These 1744 sequences are searchable at

the P450 BLAST server

 

>CYP4C1 cockroach M63798

MEFITILLSTALFIVTFLFLFRQGAKRARFVYLVNKLPGPTAYP

VVGNAIEAIVPRNKLFQVFDRRAKLYGPLYRIWAGPIAQVGLTRPEHVELILRDTKHI

DKSLVYSFIRPWLGEGLLTGTGAKWHSHRKMITPTFHFKILDIFVDVFVEKSEILVKK

LQSKVGGKDFDIYPFITHCALDIICETAMGIQMNAQEESESEYVKAVYEISELTMQRS

VRPWLHPKVIFDLTTMGKRYAECLRILHGFTNKVIQERKSLRQMTGMKPTISNEEDEL

LGKKKRLAFLDLLLEASENGTKMSDTDIREEVDTFMFEGHDTTSAGICWALFLLGSHP

EIQDKVYEELDHIFQGSDRSTTMRDLADMKYLERVIKESLRLFPSVPFIGRVLKEDTK

IGDYLVPAGCMMNLQIYHVHRNQDQYPNPEAFNPDNFLPERVAKRHPYAYVPFSAGPR

NCIGQKFATLEEKTVLSSILRNFKVRSIEKREDLTLMNELILRPESGIKVELIPRLPA

DAC

 

>CYP4C2 Anopheles albimanus (mosquito) L38678

TSAAISWILLLLGGDPAIQERIVEEIDLIMGGDRERFPTMQELN

EMKYLEACIKEGLRLYPSVPLIARHLTEDVDIDGYTLPAGTTAMIVVYQLHRNPDVFP

NPDKYNPDHFLPENCRGRHPYAYI

 

>CYP4C3 D. melanogaster AC014779 73845-80196 also AC008219

MSSKVITSLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPG

PAAMPFLGNAIEMNVDHD

ELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVE

PILNSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKI

LTPAFHFKILDDFIDVFNEQSAV

LARKLAVEVGSEAFNLFPYVTLCTLDIVC

ETAMGRRIYAQSNSESEYVKAVYG

IGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPD

AYDDVGKKKRLAFLDLLIDASKEGTVLSN

EDIREEVDTFMFEGHDTTSAAISWTLFLLGC

HPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI

GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRN

CIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD

 

>CYP4C3 D. pseudoobscura ortholog of Cyp4c3 94% intron 3 missing

MSSKVISSLMAESILLTKMAQVISGYSPITIFLLASIALFLVVYNKRRSRLVKHIEKIPG

PAAMPFLGNAIEMNVDHD

ELFNRVIGMQKLWGTRLGINRVWQGTSPRVLLFEPETVE

PILNSQKFVNKSHDYDYLHPWLGTGLLTSTDRKWHSRRKILTPAFHFKILDDFVDVFNEQSAV

LARKLAVEVGSEAFNLFPYVTLCTLDIVC

ETAMGRRIYAQSDSESEYVKAVYG

IGSIVQSRQSKIWLQSDLIFRLTADYKLHQSYINTLHGFSNMVIRERKSELALLQDNNNNNNNTPDA

YDDVGKKKRLAFLDLLIDASKDGTVLTN

EDIREEVDTFMFEGHDTTSAAISWTLFLLGCH

PEYQEQVAEELDSIFGNDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI

GGKLVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNC

IGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD

 

>CYP4C4 Diploptera punctata (Pacific beetle cockroach) AF071073

TTAAISWTLYLLATHPDIQDKVYEELENIFENSDRSPSMKDLSE                      MKYLERVTKETLRLYPSVPFIVRKLREDVEVDGYILPRSIEVSMVPYYAHRLPEYFPE                      PDKFNPDNFLPERVAARHPYAYIPFSAGPR

 

>CYP4C5 Diploptera punctata (Pacific beetle cockroach) AF071074

TAVGISWTLQMIASHPDVQEKVYEELENIFQGSERQPTMKDLNE                      MKYLERVIKESLRLYPSVPLIARYLNEDIQIDGYNIPAGMTILFEITFTHRDPEIYPD                      PDRFNPDNFLPERVAARHPYAYIPFSAGPR

 

>CYP4C6 Diploptera punctata (Pacific beetle cockroach) AF071075

TTAGMCWAIFLLGLHPDVQEKAYEEQQSIFEGSKRSATMKDLNEMKYLERVIKEALRL

YPSVPTIGRMATEDIKLDNYIIPKGCTVTLQFFFLHRNADYFPDPEKFDPDRFLPENV

AKRHPYAYLPFSAGPR

 

>CYP4C7 Diploptera punctata (Pacific beetle cockroach) AF071072

AVLLLTSLAIVVVYLCRRLNFWVKLRSVPGPPALPFLGNSLILR                      GTQEEFFRLLSKCATKYGNIFRLWVGQRPFVFLYSAEAIQPILNSTVYIDKSYEYSFL                      FPWLGTGLLTSTGNKWHTRRKLLTQSFHSKVLEDFLEPIYQHSLFLCNRLELELDKPH                      FKVTPYAKLCALDIICDTAMGSTINAQENSQSEYVTAVDSLSEIVQRRFITPWLKPDF                      LFKMTKLGKKQEQCLKIVHNFTRKVINERKEDKLRQNNLEVEISQQNGIKKKHRLALL                      DLLLELSENGKVLTDEDICEEVDTFMFAGHDTIASGVSWILYVLGHHLDSQEKIVEEF                      KNVMEEDNTEWPTMKHLNKLCYLERCIKEAMRLYPVVPLIARNLTQPIKIMDYMLPEG                      VTILINTYLLHRDSRFFPNPDIFEPDRFLTSNCEARNPFAYVPFSAGPRNCIGQKFAM                      MELKIILSTVLQRFIVKSVDKEERLKLVGELVLLNRDGIRLTITART

 

>CYP4C8 Mastotermes darwiniensis cytochrome U77126

FEGQEKTSAGMWWDLFFVGLHPDIQEKAFQEQENIFQGSDRSAT                      MKDLNEMKFLERVIKESLRLYPSVPKISREINEDVKIAEYDIPSGCTVIVHIYNIHRN                      PDQFPNPEKFDPDNFLPERVAKRHPYAYIPFSAGPRNCIGQN

 

>CYP4C9 Coptotermes acinaciformis AF046008

DSTSAGICWTIYLLGVHTDIQNKVSEELDHIFHGSDRSVTMKDL                      NEMKYLERVIKESLRLYPSVPFIGRQTTQDIQLDEYTIPAGVTMTVPIYSIHRNPDQF                      PNPEKFDPDNFLPERVAKRHPYAYIPFSAGP

 

>CYP4C10 Coptotermes acinaciformis AF046009

DTTSAAVCWTLFLLGLHPEVQDKAYEELEGIFEGSDRPPTMKDL                      NELKYLERVIKESLRLYPSVPSFSRLLKEDIVIGGYTIPAGCSIRVSIYMNNRNSDQF                      PNPEKFDPDNFLPERVAKRHPYAYIPFSAGP

 

>CYP4C11 Mastotermes darwiniensis AF067631

DTTSAGMCWALFLLGLHPDIQEKAFQEQENIFQGSDQSATMKDL                      NEMKFLQRVIKESLRLYPSVPIFAIKLNKDIKIADYDIPSGCTLFVPIYSIHRNPDQF                      PNPDKFDPDYFLPQKVPNTHPYAYIPSTAGP

 

>CYP4C12 Mastotermes darwiniensis AF067632

DTTSDAICWTVYLLGVHSDIQNKVYEELEGIFQGCDRSPTMKDL                      NEMKYLERVIKEALRLYPSVPCICRETTEDIKIDEYTIPAGVTVTVPIYNVHRSPVYF                      PNREKFDPDNFLPEKVLKRHPYAYIPFSGGP

 

>CYP4C13 Mastotermes darwiniensis AF067633

DTTSAAICWTLYLLGLHTDIQNKVYEELEGIFQGSDRSPTMKDL                      NEMKYLERVIKEALRLYPTVPYISRETTEDIKIDEYTIPAGVTVTVPIYNVHRNPVYF                      PNPDKFDPDNFLPEKVLNRHPYAYIPFSAGP

 

>CYP4C14 Mastotermes darwiniensis AF067634

GGHENYKCCDMLTLFLLGLHPDVQETAYQEQESIFQGSNRSVTM                      NDLNEMKYLERVIKETLRLYPSAPIIGRILKNDVNIAGYDIPSGCTVLMHIYGIHRNP                      VQFPNPEKFDPDNFLPKGVAKRHPYAYIPFSAGPRNCIGQKFAMLEVDTFML

 

>CYP4C21 Blattella germanica (German cockroach) AF275641

MDITVFLSLTVVVFLAVIIFYGRNEERKRMLQKIPGAPSLPLIG

TALPILYRRKEDRMTWIEEILEKYKPLILWYFGNRPFVNISSPELIEVVLRNTQLIDK

AFLYDLFHSWLGTGLLTSSGAKWHQHRKIITPTFHFSILEGFITIFAEKSEILVRKLQ

KEVGRGPFFIRQYVSNCALDIICETAMGTSVNAQDEGFSEYVTAINKMTDVLSDRMAN

PLLYPEFIFKLTPYYWTHKKCLKVLNGFVNKIIQERKEERKKSKVTQTSEDADIGKKK

RVPFLDTLLDASEDDNKLTDTDILEEVHTFMFEGHDTVSAAMTWLLFELGHHPEIQEE

AYKEVQDIFQGSDRVPTMADLNNMNYLERVIKESLRLHPSVIYFVREAHQDFELGGYT

IPAGTNIDFSVPFIHRNPEIFPNPRCFNPDNFLPDRVVNRHPYAYIPFSAGPRNCIGQ

RFALLEEKVVLSYLLRHYRFRTVNKREDSKFKLEMINTPVKPIQLIIEARN

 

>CYP4C22v1   Culex pipiens pallens (mosquito) AF157093

EVDTFMFEGHDTTSAAISWILLLLGAEPAIQDRIVEEIDEIMGG DRDRFPTMKELNDMKYLECCIKEGLRLYPSVPLIARKLVEDCVVQDYTIPAGTTAMIV VYQLHRDPAVFPNPDKFNPDHFAPENCRGRHPYAYIPFMAGPRNCIGH 

 

>CYP4C22v2  Culex pipiens  AF208659

TSAAISWILLLLGAEPAIQDRIVEEIDQIMGGDRDRFPTMKELN DMKYLECCIKEGLRLYPSVPLIARQLVEDCVVQDYSIPAGTTAMIVVYQPHRDPAVFP

NPDKFNPDHFAPENCRGRHPYAYI 

 

>CYP4C23    Culex pipiens pallens (mosquito) AF157090

MFEGHDTTAAGIILTIMLPANEQDAQRRVYEDLSKARRLKPEHE AFTIADYTNLKYLDRFVKEALRLYPPVSFISRSLTGRLDVGRYSKLPVNQILVHIELL NRSHHHLAARNYRQHSHLRSAPYPEQFPDPERFDPDRFLPEVSAKRNPYAYVPFCAGPRNCIGH

 

