3   RRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWG  107

 

$

 

>CYP72A184a CYP72A.33

iTAG gene:chr07.1985 100%

PGSC0003DMB000000096

907925-911277 (-) strand

94% to scaffold07408 tomato

911277   MEKIEMIVTICCCATA

911229   ITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLSGMIKEANSKPMNMS  911050

911049   DHNLAPRMVPFFLETIKKY (1)  910993

910050   GKKSFIWMGPRPQILIMDPELIKEVLSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHR  909871

909870   KIINPAFHLEKLK (0) 909832

909294   HMLPAFYLSCSEMLSKWEDVVQVEG-SHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKI  909121

909120   FELQQEQAQHFLEVIRSVYIPGWR

908934   FLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHG  908761

908760   NKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVLQVFGSRKP  908581

908580   DFDGLNHLKV (0)  908561

908350   VTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKF  908171

908170   NPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTVCMILQSFFFELSPSYTH  907991

907990   APQSLVTTQPQYGAPLIFHKL*  907925

 

$

 

>CYP72A183 ortholog CYP72A.34

iTAG gene:chr07.2035 100% after deleting 2 aa at intron boundary

PGSC0003DMB000000096

1320101-1326104  (-) strand

94% to scaffold07408 tomato

1326104   MVVLILFLALLVIMIWVWRMVNWMWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAK  1325916

1325915   LKPMKLTDDILTRVLPFYHYTLNKY (1)  1325841

1323600   GNNCFTWIGPEPRIFVMEPELIKEIVMNNNIFKKPKPTPLVQLLVSGISSYEDQKWAKHR  1323421

1323420   KILNTAFYAEKLK (0) 1323382

1322642   CMVPAMHKSCEDMMNKWEILICNKNKSCELDVHPYFEDLTSDVISRT  1322502

1322501   AFGSSYQEGMKIFQLQKELAELTRQAFQSVYIPGWR (2)  1322394

1321568   FLPTRRNRRMKGIDNELKHTLRKIVNKRDRSMNLGETQEDLLGILLKSNMKEIQQNG  1321398

1321397   SKFGMTTDEVIEECKVFYFAGQETSSNLLVWTMVLLSVHQNWQTRAREEVQQVFHNNNP  1321221

1321220   DFEGLNRLKI (0)  1321191

1320526   VTMILNEVLRLYPPAPYFLRKANQETKLGKMNIPPEVILMIPTIFIHHNEELWGDDVK  1320353

1320352   EFKPDRFFQGIAKATKDKLCFLPFSWGPRICIGNNFAMMETKIALAMILQRFEFELSPSY  1320173

1320172   THAPTYVVTLQPQCGAHLILKKL*  1320101

 

$

 

>CYP72A.x scaffold

PGSC0003DMS000003002

 

>CYP72A.x = 100% to CYP72A.35a, 35b, 35c

PGSC0003DMO000068047 contig

52% to tomato (scaffold04687 54% to CYP72A30)

1956 TVIGATIGILIAIFCVKSFYTLWWWPKMIEKKLKKEGIHGLPYQFLFGNLKEMTRMSREAKK 1771

1770 TPLVNHDIVPWVNPFILHLSKTY (1) 1702

1616 ERLFVMWAGPTPRIVVSDPKLIKEVVNRHNEFQKPQANAFIDMFVTGLASYNGQKWDHH 1440

1439 RKILNPAFHIEKIK (0) 1398

1311 RLYPAFCDCCDEMINRWEELVSKSGSCELDVADEFLNVGGDVISKAAFGSNIEEGRTIFILQKEQ 1117

1116 CDLILASPFTLFFPLLR (2) 1066

 980 FFPTASNRRARYIYKKVLSLINGIIEKKKDTMRRGVSQSDDILGLLLKG 834

 833 GLSTTEIIEECKEFYLAGQDTTTALLSWTLVALSMHPEWQDKARNEVFQVLGKNKPKF 660

 659 EDLNQLKI (0) 636

 549 MNMIFQEVLRLYPALTLMRSTVKNTKLGDMTIPAGVQIFVPIYIAHRDPQVWGDDALIFN 358

 357 PNRFSEGVSKAAKEPLYFPFGWGPRMCIGNNFGMAEAKLVLSQILQRFWFKLSPSYVHAP 178

 177 QAILVMKPQYGAQIILNKL* 118

 

>CYP72A208a ortholog CYP72A.35av1

iTAG gene:chr06.1637 100%

PGSC0003DMB000000346

261664-263514 (-) strand

100% to CYP72A.35b, 35c

52% to scaffold04687 tomato, 96% to tomato AK319932.1 (not in set of 366)