>CYP4C25 Anopheles gambiae CYPb1x3, 495 aa AAAB01008846.1

MESLLGGSLLLSKLSKVFTLFSPVTLLLLTTVSCAIYVYNRRRAHIVRHIDKIPGPAGLP

ILGNTLHINVDHD  8117713

8114485 EIFNRIIAIRKLYGRIQGFSRAWNGPLPYVMISKASAVE 

RILGSQKHIEKSHDYEFLKPWLGTGLLTSAGKKWHPRRKILTPAF

HFKILDDFVDIFQEQSAVLKRLEAELGNEQGFNCFPYVTLCALDVVC 

ETAMGRQVNAQCNSDSDYVKAVYQ 

IGSIVQNRQQKIWLQPDFIFKLTQDYKNHQKCLAILHEFSNRVIHERKEEIRRQKQQLGDKN

NNNSNNNNGGGGAAGTDQDGNNNKDDYLSHEELGRKKRLAFLDLLIEASQDGAVLSHEDI  REEVDTFMFEGHDTTSAAISWILLLLGTEPTIQDRIVEEIDQIMGGDRERFPTMQELNEM  KYLEACIKEGLRLYPSVPLIARRLTEDVDIDGYVLPAGTTAMIVVYQLHRNPEVFPNPDK  FNPDHFLPENCRGRHPYAYIPFSAGPRNCIGQKFAVLEEKSIISAVLRRYRVEAVDRREN 

LTLLGELILRPKNGLRIRIARRT* 

 

>CYP4C26 Anopheles gambiae CYPb1x1, 480aa AAAB01008846.1

MENSFASDRIGTVRRGTAALVAVFSPPTLAMLLLLALVLVVFKARRAKMVKLIDQIPGPV

CMPLVGNGLQINVGCKD 

ELFDRIIASRKMFGRRQGISRVWNGPIPYVLISKAAAVE PILSNPKLVEKSNDYEYMKAWLGNGLLTSPGYIWHPRRKSLTPAFHFKILSDFVTIFQN

QADVLIDKLAEHTVQGEPFNIVPYVTLCALDIFC 

ETAMGCPVYAQKNSNSEYVRAHKQ 

IGKVIRNRLQKIWLHPDFVFKRTKEFQKHQECLKVLHNFSDRVVRERKEELRKRKEQLDQ NNNNGNGESDYSVLEDGIYRKKQLAFLDLLLEGSGLSDLAIREEVDTFIIGGHDTTAAAM AWILYLLGAAPDIQERVIQEIDAVMGTDRDRRPTMAELNEMRYLE                 CCIKEGLRLYPSIPVIGRRLTEDVRVDNYTIPAGTTAMIVVYELHRDTSVFSNPDKFNPD NFLPENCHGRHPYAYIPFSAGPRNCIGQKFAILEEKSVISAILRKYRIEAVNRREDVQLL 

CDLVLRPKDGLIVRLHKRE*

 

>CYP4C27 Anopheles gambiae CYPo3r3 515aa AAAB01008984.1

MSELSTIFHGVLVFVVFAIYLQWLMKRWQLSQIFEKIPGPKAYPIIGTMYSFIGKQRH  EIFYLLDERTRRYPEIHRVWTGLTPEVRISKPEYVEQVIGSSKHIEKATMYRFL

HDWLGNGLLTSK 

GERWHQHRKLITPTFHFNILDG

FCDVFAENSEEMVEYLRPHADTGKPVNVYPFIAKAALDIIC 

ETAMGVKVNAQSEGEENDYVKAVCE 

LSRLFVERMVRPWLHLDFIWLRSRFAARYKNALDTVHNYSRE 

VIRDRKAALESAKKSAGAETSDGEAFGVRMRMAFLDLLLEGNQAHNIMTDEDVREEVDTFMFE 

GHDTTTAGISWVLFLLALHPDVQERVCEEIESIFPPGDDRPATMQDLNELKLLERCIKE

ALRLYPSVSFFGRTLSEDVQLGGHQVPAQTIVGIHAYHVHRDER 

FYPDPEKFDPDRFLPENTENRHPYAYIPFSAGPRNCIGQKFALLEEKSIVSSVLRRYRL

RSVRTRDEQKIMHELITRPKDGILLYLESRQKKVDA* 

 

>CYP4C28 Anopheles gambiae CYPs3l1 460 aainc AAAB01008849.1 N-term added 

MSSILWSDLVPNALQLLSPTAWIVMLTVAASTVIFYRQRAEVAKHINRIPGPPALPLLGNSLQWLVDRD EMFSTINGARLLYGRRQGFNRVWAGLKPYILISKATAAE 

RILSSSKNIEKGRDYDLLKPWIGTGLLTSHAAKWHQRRKMLTPTFHFKILANFVEVMNKQ

SYVLVRQLEKQLNNTEGFDCTIYATLTSLDIIC 

ETAMGYPIHALEKSDSEYVKAHEK 

ISEIILERLQKFWLRSDFIFRFTKAYTEHEHCLKILHDFAYSMIQKRREMYRQRKQSML   SETGSADNAPHSEEAHGQRKQLAFLDLLLELSEDGQLLSDADIREEVDTFILGGHDTTAT ALAWMLYLLGTDQTVQERVFLEIDGIMGGDRERHPTMAELSEMRYLECCIKESLRLFPSI  PILSRTLTTGVDIEGHHIPSGTNAVIMLYQLHRDPQYFPNPEKFYPDRFLPENSTNRHPY  SYIPFSAGPRNCIGQKFGALEEKAVISAVVRNYKIESVHRREDLILYGDLVMRTKGGLKI 

RIQRRI* 

 

>CYP4C35 Anopheles gambiae CYPo3r1 509 aa AAAB01008984.1 

MLLVVLVLLLLTPVLQWLIRRVQMSQIYDKIPGPKAYPFVGTLYLLFGKKSH  EIFTLIDQRTRQYDGIHRIWVGMTPEVRLSRAEYVEQIIGASKHTEKATLYRFLGDWLGEGLLTSK  GERWFQHRKLITPTFHFNILDGFCEVFAENGAVLVERLQRHANTGQPVNIYPYVTKAALDVIC 

ETAMGVQVHAQTAGEDNAYVNAVYE 

LSSLFLERLVRPWLHPEWTFRRSALGRRQAQLLAILHGYTRK 

VIQERRRTLDQQHAGERNQPEAEGDGLGRRKRLAFLDLLLQSATTGTGSPLLTDEDVR

EEVDTFMFE 

GHDTTTAGMSWALFLLALHPEVQERVHQEIDSIFGGSDRPATMQDLTAMRLLERCLKET

LRLYPSVAFFGRTTSKDVTLGGYHVPAGTIVGIHAYNVHRDER 

FFPDAETFDPDRFLPERTAENRHPYAYIPFSAGPRNCIGQKFALLEEKCLVSSILRRFR

IRSHRTRAEQLIVNELITRPKDGILLYLEEREW*

 

>CYP4C36 Anopheles gambiae CYPo3r2 512 aa AAAB01008984.1 

MLTGETVLLVQIALVVIALVPLAKWIKKRLNLHDVINKIPGPKAYPIIGTMYTFVGKKSE 

EIFYIIDKRTRDYPEIHRIWNGFVPEVRINKAEYVEKLLSSSRNIEKSMTYKFTRDWL

GQGLLTSK 

DDRWFQHRRLITPTFHFNILDGFCEVFAEHGALLVEKLATARAATSASQPINVYPFMTKAALDIIC 

ETAMGVKVNAQTSGMDNPYVAAVYD 

LSSLIQYRLLRPWLHTDFVWNRTAEGKRYHEVLAIVHGYAHK 

VIRERREERKQLRTQGKDGMAQDGERKRRLAFLDMLLESNEQNNLLTDNDVREEVDTFMFE 

GHDTTTAGMCWALFLLALHPDIQHQVHQEIDSIFGGSDRAPTMRDLNEMKLLERCLK

ETLRLYPSVSFFGRTLSEDIQFGHYHVPAGTVVGVHAYHVHRDER 

FFPDAEKFDPDRFLPERTENRHPYAYIPFSAGPRNCIGQKFALLEEKSVVSSILRRFTV

RSAKTRKEQLIQHELITRPKDGILLYFEPRS*

 

>CYP4C37 Anopheles gambiae CYPb1x2 548aa AAAB01008846.1

MAYGDSVLLTSSIGAGSNSWTRQQFIESVPKTSVLLLLSFIFIVCCLAAYLERYRRLVRH

INCIPGPATLPIIGNALLINADRE 

ELFNRIIASRKLYGRRQGITRIWNGMTPYVLISQAQAVE KILSSTKNIEKGRDYEFLQPWLGTGLLTSPASKWQHRRKILTPTFHFRILADFVEVFNK

QATVLVEKLAKELDNEAGFDCVRYITLCSLDIIC 

ETAMGCPVYAQRQSDSEYVRAHEK

IGEIMLNRLQKLWLHPDIIFRCTRQYREQQKCLDILHRFSYRMITERRSIIQTGSVVKQ ANTEDGLDANNNNCEGTGRKQLAFLDLLIEASDGGRILSDTDIREEVDTFILGGHDTTAT SISWTLFLLGTDPTVQERVVQEIECVMGDGGERWPTMRELNEMRYLEACIKEGLRLYPSI PIIGRRLTEDVRLADHVLPAGTNAVIVVYQLHRDPAVFPNPDRFNPDHFMVDASSSQEPR HPFAYIPFSAGPRNCIGQKFGALEAKAVLVAVLRQYRVEAVDRRENLTLYGELVLRSKDG 

LRIRITKRK*

 

>CYP4C38 Aedes aegypti 1.673_1 AAGE01009885 CYP4C38 4T1.4

MSELTTFIYGILVFLIFAPFLQWWVKRARLVQIIDKIPGPKAYPFIGTTYTFFGKKHYELFYIIDERTRRYPDIHRIWTG

MRPEIRISKPEYVETIIGASKHMEKSHGYDFLFDWLGEGLLTSKGERWFQHRKLITPTFHFNILDGFCDVFAEQGAVLAE

RLEPFANTGKPVDVFPFITKAALDIICETAMGVKVNAQTGGENNYVNAIYRMSEIFVDRSIKPWLHPEFIFKRTEYGRQH

KKALDIVHGYTKKVIRDRKEALQVKENSTGAGDTGEDLYFGTKKRLAFLDLLLEGNAKHKQLTDDDVREEVDTFMFEGHD

TTTAGMSWALFLLGLHPDWQDRVHQEIDSIFAGSDRPATMKDLGEMKLLERCLKETLRLYPSVSFFGRKLSEDVTLGQYH

IPAGTLMGIHAYHVHRDERFYPDPEKFDPDRFLPENTEHRHPFAYIPFSAGPRNCIGQKFAILEEKSIVSSVLRKFRVRS

ANTRDEQKICQELITRPNEGIRLYLEKRQ*

 

>CYP4C38 Aedes aegypti 4T1.4 84% to CYP4C36, 83% to 4C35,

82% to 4C27, 53% to 4T1.1

 DTFMFEGHDT TTAGMSWALF LLGLHPDWQD RVHQEIDSIF AGSDRPATMK

 DLGEMKLLER CLKETLRLYP SVSFFGRKLS EDVTLGQYHI PAGTLMGIHA

 YHVHRDERFY PDPEKFDPDR FLPENTEHRH PFAYIPFSAG PRNCIGQKFA

 

>CYP4C38 ortholog intact from CPIJ001810 + CPIJ018716, 78% to CYP4C38 Aedes

XM_001843432.1 with revisions, XM_001868893.1 (C-term)

MSEVTTLIYGGVLFALFTVFLPWLVKRVRYIQIIDRIPGPKAYPLIGTTHMFFGKKRHGE (0)

IFYVIDERTRRYPEIHRIWTGTRAEVRISKAEYVEAVIGGNKHIEKSEGYKFLGDWLGEGLLTSK (1)

GERWFKHRKLITPTFHFNILDGFCDVFAENGAVLADRLKPFADTGAPVDVFPFITKAALDIIC (1)

ETAM &

GVKVNAQTDGENEYVKAIYA (2)

LSELFLDRLVRPWLHNNYLFKRSEYGRKHQKAIDIVHGYTKK (0)

VIRDRKELLRRQRESNGEGIPAKPEDTGLGVKKRLAFLDLLLQGNEKSNQLSDDDVREEVDTFMFE (0)

GHDTTTAGMSWALFLLGLAPDVQKRVHQEIDSIFAGSDRPATMADLAEMKLLER

CLKETLRLYPSVSFFGRTLSEDITLGGYHVPAGTLLGVHAYHVHRDER (2)

FFPDAEKFDPDRFLPENTESRHPYAYIPFSAGPRNCIGQKFALLEEKSVISAVLRRYRVRSALTRDQQLINH

ELITRPKDGIRLYLEKRK*

 

>CYP4C40 Anopheles funestus AY648707

EVDTFMFEGHDTTTAGMSWALFLLALHPDVQEQVHQEIDSIFNG                      SERPATMQDLNEMKERCLKETLRLYPSVSFFGRTLSEDVTLGGYHVPSGTIIGIHTYN                      VHRDERFFPDAETFDRFLPENSERRHPYAYIPFTAGPRNCIGQ

 

>CYP4C41 Anopheles funestus AY648700

EVDTFMFEGHDTTTAGISWVLFLLALHPDVQERVYEEIESIFPT                      GDNRPATMQDLNELKLLERCIKEALRLYPSVSFFGRTLSEDIQLGGYHVPNQTIVGIH                      AYHVHRDERYYPEPEKFDPDRFLPENTENRHPYAYIPFTAGPRNCIGQ

 

>CYP4C43v1 Reticulitermes flavipes (termite) DQ279463.1

SAGMCWALYLLGLHPDVQEKAYQEQESIFQGSDRSVTMRDLSEMKYLEMVIKETLRLY

PSVPGVGRTLNEDVKMGEFTIPAGSMVHLHIYFLHRNPRHFSNPEKFDPDNFLPERVV

KRHPYAYI

 

>CYP4C43v2 Reticulitermes flavipes (termite) DQ279464.1

SAGMCWALYLLGLHPDVQEKAYQEQESIFQGSDRSVTMRDLSEMKYLEMVIKETLRLY

PSVPGVGRTLNEDVKMGEFTIPAGSMVHLYIYFLHRNPWHFSNPEKFDPDNFLPERVV

KRHPYAYI

 

>CYP4C44v1 Reticulitermes flavipes (termite) DQ279465.1

GAGISWTLFLLGLHPDVQEIAYLEQESIFQGSDRSVTMKDLNEMKCLERVIKETLRLY

PSVPVIGRILKKDVNIAGYDIPSGCTLIMHIYRVHRNPVQFPNPEKFDPDNFLPERVA

KRHPYAYI

 

>CYP4C44v2 Reticulitermes flavipes (termite) DQ279466.1

GAGISWTLFLLGLHPDVQEIAYLEQESIFQGSDRSVTMKDLNEMKYLERVIKETLRLY

PSVPVIGRILKKDVNIAGYDIPSGCTLIMHIYRVHRNPVQFPNPEKFDPDNFLPERVA

KRHPYAYI

 

>CYP4C45v1 Reticulitermes flavipes (termite) DQ279467.1

TSNISWTIQVLGMNQDIQDKVCEELQTIFQGSARPPTMTDLNEMKYLERVIKETMRLY

PPVPLIFRELTEDTEIGGYTIPAGVKIAIPILCLHRMAEHFPNPMKFDPDNFLPERMV

KRHPYSYI

 

>CYP4C45v2 Reticulitermes flavipes (termite) DQ279468.1

TSNISWTIQVLGMNQDIQDKVCEELQTIFQGSDRPPTMTDLNEMKYLERVIKETMRLY

PPVPLIFRELTEDTEIGGYTIPAGVKIAIPILCLHRMAEHFPNPMKFDPDNFLPERMV

KRHPYSYI

 

>CYP4C46 Reticulitermes flavipes (termite) DQ279469.1

GAGISWTLFLLGLHPDVQEIAYLEQESIFQGSDRSVNMNDLNEMKYLERVIKETLRLY

PSVPVIGRILKKDVNIAGYDIPSGCTLMMHIYRVYRDPIQFPNPEKFDPDNFLPERVA

KRHPYAYI

 

>CYP4C47 Reticulitermes flavipes (termite) DQ279470.1

SVGISWAMYLLGSHPEVQEKVAEELKGIFGDSDREATYEDLQQMKYLEQVIKEALRLF

PSVPGISRLLEVDVKIKNYTIPAGTQTPIFPFLIHRNPEVFPNPENFNPDNFLPEKVQ

NRHPFAYI

 

>CYP4C48 Reticulitermes flavipes (termite) DQ279471.1

SAGICWAIYLLGLHTDIQNKVSEELDHIFQDSDHSVTMKNLNEMKYLERVIKESLRLY

PSVPFIAREITQDIQLDEYTIPAGVIMTVPIYSIHRNPIQFPNPEKFEPDNFLPERVA

KRHPYAYI

 

 

>CYP4C50 Aedes aegypti 1.295_3 AAGE01102043.1 4C25 ortholog  80% to 4C25

MIEATVKSSFVLSKVAKMLSYFSPITIILATMIAGAIYVYNKRRARLVKLIEKIPGPA

SMPLIGNSLHINVDHDEIFNRI

ISIRKLYGRQQGFSRAWNGPIPYVMISKASAVEPILGSPRHIEKSHDYEFLKPWLGTGLLTSQGKKWHPRRKILTPAFHF

KILDDFVDIFQEQSAVLVQRLQRELGNEEGFNCFPYVTLCALDIVCETAMGRLIHAQKNSDSDYVKAVYQIGSIVQNRQQ

KIWLQPDFIFKRTEDYRNHQRCLSILHEFSNRVIRERKEEIRKQKQSNNNTINGNANNAVEANILDGNNNAEEFGRKKRL

AFLDLLIEASQDGTVLSNEDIREEVDTFMFEGHDTTSAAISWILLLLGAEPAIQDRIVEEIDHIMGGDRDRFPTMKELND

MKYLECCIKEGLRLYPSVPLIARKLVEDVQIEDYTIPAGTTAMIVVYQLHRDPAVFPNPDKFNPDNFLPENCRGRHPYAY

IPFSAGPRNCIGQKFAVLEEKSVISAVLRKYRIEAVDRRENLTLLGELILRPKDGLRIKISRRE.

 

>CYP4C50v1 Culex pipiens CPIJ017351 ortholog XM_001867494

2 aa diffs to partial seq CYP4C22v1

3 aa diffs to CPIJ018854

89% to CYP4C50 Aedes, 63% to CYP4C52, 60% to CYP4C51

MLEMEFVKSSFVLSRAAKVFTYFSPLTVILVSAILGAMFVYNRRRSRLVKMIEKIPGPAS

MPIIGNSLHINVDHDEIFNRIISIRKLYGRQQGFSRAWNGPMPYVMISKAAAVEPILSSP

KHIEKSHDYEFLKPWLGTGLLTSQGRKWHPRRKILTPAFHFKILDDFVDIFQEQSAVLVQ

RLERELGNREGFNCFPYVTLCALDIVCETAMGRLVNAQMNSDSEYVKAVYQIGGIVQNRQ

QKIWLQPDFIFKRTKDYRDHQRCLSILHEFSNRVIHERKEEIRKQKLSNNNSVEQAPAAD

GNNNAEEFGRKKRLAFLDLLIEASQDGTVLSHEDIREEVDTFMFEGHDTTSAAISWILLL

LGAEPAIQDRIVEEIDQIMGGDRDRFPTMKELNDMKYLECCIKEGLRLYPSVPLIARKLV

EDCVVQDYTIPAGTTAMIVVYQLHRDPAVFPNPDKFNPDHFAPENCRGRHPYAYIPFSAG

PRNCIGQKFAVLEEKSIISAVLRKYRIEAVDRRENLTLLGELILRPKDGLRIKISRRV

 

>Culex pipiens CPIJ018854 CYP4C50v2 ortholog XM_001869293.1

1 aa diff to partial seq CYP4C22v1

MLEMEFVKSSFVLSRAAKVFTYFSPLTVILVSAFLGAMFVYNRRRSRLVKMIEKIPGPAS

MPIIGNSLHINVDHDEIFNRIISIRKLYGRQQGFSRAWNGPMPYVMISKAAAVEPILSSP

KHIEKSHDYEFLKPWLGTGLLTSQGRKWHPRRKILTPAFHFKILDDFVDIFQEQSAVLVQ

RLERELGNREGFNCFPYVTLCALDIVCETAMGRLVNAQMNSDSEYVKAVYQIGGIVQNRQ

QKIWLQPDFIFKRTKDYRDHQRCLSILHEFSNRVIHERKEEIRKQKLSNNNSVEQAPNAD

GNNNAEEFGRKKRLAFLDLLIEASQDGTVLSHEDIREEVDTFMFEGHDTTSAAISWILLL

LGAEPAIQDRIVEEIDEIMGGDRDRFPTMKELNDMKYLECCIKEGLRLYPSVPLIARKLV

EDCVVQDYTIPAGTTAMIVVYQLHRDPAVFPNPDKFNPDHFAPENCRGRHPYAYIPFSAG

PRNCIGQKFAVLEEKSIISAVLRKYRIEAVDRRENLTLLGELILRPKDGLRIKISRRV

 

>CYP4C51 Aedes aegypti 1.295_2 92% to Aedes albopictus AY971511

MLKEPLLLVITIASQLLHAVKEFPLPATVLLGVVIVVYLFAHADRDQLKSLLRINGAKDGSKKSVKFYLNQLPGPQCIPL

LGNSLMMATDREDMFNRLTTARKLYGRKQGICRIWNGRTPYVLISKAEPVERILSSSVNIEKGRDYGFLRPWLGNGLLTC

PGSRWYKRRKALNPTFNYKMLSDFLEVFNRQAQTMVRLMEKELNRENGFNCTPYATLCSLDILCETAMGYPIQAQEQFGS

DYVKAHEEIGRIMLERLQKIWLHPDFIYKRTNFYKRQSECLKILHGFSENVIKQRRLQRDASLANKHDEDPSIEIGRKRQ

LAFLDLLLEATQDGQPLSDRDIRDEVDTFILGGHDTTATAIGWLLYLLGTDLQVQDRVFEEIDSIMGQDRDRPPTMIELN

EMKYLECCIKEALRLFPSIPLIARKLTESVNVGDYTIPAGTNAVIVVYQLHRDTQVFPNPDKFNPDRFLPENSQGRHQYA

YIPFSAGPRNCIGQKFGLLEEKAVAVAVLRKYRITSLDRREDLTLYGELVLKSKNGLRISISQRQ.

 

>CYP4C51v1 Culex pipiens CPIJ018944 ortholog 71% to CYP4C51 Aedes XM_001869166.1

small diference at the ETAM exon boundary

MDKLVLLTVLSQLLSLVREFPLVATAAFVGVLFFYVKTFGVGPPGKSLTQKSLKSARQYINELPGPACLPLLGNSLMMAT

DREDMFNRLIAARCLYGRQQGMTRVWNGPVPYVLVSRAAVVERILSSSVNIEKGRDYDFLRPWLGDGLLTAPAAKWYHRR

KALNPTFNYKMLSDFLGVFNKQAAVMARMLGKELGNGEGFDCTNYATLCSLDILCETAMGCSIHAQEQHESEYVKAHEEI

GQIMLYRLQNIWLHPDLVFRFTKYYKRQNECLRVLHSFSEQVIQQRRALRESAPADFEDSSEIGRKRQLAFLDLLIETTQ

NGKPLSDRDIREEVDTFILGGHDTTATAIGWLMYLLGTDAAVQDRLFEEIDSVMGQDRDREPSMIELNEMRYLDCCIKEA

LRLFPSIPLIARRLTEDVQVENYVIPKATNAVIVVYQLHRDAKVFPNPEAFNPDRFLPENCCGRHPYAYIPFSAGPRNCI

GQKFGALEEKAVMVAVLRKFRIESLDRREDLTLYGELVLRSKNGLRVRIAKRD.