263514   MAIGTVIGATIGILIAIFCVKSFYTL

263436   WWWPKMIEKKLKKEGIHGLPYQFLFGNLKEMTRMSREAKKTPLVNHDIVPWVNPFILHLSKTY (1)  263248

263162   ERLFVMWAGPTPRIVVSDPKLIKEVVNRHNEFQKPQANAFIDMFVTGLASYNGQKWDHHRKILNP  262968

262967   AFHIEKIK (0) 262944

262857   RLYPAFCDCCDEMINRWEELVSKSGSCELDVADEFLNVGGDVISKAAFGSNIEEGRTI  262684

262683   FILQKEQCDLILASPFTLFFPLLR (2) 262612

262526   FFPTASNRRARYIYKKVLSLINGIIEKKKDTMRRGVSQSDDILGLLLKGG  262377

262376   LSTTEIIEECKEFYLAGQDTTTALLSWTLVALSMHPEWQDKARNEVFQVLGKNKPK  262209

262208   FEDLNQLKI (0)  262182

262083   MNMIFQEVLRLYPALTLMRSTVKNTKLGDMTIPAGVQIFVPIYIAHRDPQVWGDDALIF  261907

261906   NPNRFSEGVSKAAKEPLYFPFGWGPRMCIGNNFGMAEAKLVLSQILQRFWFKLSPSYVH  261730

261729   APQAILVMKPQYGAQIILNKL*  261664

 

$

 

>CYP72A.35av2

PGSC0003DMB000002331

118-1956 (-) strand missing first 4 aa.

100% to CYP72A.35a, 35b

1956  TVIGATIGILIAIFCVKSFYTL

1890  WWWPKMIEKKLKKEGIHGLPYQFLFGNLKEMTRMSREAKKTPLVNHDIVPWVNPFILH  1717

1716  LSKTY (1)  1702

1616  ERLFVMWAGPTPRIVVSDPKLIKEVVNRHNEFQKPQANAFIDMFVTGLASYNGQKWDHHRKILNP  1422

1421  AFHIEKIK (0) 1398

1311  RLYPAFCDCCDEMINRWEELVSKSGSCELDVADEFLNVGGDVISKAAFGSNIEEGRTI  1138

1137  FILQKEQCDLILASPFTLFFPLLR (2) 1065

980   FFPTASNRRARYIYKKVLSLINGIIEKKKDTMRRGVSQSDDILGLLLKGG  831

830   LSTTEIIEECKEFYLAGQDTTTALLSWTLVALSMHPEWQDKARNEVFQVLGKNKPK  663

662   FEDLNQLKI (0)  636

537   MNMIFQEVLRLYPALTLMRSTVKNTKLGDMTIPAGVQIFVPIYIAHRDPQVWGDDALIF  361

360   NPNRFSEGVSKAAKEPLYFPFGWGPRMCIGNNFGMAEAKLVLSQILQRFWFKLSPSYVH  184

183   APQAILVMKPQYGAQIILNKL*  118

 

$

 

>CYP72A208b CYP72A.35b

iTAG gene:chr06.1638 100%

PGSC0003DMB000000346

301802-303652 (+) strand

100% to CYP72A.35a, 35c

52% to scaffold04687 tomato

301802   MAIATVIGATIGILIAIFCVKSFYTL

301880   WWWPKMIEKKLKKEGIHGLPYQFLFGNLKEMTRMSREAKKTPLVNHDIVPWVNPFILH  302053

302054   LSKTY (1)  302068

302154   ERLFVMWAGPTPRIVVSDPKLIKEVVNRHNEFQKPQANAFIDMFVTGLASYNGQKWDHHRKILNP  302348

302349   AFHIEKIK (0) 302372

302459   RLYPAFCDCCDEMINRWEELVSKSGSCELDVADEFLNVGGDVISKAAFGSNIEEGRTI  302632

302633   FILQKEQCDLILASPFTLFFPLLR (2) 302704

302790   FFPTASNRRARYIYKKVLSLINGIIEKKKDTMRRGVSQSDDILGLLLKGG  302939

302940   LSTTEIIEECKEFYLAGQDTTTALLSWTLVALSMHPEWQDKARNEVFQVLGKNKPK  303107

303108   FEDLNQLKI (0)  303138

303233   MNMIFQEVLRLYPALTLMRSTVKNTKLGDMTIPAGVQIFVPIYIAHRDPQVWGDDALIF  303409

303410   NPNRFSEGVSKAAKEPLYFPFGWGPRMCIGNNFGMAEAKLVLSQILQRFWFKLSPSYVH  303586

303587   APQAILVMKPQYGAQIILNKL*  303652

 

$

 

>CYP72A193 ortholog CYP72A.36

iTAG gene:chr10.330 100%

PGSC0003DMB000000472

175452-178443 (+) strand

94% to scaffold05603 tomato

175452   MQYISLTIAFAIILVIFLRWRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVKMDE  175637

175638   EAKSKPIKFSHDIVPRLMPFIHKTIIDY (1) 175721

176457   GKNSFIWLGPNPAMLIMEPEHIREILSKSNIFQKPPPALTKLLAEGILSYEADKWAKHR  176633

176634   RIINPAFHLDKLK (0) 176672

176912   HMVPSFHLTTCEMLSKWEKIVSTEGSEVDVWPYLQTLTSDAISRTAFGSSYEE  177060

177061   GRKIHELQQELAKIIVKETEASYIR (2)  177135

177221   FLPTKEKRRMNRLHQEVRSLVLRIINKRMNEIEAGETSNSDDLLGIL  177361

177362   LESNLKEIQEHGNKKFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQARAR  177541

177542   EEVLQVFGNNIPDYDKLSQLKV (0)  177607

178018   VTMIMQEVLRLYPPIFLMGREVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVKEF  178197

178198   NPERFSEGVNRATKGKFAYFPFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAH  178377

178378   VPYSVFTLLPQYGAQLILNKL*  178443

 

>CYP72A193-de1b CYP72A.36-de1b

PGSC0003DMB000000472

179451-179519 (+) strand

179451   KPKKLEKQLRQQGFNGNSYKFLF  179519

 

$

 

>CYP72A194a POSSIBLE ortholog CYP72A.37

iTAG gene:chr10.331 96% defect at framesshift

PGSC0003DMB000000472

181450-184325 (+) strand, one frameshift, possible pseudogene

77% to CYP72A51 tomato

181450   MEIPYNYYNLNLVLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGD  181629

181630   VKEMMKMGKEALSKPIDFSHDMIWPRVMPFFHKTINNY (1)  181743

181968   GKNCFAWYGPRPAVVIVDPELIREVLTKNYIYQKPPGNPLTRLAANGLAGYEADKWAKHR  182147

182148   RIVNPAFHLDKLK (0) 182186

182881   HMLPAFQLTSSELLKKWKEIISKEGSEIDVWPYLQTLTSDAISRTAFGSSYEEGKK  183048

183049   IFELQKEQMGLLLQVARSLYIPGWR (2)  183123

183279   FVPTKTNRRMKQIFNEVGALILGIIKKRIKMIEDGEIHDDLLSILLTSNLQEIQQHGH  183452

183453   KKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQERAREEVLQVFESDEFD  183632

183633   YDKLNHLK & 183656

183658   V* 183656

183897   VTMILNEVLRLYPSGYFINRVVTKDTKLGNVCLPSGVQLLLGTILLHHDTEIWGDDAMEF  184076

184077   NPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSPSYAH  184256

184257   APHPLLLQPQYGAHLILYKLEK*  184325

 

$

 

>CYP72A194a-de4b CYP72A.37-de4b

PGSC0003DMB000000472

185168-185287 (+) strand

185168   VEKMILLCKHPNWQVRAREEVLQVFGSNEIAYDKLNQLKV (0) 185287

 

$

 

>CYP72A195Pa CYP72A.38P

iTAG gene:chr10.983 77% not the same sequence

PGSC0003DMB000000472

185922-189493 (-) strand, missing the end of exon 3

95% to CYP72A.40, 77% to CYP72A51 tomato

189493   MEISYYNLKIAIFSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  189314

189313   EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNY (1)  189206

188548   GKNCFVWIGPKPAVLITEPKLIREVLTKNYVYHKARGSPLSKLVISGLAGHEKDKWATHR  188369

188368   RILNPAFHLDKLK (0)

187895   HMLPAFKLTVNEMLNTWKKVVSKDGTEIDVWPYLQTLTSDAISRTAFGSNYEEGKK  187728

187727   NFELQKEQIELISKMNIYIYI () 187665

187155   FVPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGESHDDLLSIL  187021

187020   LTSNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAR  186841

186840   EEVLQVFASDELDYDKLNQLKV (0)  186784

186344   VTMILNEVLRLYTSAYTINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEF  186165

186164   KPERFSEGISKATKGQVVFFPFSWGPRICIGQNFAMLEAKMAMVMILKYYAFELSPSYAH  185985

185984   APHPLLLQPQYGAQLIMHKL*  185922

 

$

 

>CYP72A.38Pv2

PGSC0003DMB000012570

1-237 (+) strand

100% to CYP72A.38Pv1

  1   DLCLPSGVQLILATMLVHHDTEIWGDDAMEFKPERFSEGISKATKGQVVFFPFSWGPRIC  180

181   IGQNFAMLEAKMAMVMILK  237

 

$

 