 

>CYP4C51v2 Culex pipiens v2CPIJ018944 This seq missing a small (intron?) region near the N-term compared to CPIJ018944.  Aedes CYP4C51 has seq in this region so it is probably not an intron.

MDKLVLLTVLSQLLSLVREFPLVATAAFVGVLFFY                       YINELPGPACLPLLGNSLMMAT

DREDMFNRLIAARCLYGRQQGMTRVWNGPVPYVLVSRAAVVERILSSSVNIEKGRDYDFLRPWLGDGLLTAPAAKWYHRR

KALNPTFNYKMLSDFLGVFNKQAAVMARMLGKELGNGEGFDCTNYATLCSLDILCGNGGKTAMGCSIHAQEQHESEYVKA

HEEIGQIMLYRLQNIWLHPDLVFRFTKYYKRQNECLRVLHSFSEQVIQQRRALRESAPADFEDSSEIGRKRQLAFLDLLI

ETTQNGKPLSDRDIREEVDTFILGGHDTTATAIGWLMYLLGTDAAVQDRLFEEIDSVMGQDRDREPSMIELNEMRYLDCC

IKEALRLFPSIPLIARRLTEDVQVENYVIPKATNAVIVVYQLHRDAKVFPNPEAFNPDRFLPENCCGRHPYAYIPFSAGP

RNCIGQKFGALEEKAVMVAVLRKFRIESLDRREDLTLYGELVLRSKNGLRVRIAKRD.

 

>CYP4C52 Aedes aegypti 1.295_1 AAGE01029369 Hils Version? 72% to 4C26

MNHNIAAKIASLFSVLSPITTVILVVMVCAIITYKKKRARLVHHINRIPGPFMLPIIGNGLHVTLGCKDEFLDRVISAQK

MYGRRIGMSRAWNGPIPYVMISKASAVEPILSNPKLVEKSVDYDFMKPWLGNGLLTSRASVWHPRRKTLTPAFHFKILSE

FVNIFHKQALVMNEKLAEQLDNTAGFDIVPFTTLCALDIFCETAMGCPVNAQRNSDSEYVRAHKLIGKIIRNRLQKVWLR

PDFIFKHTEDYRKHHECLQVLHSFSDRVVQERKAEIVAKRRQAEDLIDLNNNNESEELTSCCRKKQLAFLDLLIEGSLDG

NGLTDLDVREEVDTFVIGGHDTTAAAMAWILLLLGSDQKIQDRVIDEIDGIMNGDRDRKPTMQELNDMKYLECCIKEGLR

LYPSIPLIARRLTEDVQVDDYIIPSGTTTLIVVYQLHRDPSVFPNPDKYNPDNFLPENCSGRHPYAYIPFSAGPRNCIGQ

KFAILEEKMVLSTVLRKFRIEAVERREDVKLLGDLVLRPRDGLKIRVSRRL.

 

>Culex pipiens CPIJ018943 CYP4C52v1 ortholog, XM_001869165.1

75% to CYP4C52, 62% to CYP4C50, 55% to CYP4C51

MDVHLVAAKIANLLSVLSPVTTIILVMIVGAYVTYRKRLAKLEYHINKLPGPYSLPLIGNGL

QVSLGSKDDFLDRVVSAQK

MYGRRIGLSRAWNGPFPYVLISKASAAEPILSNPRQVEKSADYDFLKPWLGNGLLTSPASIWHPRRKTLTPAFHFKILS

DFIPIFHRNALILAEKLEEQLGNRTGFDVVPLTTLCALDVFCETAMGIPVNAQRNSDSEYVRAHQLIGKIIRNRVQKFWL

QPDAIFKLTDEYRQHQECLQVLHSFSDRVIRDRHESLLKRRQAADLNNNNDPADDQPFRRKQLAFLDLLIEGALDGNGLT

LLDVREEVDTFVIGGHDTTAAAMAWLLLLLGTDQTIQERCFAEIDQIMGGDRDRMPTLHELNEMKYLELCLKETLRLYPS

IPMIARKLAEDVKIHNQYTIPAGTNVMIVVYQLHRDPAVFPNPEKFNPDNFLPENSAGRHPYAYIPFSAGARNCIGQKFA

VLEEKTVLSTILRKFRIEAIERREDVSLLGDLVLRPRDGLRIRVSRRV.

 

>Culex pipiens CPIJ019395 CYP4C52v2 XM_001869675.1

78% to CYP4C52 97% to CPIJ018943, missing N-term

MYGRRIGLSRAWNGPFPYVLISKASAAEPILSNPRQVEKSADYDFLKPWLGNGLLTSPASIWHPRRKTLTPAFHFKILSD

FIPIFHRNALILAEKLEEQLGNRTGFDVVPLTTLCALDVFCETAMGIPVNAQRNSDSEYVRAHQLIGKIIRNRVQKFWLQ

PDAIFKLTDEYRKHQECLQVLHSFSDRVIRDRHESLLKRRQTTDLNNNNADDDQPFRRKQLAFLDLLIEGSLDGNGLTLL

DVREEVDTFVIGGHDTTAAAMAWLLLLLGTDQTIQDRCFAEIDQIMGGDRDRMPTLHELNEMKYLELCLKETLRLYPSIP

MIARKLAEDVKIHNQYTIPAGTNVMIVVYQLHRDPAVFPNPDKFNPDNFLPENSAGRHPYAYIPFSAGARNCIGQKFAVL

EEKTVLSTILRKFRIEAIERREDVSLLGDLVLRPRDGLRIRVSRRV.

 

>CYP4C60 Nasonia vitripennis XM_001603426.1

MYLANKCLQWILDVKRFNILLMVLFTIFGWLILRWWQMKRRCWKYLAKIPGPF

SLPLIGNLVQLKVDHDE(1)LFSLIVGMRLMWGTQEGINKAWLGRKPYVFLSK

ASTVEQILGSNRHIDKSCDYKFLQPWLGTGLLTGSG(1)HKWYSRRKILTPTF

HFNILEDFVQVFGEQTEVLVRKMSSELGRPSFNIFPYVTLCTLDIICE(1)TA

MGRRISAQSHSDSDYVRAVYD(2)IGSIIQTRQASVFYQSNIFFRLSPLYKKH

QECIRILHQFSNE(0)VIKERRKEISESIREINGNEV(1)PKKRLAFLDLLIK

ASENGAILSNSDIREEVDTFMFE(0)GHDTTSSAVCWTLYLLGCHPEVQ(0)E

EVVNELEMIFSEGDYDRRPSLKDLKRMKYLDKCIKEALRLYPSVPILGREISE

DVEIG(1)GYTVPKGTTALVVLPVLHRDPEIFSNPEKYDPERFAAENMIGRHP

YSYIPFSAGPRNCIG(1)QKFALLEEKAIISGILRKFVVEATEQRDDISVTAE

LVLRTKSGLHLRIQPRMN*

 

>CYP4C61 Nilaparvata lugens FM163384

MKMITLILTSFALAIIVTYLVKLSYRRYQFLRKLKGLPGPKAYP              IVGDSLEMLYLKRNELMKMNSEKRELYKSIYLEWSGPFAEIHLLRPEYVEVALKSTVN

ITKSMAYDFLHDWLGTGLLTSSGRKWQERRKMITPAFHFGILEDFVEIFGEKSRTLVE

ILKKQKFGEEFDIYPMITNCALDIICESAMGTTVNAQEKKDSDYVRAVYEVSELILYR

ALRPWLYAEFIWKMSSHGKAFYRNLKTLHDFTNKVIVERREATSKKCSLNESDDGVGK

KKAFLDLLLEATENGHELSQADIREEVDTFMFEGHDTTAASIGWAIFLLGNNPEVQDR

VVEELNDIFGDSDRLATIHDLNDMKYLEMVIKETLRLYPSVPFIGRLVTEDMVVGEHL

IPAGVWVNIELFSVHRCRDHYSDPEKFNPDNFLPENTKSRHPFAYVPFSAGPRNCIGQ

KFALLEEKTILSSILRKFRVESTEKQEDICLMMDLVLRPESGVKIKMYPREQ

 

>CYP4C62 Nilaparvata lugens FM163385

MAKTANGSIKMDYTTTILSLVLFIFSALYLLRQAFRRIKIINMV              DQLPGPRAYPIIGNALDFMVPRSELMNVFDSRTKKYGPLFRTWAGPVPQIHITRPEHM

EIVMSSLKHIDKSKAYTFLQPGLGTGLLTGTGAKWHSHRKMITPTLHFKILDVFVEVF

GEKCQTLIENLLKKADGQEFDIYPFITHCALDIICETAMGTQINAQNESDSDYVRAIY

DISELTTERTTKPWLHSDLIWKSSKRGARYAHDLSILHGFTNRVISERKVARLADKER

IKNHEDDDEFLGKKKRMAFLDLLLEASELGQKLTDDEIREEVDTFMFEGHDTTTAGIC

WSLFMLGNHPEYQDQVAQELDQIFGDSNLPPTMKDLNEMKYLERVIKESLRLFPSVPF

IGRYLGEDTKFDNYIVPAGCVMNLQIFHVHRCPDQFPDPEKFNPDNFLPERTQGRHPY

AYIPFSAGPRNCIGQKFAVLEEKTVLSSILRNYRVESVEKLEDLNLMNELILRPESGI

RMRIYPRKKTQS

 

>Cyp4d1 D. melanogaster AC017770 49988-51720

MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKK

IFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLRFNDKAGEYKALEPWLKEGLL

VSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWIN

LCTMDTICETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARA

EKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP

LSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSY

ELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREEL

FSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD

FVGDSSEPPVLIAELILRTKEPLMFKVRERVY

 

>CYP4D1 D. pseudoobscura ortholog with one N-terminal exon

MFLLLGALLA SGLFVALLVY QLKFKRVIEV ISYMPGPPVL PLVGHGHHFI GKPPHELVKQ

ITEFMSKYAK DETLKVWLGP ELNVLMANPK DVEVVLGTMR FNDKAGEYKA LEPWLKEGLL

VSRGRKWHKR RKIITPAFHF KILDQFVDVF ENGSRDLLRN MEMDRLRQGQ TGFNLYDWIN

LCTMDTIC

ET AMGVSINAQT NADSEYVQAV KTISMVLHKR MFNIFYRFDL TYMLTPLARA

EKRALHVLHE FTEKIIVQRR EELIRGGSKD AAAASDDADA DVGAKRKMAF LDILLQSTID

EKPLTNLDIR EEVDTFMFEG HDTTSSALMF FFYNVATHPE AQKKCFEEIS SVIGQDKSTP

VTYELLNKLH YVDLCIKETL RMYPSVPLLG RRVVEECEI

N GKRIPAGTNI GISPLYLGRR

EELFSEPNSF KPERFDVVTS AEKLNPYAYI PFSAGPRNCI GQKFAMLEIK AIVANVLRHY

HIDFVGDTTE PPVLIAELIL RTKDPLLFKL QDRVY

 

>Cyp4d1 D. melanogaster alt. splice AC017770 48817-51720

MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGNAHIFLGLTPAEACLKIGELAE

RHGDTFGLFLGPSYSVMLFNPRDVERVLGSSQLLTKSQEYSFLGRWLNEGLLVSNGRKWH

RRRKIITPAFHFRILEPYVEIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICE

TAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLH

QFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERPLSNLDIREE

VDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYV

DLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREELFSEPNIFKP

ERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPP

VLIAELILRTKEPLMFKVRERVY

 

>CYP4D1 D. pseudoobscura ortholog with alternative splice exon 1

MWLSLVFGAVGTVLVLGLFSWLPFCRRRRRISELAELLPGPKPW

PLLGDAHLFFGLSPAEACLMMGQLAEKY

GDTFKLRLGPCFSVMFFHPSDVEQVLSSTQLVDKADEYDFLARWLNEGLLVSTGRKWHKR

RKIITPAFHFRILEQYVEIFDRQTHQFLSNLDLARGKDDNLVNLGHAVHLCALDVIC

ETAMGVSIN AQTNADSEYV QAVKTISMVL

HKRMFNIFYR FDLTYMLTPL ARAEKRALHV LHEFTEKIIV QRREELIRGG SKDAAAASDD

ADADVGAKRKMAFLDILLQSTIDEKPLTNLDIREEVDTFMFEGHDTTSSALMFFFYNVAT

HPEAQKKCFE EISSVIGQDK STPVTYELLN KLHYVDLCIK ETLRMYPSVP LLGRRVVEEC

EI 

NGKRIPAG TNIGISPLYL GRREELFSEP NSFKPERFDV VTSAEKLNPY AYIPFSAGPR

NCIGQKFAML EIKAIVANVL RHYHIDFVGD TTEPPVLIAE LILRTKDPLL FKLQDRVY

 

>Cyp4d2 D. melanogaster AC017770 comp(32267-34028)

MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKK

NQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGR

KWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDII

AETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAI

KVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED

IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGE

LKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPD

EFRPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR

HSMNIVLRSANGVHLGLKPRA

 

>Cyp4D2 D. pseudoobscura ORTHOLOG 79% TO 4D2

MLALVVFLVALTTVLVWDYFWRKRRNDILHYMPGPRGLPLVGNALMYRGLDAE

QIMGFVSKNRNKYGPLYKVWVLNQLAVFSTDPHDIEFILSSQQHITKNNLYELLHCWLGTGLLMSTG

KKWHSRRKIITPTFHFKILEQFVEIFDQQSAVMVGQLQQRADGKTAINIFSVVCLLALDIIA

ETAMGTKIQAQMSPNLPYVQAVTD 

VTNIMTTRFIHAWQRIDWLFRLVHPGMAKRQDSAIKVMHDFTENIIKQRRQALVSAGKQEKEKEEIK

EDDDLGQKRRMALLDVLLQSTIDGASLSNDDIREEVDTFMFEGHDTTTSAISFCLYEISRH

PQVQQLLVEEIHEVLGVDRHRPVTLRDLGELKYLENVIKESLRLHPPVPMIGRWFNEDVEI

RGKRIPAGTNYTVGIFVLLRDPEYFESPDEFKPDRFDSTSPQTHPYAYIPFSAGPRNCIG

QKFALLEMKSTISKLLRNFELLPLGPEPRPAMNIVLRSANGVHLGLQPRSVLAS*

 

>CYP4D3v1 Musca domestica (house fly) 73% to 4D10

4 aa diffs to CYP4D3v2

TSSAVTFCFYNLANYTECQQKCLEEIVQVLGKDKSKPVTIEDLNNL

HYLDLCIKETLRMFPSVPLLGRKVTEECEINGKIIPAGTNIGISPLQLGRLEELFPDP

DTFKPERFEAGYSTERLNPYAYIPFSAGPR

 

>CYP4D3v2 Musca domestica (house fly) Nannan Liu 7/20/06 EF615000.1

MAAAALINVLLCAGGLFTILSTIGLVLYLVKFKHMIDITNNLPSPPYLPIVGHGHHFAGK PPHENMYTIYEFASKYGPTFKVWLGTELNIWTSDLKDVEVILGTTRFNDKAHEYDMLEPW LKEGLLTSRGRKWNSRRKVLTPAFHFKILESFIDVFEKESRTLVANLDKEYRMQTDKGFD LNDWVNLCTLDTICETAMGVSVNAQTNADSEYVRAVKTIAMVLRKRMFDILCRFELTYRF TRLAREEKKALAVLHGFTEKVIVQRREELLKVQEAGKLDAADKDTGSKRKMAFLDILLQS QVDGKPLTNMDIREEVDTFMFEGHDTTSSAVTFCFYNLANYPECQQKCFEEIVQVLGKDK SKPVTFEDLNNLHYLDLCIKETLRMFPSVPLLGRKVTEECEINGKIIPAGTNIGISPLQL GRLEELFPDPDTFKPERFEAGYSTEHLNPYAYIPFSAGPRNCIGQKFAVLEIKTILSNVL RHYSVEYVGPGEEEIHLIAELILRTKDPLMFKIKPRVYY*

 

>CYP4D4v1 Musca domestica (house fly)

TTSGICFTLYLLSRHPGVQQKVLEEIHSVIGEDRNKPVTMKDLQEL

KYLDCVIKESQRLYPSVPTIGRVTEQDVVINGVTIPANTNITLLMYAAMKDPDYFPKP

EEFSPERFMNTEDKINPFAYVPFSAGPR

 

>CYP4D4v2 AF182170 housefly 4aa diffs to CYP4D4v1

FMFEGHDTTTSGICFTLYLLSRHPDVQQKVLEEIHSVIGEDKEK

PVTMKDLQELKYLDCVIKESQRLYPSVPTIGRVTEQDVVINGVTIPANTNITLLMYAA

MKDPDYFPKPEEFLPERFMNTEDKINPFAYVPFSAGPRNCIGQKFGS

 

>CYP4D4v2 EF615001 housefly Nannan Liu 7/20/06

MLFEFLAGLLTLLLVVDTLYKRRRHVMIAKAGIRGPTPLPLFGNMLHFVGNTTANAYDLF DKLTAKYGKVVRMWMGNHCVLFVRDAKFFEDIFKSQQLITKNNLYDLLSGWLGQGLLLST GPKWFSRRKIITPTFHFKILEEFVEIFDQQSHVMVKSLMEKADGKTVVHMFPKVCLMALD IITETAMGVKVHAQEHPEFPYAKAVTDTSNIMSDRFVKPFDRFDGYFRIFHNQKYHQLQN NIKIMHDFTDKVINERREALQKSIDSGTYQAGSSVDEMGIKKRMAFLDVLLQSTVGGKPL TNKDIREEVDTFMFEGHDTTTSGICFTLYLLSRHPDVQQKVLEEIHSVIGEDKEKPVTMK DLQELKYLDCVIKESQRLYPSVPTIGRVTEQDVVINGVTIPANTNITLLMYAAMKDPDYF PKPEEFLPERFMNTEDKINPFAYVPFSAGPRNCIGQKFAMAEMKSTVSKMVRHFELLPLG

EEVKPVMNMVLRSETDAQLGLRVRK*

 

>CYP4D5      Anopheles albimanus (mosquito) L38679

TTSAISFLLQSLAKNAAIQQKVFDEVRSIVGDDRTQPVTMAMLN

EVSYLDLVIKETLRLYPSVPMIGRKIHQTTEINGKIFPKGANVIIMPFFVGRNPKYYT

NPEQFDPERFNVETSAEKTNPYQYI

 

>CYP4D6      Anopheles albimanus (mosquito) L38680

TTSAISFLLSNLAKNPAIQQKVFDEVRNIIGDDRSRPVTMAMLN

DMHYLDLVIKETLRFYPSVPMFGRKMLDNNEINGKIFPKGSNVIILPFFMGRNPEFYP

DPEKFDPERFNVETSAEKTNPYQYI

 

>CYP4D7      Anopheles albimanus (mosquito) L38681

TTSAISFLFHSLAHNPHVQQKVFDEVRRIIGDDRTKPMTMAKLN

EMHYLELVIKETLRLYPSVPMFGRKMMENTEINGKIFPQGANVIFMSFFLGRNPKHFP

DPLVFDPERFNVETSAEKTNPYQYI

 

>Cyp4d8 D. melanogaster AC017388 comp(37292-39859) AC010557 AC010112 AC010113

MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGAMQLMLRLNPK

TFIKVGREYVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGK

VWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIA

ETAMGTKIYAQANESTPYAEAVNE

CTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIR

TMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIR

EEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELK

YMECVIKESLRMYPPVPIVGRKLQTDFKY

THSVHGDGVIPAGSEIIIGIFGVHRQPETFP

NPDEFIPERHENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR

VECIVNIVLRSETGFQLGMRKRKHN

 

>Cyp4d8 D. pseudoobscura 79%

MLLLVLVLLLVAVGWLVHRGQAERRRAVSNLPGPMCPPLLGALHIMSSMNPK

TFIKVSGENMRKYG

PLQRVWILNRLLIMSADSEINEQLLSSQEHLVKHPVYRVLGKWLGNGLLLSDGKV

WHQRRKIITPTFHFSILEQFVEVFDQQSNVCVERLAPRANGQTFDVYRPVCMAALD

IIAETAMGTKIHAQAAESTPYAEAVNE

CTALLSWRFISVYLQVELLFTLTHPYMKWRQTQLIRTMHDFTTKVIEERRRTLEEQQ

GSKLSPSPDDDVGRKRRMALLDVLLLATVDGRPLTNDEIREEVDTFMFEGHD

TTTSALSFCLHVLARHPQVQEKMLEEILRVIGTDRKRPVTIRDLNEMKYLECVIKESLRL

YPPVPLVGRKLQTDFKY

SHSKYGDGVIPAGSEFLIGIYGMQRNKNEFAQSEEFIPERHENGERFSPFTFIPFSA

GPRNCIGQKFAQLEMKMMLAKIVREYELLPLGEPVECVINIVLRSD

TGFQLGMRRRNDTQ*

 

>CYP4D10 Drosophila mettleri U91634

MSLSLPPLIAVACLVVALARISWLPLRSWLRRRRRTHQLAAQLP                      GPRNLPLLGNFHMFFGLEPWQVPHLINQLAKKYDGTFKLKMGSNFSLMMFQPRDIEVV                      LGSSQLLDKAVEYSFLRGWLNDGLLLSGGRKWHRRRKIITPAFHFRILESYDEIFDRQ                      TRLLIHKWQQTLGHSFDLGHDVHLFTLDVICETAMGVSTNAQTNADSDYVRAVKTIST                      VLHKRMFNIFYRFDLTYMLTPLAWAERRALNVLHKFTEKIIVQRREELLRGGVTQTTD                      GADVGAKSKMVFLDILLQSNIDDKPLTNLDIREEVDTFMFEGHDTTSSGITFFFYNIA                      LYPECQRKCVEEIVSVLGKDTETPVTYDLLNNLNYMDLCIKETLRMYPSVPLLGRKVL                      QECEINGKIIPAGTNIGISPLFLGRSEDISSEPNTFKPERFDVVTSAEKLNPHAYIPF                      SAGPRNCIGQKFAMLEIKAIAANVLRHYEIEFVGNAEESPVLIAELILRTKDPLMFKL

KKRVI

 

>CYP4D11 Ceratitis capitata AF028606

QRFAMLEVKSVVTNVLRHYAIDFVGNSTTEPILIAELILRTKDPLMFRLTPRVD

 

>CYP4D12 Ceratitis capitata AF028817

QKFAILEMKSTISKILRYYELLPFGEKMRPSMSIVMRSQNGSEMGLKPRVYK

 

>CYP4D13 Ceratitis capitata AF028818

QKFAVPEMKSTVSKMLRHFELLPLGEPVKPIMNLILRSTTGINIGLKPRVY

 

>Cyp4d14 D. melanogaster AC017770 35699-37438 missing intron 3

MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPK

TIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQKNNLYSLLVNWLGDGLLISQ

GKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAMD

IIAETAMGVKINAQLQPQFTYVQSVTT

ASAMLAERFMNPLQRLDFTMKLFYPKLLDKLND

AVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL

SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMK

LLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLIPADSNVIILIYHAQRDPDYF

PDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPL

GEEVQPVLNVILRSTTGINCGLKPRVY

 