>CYP72A194Pb CYP72A.39P

PGSC0003DMB000000472

190641-191704 (+) strand

95% to scaffold02289 tomato

190641   RFVPTKTNRRMKQIFNEVGALILGIINKRIKMIEDGEIDDDLLSILLTSNLQEIQQHGH  190817

190818   KKFGMSTDEVIEECKLFYLAGQETTSALLVWTMILLCKYPIWQERARQEVLQVFESDEFD  190997

190998   YDKLNHLKV (0)  191024

191276   VTMILNEVLRLYPSGYFINRVVTKDTKLGKLCLPSGVQLLLGTILLHHDTELWGDYAMEF  191455

191456   NPERFSDGVAKATKGQLVFFPFSWGPRICIGQNFAMLEAKIAIAMILKHYSFGLSPSYAH  191635

191636   APHPLLLQPQYGAHLILYKLEK*  191704

 

$

 

>CYP72A195b CYP72A.40v1

iTAG gene:chr10.983 78% not the same sequence

PGSC0003DMB000000472

192948-196712 (-) strand

196712   MEISYYNLKIAIFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  196533

196532   EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNY (1)  196425

195759   GKNCFVWFGPKPAVLITEPKLIKEVLTKNYVYQKARGSPLLKLAISGLAAHEKDKWATHR  195580

195579   RILNPAFHIDKLK (0) 195541

195143   HMLPAFKLTVNEMLNIWKEVISKDGTEIDVWPYLQTLTSDAISRTA  195006

195005   FGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWR (2) 194901

194215   FVPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGESHDDLLSILLTSNLKEIQQHGN  194042

194041   KKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELD  193862

193861   YDKLNQLKV (0)  193835

193370   VTMILNEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEF  193191

193190   KPERFSEGISKATKGQVVFFPFNWGPRICIGQNFAMLEAKMAMVMILKHYAFELSPSYAH  193011

193010   APHPLLLQPQYGAQLIMHKL*  192948

 

$

 

>CYP72A.40v2

PGSC0003DMB000010099

129-293 (-) strand

100% to CYP72A.40v1

293   EIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWR  129

 

$

 

>CYP72A188 ortholog CYP72A.41

iTAG gene:chr07.1159 100%

PGSC0003DMB000000250

444967-446961 (+) strand

96% to scaffold04687 tomato

444967   MGIAVFIALAVCLPFSF

445018   WCLKLLYFVWWRPKTVENELRQQGIYGRPYRFLFGNLKEMIEMNKIAKSKPMPLHHDFT  445194

445195   PRLNPLFYELATTY (1)  445236

445322   KKLYLFWLGPIPRLTILDPKLIKEVLSNKSGEFRKPNISAFLKLFVTGLGTYDGEKWAKHRKIL  445513

445514   NPAFHMEKLK (0) 445543

445620   VMLGLFVNCTDDMISRWDKLTGSTGGSCEVDISQEFHNLTGDMLSKAAFGSNFEEGKLVFSLL  445808

445809   REQCELIFTAKLAINVFPWLR (2)  445823

445945   FVPTKTNRRRLYIYNTVRSSLKAIIEKREKEVQSGKSHNEDLLGLLMKSNQEEQQG  446112

446113   NKNSNKGMSTEDMIEECNSFYFAGQETTATLLTWTAIVLTMHPDWQEKARKEVLEVIGKD  446292

446293   EPKFDQLNHLKI (0)  446328

446536   VTMILHEVLRLYPSGSLVRETNKKTKLGEYTIPAGAQLLVPLQTIHRDTEAWGEDALIF  446712

446713   NPERFSEGVSKASKDLMYFPFGWGSRICLGMNVSMIQGKLVLAKILQNYSFELSPSYAH  446889

446890   GPTMPALVLQPQYGAPMILRKLS*  446961

 

$

 

>CYP72A189 CYP72A.42

iTAG gene:chr07.1777 79% not the same sequence

PGSC0003DMB000000458

250254-253780 (+) strand

91% to scaffold05390 tomato

250254   MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  250433

250434   SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKY (1)  250535

251178   GKNCFIWVGPKPLVIVGDPEVIRDVFNKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHR  251357

251358   RILNPAFHMEKIK (0)

251901   DMLHTVHLSCSEMVSQWEEAVSMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIF  252080

252081   ELQKEQAKHVIEVSRTLYILGWR (2) 252149

252503   RFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHGN  252682

252683   KNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQLFGDGMPE  252862

252863   FDGLNRLKV (0)  252889

253355   VTMILHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHDKEIWGEDATKF  253534

253535   KPEKFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAFELSPSYTH  253714

253715   APQSVITMQPKYGAPLMLHKL*  253780

 

$

 

>CYP72A190 POSSIBLE ortholog CYP72A.43

iTAG gene:chr07.1777