>Cyp4d14 D. Pseudoobscura 79%

MFVELLVLLLTVALVWDYLVGRKHKRLFDRAGITGPKAWPLVGNAPLMINESPK

TVFDLQWRLIQTHGKNVRCQILQDRGFMTADPKMIEAIMSSQQTIQKNNLYGLLVNWLGDGLLLSK

GKKWFRRRKIITPAFHFKILEQFVEVFDQQSAIMAKNLYDRADGKTVINMFPVACLCAMD

IIAETAMGVKINAQLQPNFPYVQSVKT

ASGMLAERFVNPAQRLDISMRLFFPSAFAKLSA

NIKAMQDFTNNVISERRDLLQKSISDGTYETTNASPLDDVGQKRRMALLDVLLQSSIDGA

PLSNEDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVLGDEKDAPVN

IQLLGELKYLECVIKESLRLFPSVPIIGRHIVEDTLL

DGKLIPAKTDVMILIYHSQRDPDYFPEPNKFVPERFSPERKGEINPFAYTPFSAGPRNCIG

QKFAMLEMKSTISKMVRHFELLPLGEDVQLVLNLILRSTTGINVGLKPRVY

 

>CYP4D15 Anopheles gambiae CYPe2r3 , 522aa AAAB01008859.1 

MWPIIVSGTALLLSIAIWWTVANFGSALRYAGKLGGPVAYPLVGNGFLFINKTPA 

EFLQLLGRLIAQYGKCLRVWLGTQLIVLITDPKDIE 

ILLSSPKYIEKSSEYDFV

RPWLGEGLLISSGRKWQTHRKIITPTFHFKILEEFMDIFDQQGNTFVDILHLFAKSGETF

DVFPLVTLCALDVIC

ESAMGTKVNAQMNSESEYVKAVKE 

ITNLIQLRIYDFVIRYEFFFRLSANRRRQRKALAILHGYTDSVIRTRRQELN

ERGAGHNDVPEEDVLGRKKRMAFLDMLLQSTVDGRPLTDLEIREEVDTFMFEGHDTTTSA ISFMLHSLAQNPDVQEKAFNEVRNIVGDDRKQPVTMAMLNDMHYLDLVIKETLRLYPSVP 

LFGRKMLQNTEIN 

GKIFPAGSNVIVLPFFMGRDPDCFANPEKFDPE

RFNVERSAEKTNPYQYIPFSAGPRNCIGQKFAVTELKSLVSKVLRNYELLPPEQVREETF

IAELILRPEHGIPIRVKQRVY*

 

>CYP4D16 Anopheles gambiae CYPe2r5, 510 aa AAAB01008859.1 

MFVATLTLLALIASVAFYVYVERFSKILKHSGKLGGPRAYPLIGNGLLFAGKTPA 

EFLQTVGRLIQQYGKCFRIWLGTQMLIVITEPKDVE 

AILSSNKYIDKSIEYDFIRPWLGEGLLTSTGRKWHTHRKVITPTFHFKILEQFVEIFD

QQSSTFVQVLAAHAKSGDTFDIFRPVTLCALDVIC 

ETAMGTKVNAQLNTESEYVQAVKD  10470977 10470907 ITNLVQIRLFNFLIRYEIFYRFSANRRKQLEALKVLHGYTDSVIKIRREELNRAAGSG    KNTVVDENENELGIKKKMAFLDMLLQSKIDGRPLTDLEIREEVDTFMFEGHDTTTSAISF  LLQNLAKHPAIQQKVFDEVRNVVGDDRTRPVTIAMLNDMHYLDLVIKETLRLYPSVPMFG 

RKMMEDAEI   

NGKVFPAGSNTIILPFFLGRNPEFFPNPEKFDPERFNVETSAEKTNPYQYVPFSAGPRNC

IGQKFAVAEIKSLVSKLLRNYEILPPVGRYDETFIAELILRPEKGIYVRLQPRVY*

 

>CYP4D17 Anopheles gambiae CYPe2r4, 508 aa AAAB01008859.1

MVYSTLAVLLALGSLAAVYLYRRFGEMLKHTGKLGGPPAYPILGNGLMFLNKSPA 

DFLRIIGELLQRYGDCFRVWLGTQLVIVMGDPKDIE 

VLLSSPKYIDKSTEYDFIRPWLGEGLLTSRGRKWHTHRKVITPTFHFKILEQFVEIFDR

QSSTFIKVLEPFAASGKSFDIFPQVTLCALDVIC 

ESAMGTKVNAQINSTSDYVLAVKE 

ITNLIQLRFYDFLIRYDIFFRLSANARKQRKVLQVLHSYTDSVIKGRRQQLASIQQSGEQ EEASDQDLGIKKRMAFLDMLLQSTIDGRPLTDLEIREEVDTFMFEGHDTTTSAISFLLHS LAQNPTIQEKVFDEVRNVVGDDRTRPVTMAMLNDMHYLDLVIKETLRLYPSVPMIGRKMQQTAEI NGKIIPAGANLIIMPFFLGREARYFPEPEKFDPERFNVERSAEKTNPYQYIPFSAGPRNC IGQKFAVAELKSLVSKVLRHYEILPPTGKQDESFIAELILRPEHGVFVRLKPRAY*

 

>CYP4D18v1  Culex pipiens AF190775

TTSAMSFILGILAKHPEVQKKAYDEVRNVFGDDPSKPATLAMLN

ELNYLDMVIKETLRLYPSVPMFGRKMLENHDIGKFWQRNAVLLVKLNAPKPLPYGTIF

PAGSNVIVMPYIMGRDPEYFDDPLEFRPERFAVETSAEKSNPYRYV

 

>CYP4D18v2  Culex pipiens AF191728           

TTSAMSFLLGVLAKHPEVQKKAYDEVRNVFGDDPSKPATLAMLN ELNYLDMVIKETLRLYPSVPIFGRKMLENHDIGKFWHRNAVLLVKLNAPKPLPDGTIF PAGSNVIIMPYIMGRDPDYFDDPLEFRPERFAVETSAEKSNPYRYV

 

>CYP4D19v1  Culex pipiens AF190786

TSGVSFTLYNLAKYPTIQQKVHDEIIAVLGTDPHKPVTMATLNE LTYLEMVIKETLRLFPSVPIIGRKCVEEVTIEGKTVPAGTNIIIGIYYMGRDANYYDN

PLEFIPERFEGEKSVEKFNPYKYV 

 

>CYP4D19v2  Culex pipiens AF190789

TTSGVSFTLYNLAKYPAIQQKVHDEIIAVLGTDPHKPVTMATLN ELTYLEMVIKETLRLFPSVPIIGRKCVEEVTIEGKTVPAGTNIITGIYYMGRDANYYD

NPLEFIPERFEGEKSVGKFNPYKYV 

 

>CYP4D19v3  Culex pipiens AF190777

TTSGVSFTLYNLAKYPTIQQKVHDEIIAVLGTDPHKPVTMATLN ELTYLEMVIKETLRLFPSLPIIGRKCVEEVTIEGKTVPAGTNIIIGIYYMGRDANYYD

NPPELIPERFEGEKSVEKFNPYKYV

 

>CYP4D19 Culex pipiens CPIJ009477 XM_001851373

4 aa diffs to CYP4D19v1 Culex pipiens partial PCR fragment

5 aa diffs to CYP4D19v2 Culex pipiens partial PCR fragment

7 aa diffs to CYP4D19v3 Culex pipiens partial PCR fragment

MQYDFVNLIQKLTDDYGDVVRFWMGPQFTIYTGNPKWIEAILTNRNLTNKSDEYGFLSNWLGDGLLLSKRHKWHARRKII

TPAFHFKILDQFVEVFDRNAAELVDVLGKFAANGKTFDVFPYILLYTLDVICETAMGTSVDAMRNSDSEYVKAVKEAASI

SITRMYDVYMRTPLFYLTPGYQKLRKAIKMLHAYTDNVIVSRRKQLEASSNQSAEVASEEHEYGGKKKEAFLDLLLKTSI

EGRPLTNLEIREEVDTFMFEGHDTTTSGVSFTLYNLAKYPAIQQKVHDEIIAVLGTDPHKPITMANLNELTYLEMVIKET

LRLFPSVPIIGRKCVEEVTIEGKTVPAGTNIIIGIYYMGRDPNYYDNPLEFIPERFEGEKSVEKFNPYKYVPFSAGQRNC

IGQKFALNEVKSVISKLLRHYEFVLPADQNHEPPVLSSELILKPHHGIPLQIKPRAPLTH.

 

>Cyp4d20 D. melanogaster AC019509 comp(19731-21636)

MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAE

NIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVST

GRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVIT

EAAMGVQVNAQNDPDFPYIKALKS

VVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPL

SLGDAEIGSKSQMALLDILLQSSINNQP

LSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQ

AQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANY

FPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLP

LGEELKPMLNFILRSASGINVGLRPRKALR

 

>Cyp4D20 D. pseudoobscura ORTHOLOG 74% TO 4D20

MLLLTLAFGALAVLLTWDFVRKRQRAATLERSKISGPLSLPVLGNGLQALDLGAE

NIVDWVEESFRLYGKTFRMWILGESLIYTKDLKYFEAILGSTTLLQKGQLYKFLRPFLNDGLLLSV

GKKWHARRKVFTNAFHFNVLGHYVDIMDRQAAVMVEKLRQVADGETTVDMLPYVSLAALDVIT

EAAMGVQVNAQSDSEFPYVQALKS

VVYIQSDRMFRFLQRYDWLFRLTCPVLRSKLLKDVRVMHDFTDKVIRERRAAVEQAKADGSYRPL 

SLGDPEVGRKSQMALLDILLQATIEGQP

LSDADIREEVDTFMFEGDDTTSSGVSFALYAIARHPQVQARIYRELLQVLGRDPSTPVTQ

AKLQELKYLDCVIRETLRLYPAVPAVGRYTSKEIQIGGQTIPANTSIYLVLYFAHREAEF

FPDPLAFKPERFLDRADSEDRETFAYLPFSAGPKNCIGQKFAMLEMKALVSKVLRCYELL

PRGPEVKPMMNFILRSSTGMNVGLRPRRSP*

 

>Cyp4d21 D. melanogaster AC020004 55466-57280

MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPE

NFIQRFGDYFNKYGKTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLLST

GNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALDVTT

ETAMGVQVNAQNEPNFPYTKALKS

VVYIESKRLASVSMRYNWLFPLAAPLVYRRLQK

DIAIMQDFTDKVIRERRAILERARADGTYKPL

IMGDDDIGGKAKMTLLDILLQATIDNKP

LSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQ

TKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEY

FPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELL

PLGADLKATYTFILSSSTGNNVGLKPRTRVK

 

>CYP4D22 Anopheles gambiae CYPe2r6, old short CYP4H20 is same sequence

MVVVVQIGLALLVVILTINYLLVRQNIKYGRHIPGPVPLPIVGCFYLYINLKPE        DIIDFVSDLRKRYGNLFRVWIGNRLALFCTNVKYNETVLSSQKLIRKSELY           KFLIPWLGDGLLLSTGQKWFGKRKILTPAFHFKILDQFIEVFHKQSSILADRLRPEANGQ LVNIYPFVTLAALDIICETAMGTSINAQTDADSAYVKAITELSLVLTGRFVKVWQRVDFL  FNLSPDKRRQDRIIKVLHDFTTKIIQSRRRELMEQGGGGGGTVEDDDMADLGTKRRMAFL  DVLLQATIDGRPLTDREIQEEVDTFMFEGHDTTTIAISFTLLLLARHPEVQERVYREVVA  IVGNDPATPATHRNLQDMKYLELVIKESLRLYPPVPIIARRFTENVEL              GGKIVPEGSNFNIGIMHMHRDPTLFPDPERFDPERFAPDRTMEQSSPYAYVPFSAGPRNCI GQKFAMLELKSTVSKVIRHFKLTAAGPEPKLTMQLTLK

PRDGLYIGFVPRR* 

 

>CYP4D23 Aedes aegypti 1.283_3 CYP4D23v2 4T1.3

MSILDWILVITGAVLAINYLLVRRNLKYQSQWPGPAAVPLIGCYYLYFNKKPEDVMDFIFTLSRKYGTMFRVWVGTRLAL

FCTNTPDTETVLSSQKLIRKSELYKFLVPWLGNGLLLSTDQKWFNKRKIITPAFHFKILEQFIEVFDRQSGILVQKLKPE

ASGKLVNVYPYVTLCALDVICETAMGTPINAQTDVDSKYVRAVTELSYLLTTRFVKVWQRSDFLFNLSPDRKRQDKVIKV

LHDFTTNIIQKRRKELMDHGDSGISGDDSIGSKKKMAFLDVLLQASVDGKPLTDKEIQEEVDTFMFEGHDTTTIAIAFTL

LLLARHPEVQEKVYKEVTEIIGTDLSIPATYRNLQDMKYLEMVIKESLRLYPPVPIIGRKFTEKTTIGGNVIPEDSNFNL

GIIVMHRDPKLFDDPEKFDPERFSPERTMEQSSPYAYIPFSAGPRNCIGQKFAMLELKSTLSKVIRNYRLTEAGPEPQLI

IQLTLKPKDGLKIAFVPRA.

 

>CYP4D23v1 Aedes aegypti 4T2.8 CO635936.1

80% to 4D22, 99% to 4T1.3 1 diff, 98% to 4T1.1

DTFMFEGHDT TTIAIAFTLL LLARHPEVQE KVYKEVTEII GTDLTTPATY

RNLQDMKYLE MVIKESLRLY PPVPIIGRKF TEKTTIGGNV IPEDSNFNLG

IIVMHRDPKL FDDPEKFDPE RFSPERTMEQ SSPYAYIPFS AGPRNCIGQK

F

 

>CYP4D23v2 Aedes aegypti 4T1.3 CO635937.1

80% to CYP4D22, 99% to 4T2.8 1 diff

TFMFEGHDTT TIAIAFTLLL LARHPEVQEK VYKEVTEIIG TDLSTPATYR

NLQDMKYLEM VIKESLRLYP PVPIIGRKFT EKTTIGGNVI PEDSNFNLGI

IVMHRDPKLF DDPEKFDPER FSPERTMEQS SPYAYIPFSA GPRNCIGQKF

A

 

>CYP4D23v3 Aedes aegypti 4T1.1 CO635938.1

79% to CYP4D22, 98% to 4T1.3 2 diffs

DTFMFEGHDT TTIAIAFTLL LLARHPEVQE KVYKEVTEII GTDLSIPATY

RNLQDMKYLE MVIKESLRLY PPVPIIGRKF TEETTIGGNV IPEDSNFNLG

IIVMHRDPKL FDDPEKFDPE RFSPERTMEQ SSPYAYIPFS AGPRNCIGQK

FA

 

>CYP4D24 Aedes aegypti 1.283_7 AAGE01006231 CYP4D24 4T2.6

MLILLASVVVLSIGLAVYFYQQFANRLHYAAKIGGPKGYPLLGNSIQYGTKSPVEFLQEVQKTNEQCGKFYRLWIGPDLI

FPITDAKLAILSSQKLLDKSVQYDFIRPWLGNGLLTSTGRKWHSRRKIITPTFHFKILEQFVEIFDQQSNIFVGQLKSKA

QSGEDFDVFPVVTLCALDVICESAMGTKVNAQLNSDSKYVRAVKDMATVAMARSFKAFARFNFTFYFTPYRRMQDKALKV

LHDYTDSVIRSRRLELAKGAFTKSDENENDVGIRKKVAFLDMLLQATVDGRPLDDLEVREEVDTFMFEGHDTTTSAISFL

IGILAKHPDVQQKVYDEVRNVIGDDLNVSVTLSMLNQLNYLDLVIKETLRLYPSVPIYGRMLLENQEINGTVFPAGSNLA

IFPYFMGRDPEYFENPLEFRPERFAVETSAEKANPYRYVPFSAGPRNCIGQKFAVAEIKSLISKLVRHYEVLPPKQPNSE

RMIAELVLRPEGGVPVRIRSRVR.

 

>CYP4D24 Aedes aegypti 4T2.6 CO635939.1

75% to 4D16, 56% to 4T1.6

DTFMFEGHDT TTSAISFLIG ILAKHPDVQQ KVYDEVRNVI GDDLNVSVTL

SMLNQLNYLD LVIKETLRLY PSVPIYGRML LENQEINGTV FPAGSNLAIF

PYFMGRDPEY FENPLEFRPE RFAVETSAEK ANPYRYVPFS AGPRNCIGQK

FA

 

>CYP4D25_Contig5 Anopheles funestus AY648701.1

94% to 4D22 56% to contig8 53% to contig10 probable ortholog of 4D22

793 EVDTFMFEGHDTTTIAISFTLLLLARHPEAQEKVYQEVVDIVGNDPYTPLSHRNLQDMKY 614

613 LEMVIKESLRLYPPVPIIARRFTENVELG 527 (1)

463 EKIVPEGSNFNIGIMHMHRDPTLFPDPERFDPERFAPDRTMEQSSPYAYVPFSAGPRN 290

289 CIGQ 278

 

>CYP4D26_Contig8 Anopheles funestus AY648702.1

85% to 4D15 78% to contig 10

284 EFRIEVDTFMFEGHDTTTSAISFILLCMAKNPEIQEKVFNEVRNVVGDDRKQPVTMAMLN 463

464 DMHYLDLVIKETLRXYPSVPMFGRKMLQNTEINGKIFPAGSNVVMFPFFLGRDPDYFPNP 643

644 EKFDPERFNVETSAEKTNPYQYVPFTAGPRNCIGQ 748

 

>CYP4D27_Contig10 Anopheles funestus AY648703.1

86% to 4D17 78% to contig 10 possible ortholog of 4D17

79% to 4D16 and 80% to 4D15

242 EVDTFMFEGHDTTTSAISFLLLSLAKNPDIQQKVFDEVRNIVGDDRTRPVTMPMLNDMHY 421

422 LDLVIKETLRLYPSVPLIGRKMLQTTDI 511 (1)

578 NGKTFPAGANLIIMPFFLGRDERYFPDPERFDPERFNVERSAEKTNPYQYIPFYRRP 748

 

>CYP4D35 Musca domestica (house fly) DQ642007.1

MYFAVVLLVLFILICVWAFHIHISTKYRRKLTDHIPGPYCYPIVGCVGEATTLTPKRLLA

KSYEVNELYGNIIKGWILNSLFIFTSNVEFMEQILSHTTQTRKSRLYSILKPWLGESLLL

SKEQKWHTRRKIITPTFHFSILEQFLKVFDRQTLVLIDCLAERADGRSAFDVMPYICSAA

LDIITETAMGVNVNAQTDKTMPYTMAVREMTNLVMWRFLRAYLNDERLFSILCPLKKLRQ

TTLIKTMHKFTGNVIEKRRRELENYMESESRHDDHDPDDIGIRKHRAFLDVLLQATIDGE

PLADEDIREEVETFMFEGHDTTTTALSFTXXXXXXX

PEVQQKLLAEIYAIFGEKSVEPFTLAKLSDL

KYMECVIKESLRLYPPVPLIGREITEDFPYTHSVIGDGIVPASTQFVISIFHALREPSVY

DRPLEFIPDRHKEASVNSPFIFVPFSAGPRNCIGQRFAMFEMKVVLCKILREYELLPLGD

DVEPIFGIVLRSDNGIQLSMRRRSAS

 

>CYP4D36 Musca domestica (house fly) DQ642008.1

MVCFAIVLLVLFIAICVWALQIHISTKYRRKLTDRIPGPFCYPILGCVGEATTLTPKRLI

SKSFEMYELYGHTIKVWILDKLFILTSTADFMEQILSHPTQTRKIRLYNIIKPWVGEGLL

LSGEKKWYTRRKIITPAFHFSILEKFLEVFDRQTSVLMDCLAERADGKTAFDVMPYICSA

ALDIITETAMGVDVNAQTDKTMPYTMAVREMSGLITWRLVRAYLHDEWLFSILCPLKKLR

QTKLITTMHKFTRNVIEKRRRDLEKYIKSDINMENYDPDNIGIRKHKALLDLLLQATIDG

NPMSDEDIREEVDTFMSAGHDTTTTALSFTLYLVSRHPEVQQKLLDEIHAIFGEKSVEPF

TPAKLSDLKYMECVIKESLRLYPPVPFIGREITEDFRYS

 

>CYP4D37 Aedes aegypti 1.283_4 AAGE01019344 82% to

AAGE01055570 same seq as AAGE01019344.1

MWIYLSLLTVGFVAVVIYRKFARTLEVAQQYAGPPALPILGNGLWFLNKQPD

EFLPIIHKLTSTYGDVVRFWQGPQFTLYVGNPSMIEILTNKHLTDKSGEYDYLSNWLG

DGLLLSKRHKWHARRKAITPAFHFKILEQFVDVFDRNAAELVDVLEKHADDGKTFDMF

PYVLLYALDVICESAMGTSVNALRNADSEYVRAVKEAAHVSIKRMFDIIRRTSLFYLT

PSYQKLRKALKVLHGYTDNVIVSRRNQLMSKTDSGGVSDEFGAKKKDAFLDMLLRTSI

NGKPLTNLEIREEVDTFMFEGHDTTTSAVVFTLFNLAKHPEIQQKVYDEIVSVIGKDP

KEKIELSHLHDLSYTEMAIKETLRLFPSVPLIGRRCVEEITIEGKTIPAGANIIVGIY

FMGRDPKYFENPSHFIPERFEGEFSVEKFNPYKYIPFSAGPRNCI

GQKFALNEMKSVISKLLRHYEFILPPDSVEEPPLASELILKPHRGVPLQIRHRALN*

 

>CYP4D38 Aedes aegypti 1.283_5 AAGE01055570 100% but N-term does not match

MWFLLSLVAAACLAWAIYRKFARTLEISGQHTGPPALPILGNGLWFLNKQPDEFLPI

IQRLTDEYGDVFRFWQGPEFTLY

VGRPSMIETLLTDKNLTDKSGEYGYLSNWLGDGLLLSKRNKWHARRKAITPAFHFKILEQFVDVFDRNASELVDVLGKHA

DSGEVFDIFPHVLLYALDVICESAMGTSVNALRNADSEYVRAVKEAANVSIKRMFDFIRRTPLFYLTPSYQQLRKSLKVL

HGYTDNVITSRRKQLSNSSNKNHKDSDDFGFRRKEAFLDMLLKTNINGKPLTDLEIREEVDTFMFEGHDTTTSAVVFTLL

NLAKHPAIQQKVYDEIESVIGNDLQKPIELSDLHDLSYLEMVIKETLRLYPSVPLIGRRCVEETTIEGKTIPAGANIIVG

VFFMGRDPNYFEKPLDFIPERFSGEKSVEKFNPYKYIPFSAGPRNCIGQKFALNEMKSVISKLLRHYEFILPAGSPAEPL

LASELILKPHHGVPLQIRRRGH.

 

>CYP4D39 Aedes aegypti 1.283_6 AY431801 64% to 4D24

MFLLVTVFFAVVSLAVFVYQKFANQLYYGAKIGGPKCYPLVGNAFRFINKSPPDFFLTIERTVREAGKCFRLWLGPELLI

IVTDAKVAEGVLSSPKFIEKSGEYNFIRPWLGDGLLTSSYRKWHSHRKIITPTFHFKILEQFVEIFDSQSNILIDKLTPF

MESGETFDVFPLVTLCALDVICESAMGTKVNAQIHSDSEYVQAVKEITTIIHIRTYDVLARYDFLFNLSSYRKRQDKVLE

VLHGYTNSVIRSRRRELSDAKEANPDNNATSELGIRRKVAFLDMLLQATVDGRPLTDVEIREEVDTFMFEGHDTTTSAIS

FLLYRLAKHPEVQHKVYDEIKAVIGEGMTGPVTLSMLNELHYLELVIKETLRLYPSVPFYGRKVLENSEIEGTTFPAGSN

LILMPMFMGRDPEYFDDPLEFRPERFEKEISAEKVNPYRYIPFSAGPRNCIGQKFAMAELKSVASKVLRHFEVLPPEGGQ

EESFIGEMILRPTYGVLLRLKKRQ*

 

>CYP4D40 Culex pipiens CPIJ009474 99% to CYP4D40 Culex_quinquefasciatus

XM_001851370 3 aa diffs to CYP4D18v2 Culex pipiens partial PCR fragment

MAIWLLSILAIVFAVGVHLYQKFANLVHYGSKITGPKAYAVVGNAARFFSMTPAEFLQEVHRLSKEWGKCFRIWLGPDLL

IVVTDAKKVETVLGSQKYLDKSTEYDFIRPWLGDGLLTSSGRKWHSRRKIITPTFHFKILEQFVEIFDQQSTVFVDQLKP

MAASGEPFDVYPRVTLCALDVICESAMGTKVNAQLNADSEYVRAVKAMSNVAFQRTYKILARLELTFKYTSYAQIQEKAL

AVLHGYTDSVVKNRRKELTKSNGDHNQNNVNDNDVGQRKKVAFLDMLLQATTTDGQPLTDLEIREEVDTFMFEGHDTTTS

AMSFILGVLAKHPEVQKKVYDEVRNVFGDDPSKPATLAMLNELNYLDMVIKETLRLYPSVPIFGRKMLENHDIDGTIFPA

GSNVIIMPYIMGRDPDYFEDPLEFRPERFAVETSAEKSNPYRYVPFSAGPRNCIGQKFAVAEIKSLVSKTLRHYEILPDT

LAPPEKLLVELILRAENGVTLRLKKRN.

 

>CYP4D40 Culex_quinquefasciatus_02

5 aa diffs to XM_001851370, 84% to 03, 67% to 4D24 Aedes

96% (5 aa diffs out of 127) to CYP4D18v2 AF191728 Culex pipiens

MAIWLLSILAIVFAVGVHLYQKFANLVHYGSKITGPKAYAVVGNAARFFSMTPAEFLQEVHRLSKEWGKCFRIWLGPDLLIVVTDAKKVETVLGSQKYLDKSTEYDFIRPWLGDGLLTSSGRKWHSRRKIITPTFHFKILEQFVEIFDQQSTVFVDQLKPMAASGEPFDVYPRVTLCALDVICESAMGTKVNAQLNADSEYVRAVKAMSNVAFQRTYKILARLELTFKYTSYAQIQEKALAVLHGYTDSVVKNRRKELTKSNGDHNQNNVNDNDVGQRKKVAFLDMLLQATTTGGQPLTDLEIREEVDTFMFEGHDTTTSAMSFLLGVLAKHPEVQKKVYDEVRNVFGDDTSKPATLAMLNELNYLDMVIKETLRLYPSVPIFGRKMLENHDIDGTIFPAGSNVIVMPYIMGRDPDYFENPLEFRPERFAVETSAEKSNPYRYVPFSAGPRNCIGQKFAVAEIKSLVSKTLRHYEILPDTLAPPEKLLVELILRAENGVTLRLKKRN

 

>CYP4D41 Culex pipiens CPIJ009473 XM_001851369

99% to CYP4D41 Culex_quinquefasciatus,

6 aa diffs to CYP4D18v1 Culex pipiens partial PCR fragment

MALLLVLISVAIAVTIVVYQKFANLVQYGSKVAGPKAYPVVGNAIRFLSLTPAGFLEELHALSKEWGKCFRIWLGVDLLI

FLMDARKVETILSSQKFLDKSIEYDFIRPWLGDGLLTSSGRKWHSRRKIITPTFHFKILEEFVEIFDQQSTVFVDQLKPM

AASGEPFDVYPRVTLMALDVICESAMGTKVNAQLNAYSEYVRAVKAMTNIVIVRAFKILARLDFTFKYTSYAKIQKQALA

VLHGYTDNVIHSRRKELAKTHSQNDFSENDVGQRKKVAFLDMLLQATTTDGQPLTDLEIREEVDTFMFEGHDTTTSAMSF

LLGVLAKHPEVQKKVYDEVRNVFGDDPSKPATLAMLNELNYLDMVIKETLRLYPSVPMFGRKMMENHDIDGTIFPAGSNV

IVMPYIMGRDPDYFEDPLEFRPERFAVETSAEKSNPYRYVPFSAGPRNCIGQKFAVAEIKSLVSKTLRHYEILPDTSEEP

EKLYSEATLKNEKGVILRLKKRSFGIFTSK*

 

>CYP4D41 Culex_quinquefasciatus_03

5 aa diffs to XM_001851369

60% to CYP4D16 Anoph. 66% to 4D24 Aedes

96% (5 aa diffs out of 127) to CYP4D18v2 AF191728 Culex pipiens

MAFLLVLILVAIAVTIVVYQKFANLVQYGSKIAGPKAYPVVGNAIRFLSLTPAGFLEE

LHALSKEWGKCFRIWLGVDLLIFLMDARKVETILSSQKFLDKSIEYDFIRPWLGDGLL

TSSGRKWHSRRKIITPTFHFKILEEFVEIFDQQSTVFVDQLKLMAASGEPFDVYPRVT

LMALDVICESAMGTKVNAQLNADSEYVRAVKAMTNIVIVRAFKILARLDFTFKYTSYA

KIQKQALAVLHGYTDNVIHSRRKELAKTHSQNDFSENDVGQRKKVAFLDMLLQATTTD

GQPLTDLEIREEVDTFMFEGHDTTTSAMSFLLGVLAKHPEVQKKVYDEVRNVFGDDPS

KPATLAMLNELNYLDMVIKETLRLYPSVPMFGRKMMENHDIDGTIFPAGSNVIVMPYI

MGRDPDYFEDPLEFRPERFAVETSAEKSNPYRYVPFSAGPRNCIGQKFAVAEIKSLVS

KTLRHYEILPDTSEEPEKLYSEATLKNEKGVILRLKKRSFGIFTSK

 

>CYP4D42 Culex pipiens pallens CB074945.1

GRGNSIEVDTFMFEGHDTTTIAITFTLMLLAKHPDIQEKVYQEVTEIIGKDLNAPTTYRN LQDMKYLELVIKESLRLYPPVPIIGRKFTEKTEIDGKVVPEDSNFNVGIILMHRDPTQFE DPERFDPERFSPERTTELSSPYAYIPFSAGPRNCIGQNH

 

>CYP4D42v1 Culex pipiens CPIJ009478 XM_001851374

1 aa diff to CYP4D42 Culex pipiens pallens partial fragment

1 aa diff to CPIJ020229 from TWFS to end, cyan parts do not match

missing correct N-term, compare to CPIJ009475

MFWSLVLVPLVVLLFNYLVRDAKKKYSVMLPGPAKYPVFGSVHIYRKRDPED

TWSFITNLSRKYGKLFCVWIGSRLALFC

SNHSDTETVLSSQKLIRKSELYKFLIPWLGDGLLLSTGQKWFNKRKILTPAFHFKILEQFVEVFDKQGTVLVQRLREQAT

GKLVNIYPFVTLAALDIICETAMGTSINAQTDTDSKYVRAVTELSYLLAGRFMKVWQRSDFLFNLSTDKKRQDKVIKVLH

DFTTSIIRSRREELLAEKIETNDTADEEGVGTRKKMAFLDVLLQASIDGRPLTDKEIQEEVDTFMFEGHDTTTIAITFTL

MLLAKHPDIQEKVYQEVTEIIGKDLNAPTTYRNLQDMKYLELVIKESLRLYPPVPIIGRKFTEKTEIDGKVVPEDSNFNV

GIILMHRDPTQFEEPERFDPERFSPERTTELSSPYAYIPFSAGPRNCIGQKFAMLELKSTLSKIIRNYRLTDTGPEPKLI

IQLTLKPKDGLKVAFVPRAAA.

 

>CYP4D42v2 Culex pipiens CPIJ020229 XM_001870408.1

1 aa diff to CYP4D42 Culex pipiens pallens partial fragment

1 aa diff to CPIJ009478 from TWFS to end, cyan parts do not match

missing correct N-term, compare to CPIJ009475

MSFKFGPPFKNFEHPWY

TWSFITNLSRKYGKLFCVWIGSRLALFCSNHSDTETVLSSQKLIRKSELYKFLIPWLGDGLLL

STGQKWFNKRKILTPAFHFKILEQFVEVFDKQGTVLVQRLREQATGKLVNIYPFVTLAALDIICETAMGTSINAQTDTDS

KYVRAVTELSYLLAGRFMKVWQRSDFLFNLSTDKKRQDKVIKVLHDFTTSIIRSRREELLAEKIETNDTADEEGVGTRKK

MAFLDVLLQASIDGRPLTDKEIQEEVDTFMFEGHDTTTIAITFTLMLLAKHPDIQEKVYQEVTEIIGKDLNAPTTYRNLQ

DMKYLELVIKESLRLYPPVPIIGRKFTEKTEIDGKVVPEDSNFNVGIILMHRDPTQFEEPERFDPERFSPERTTELSSPY

AYIPFSAGPRNCIGQKFAMLELKSTLSKIIRNYRLTDTGPEPKLIIQLTLKPKDGLKVAFVPRATA.

 

>CPIJ009475 CYP4D43 XM_001851371

2 aa diffs to CYP4D43 Culex pipiens pallens partial fragment

MAIAALVALALVGLALAVLLYRKFANALYYGAKIGGPRGYPLIGNALLFLYKSPPDFFLAIEKTIREAGRCFRLWLGPEL

LVIVTDAKVAEGILSSPKYIEKSGEYDFMRPWLGEGLLTSSGRKWHSHRKIITPTFHFKILEQFVEIFDHQSDVFVEQLR

AQAASGQAFDVFPLVTLYALDVICESAMGTKINAQIHSDSEYVKAVKEITCIIHIRTYDVMARYNSLFNLSPYRRQQDKV

LKVLHGYTNSVIQSRRRDLVENNQKSQQDRDREAELGIRRKVAFLDMLLQTTVDGRPLTDVEIREEVDTFMFEGHDTTTS

AISFLMYRLARHPEVQRKVYEEIVAVIGADRDRPVTLAMLNELHYLELVVKETLRLYPSVPFYGRKILENCEIEGRTFPA

GANVIIMPFFMGRDSEYFEDPQEFRPERFAVETSAEKTNPYRYIPFSAGPRNCIGQKFAMAEIKNVISKVLRHFELLAPD

HVPEESFIAEMILRPTYGISLRLKERT.

 

>CYP4D43 Culex pipiens pallens CB074951.1

GRGNSIEVDTFMFEGHDTTTSAISFLMYRLARHPEVQRKVYEEIVAVIGADRDRPVTLAM LNELHYLELVVKETLRLYPSVPFYGRKILENCEIEGRTFPAGANVIIMPFFMGRDSEYFE DPQKFRPERFAVGTSAEKTNPYRYIPFSAGPRNCIGQNH

 

>CPIJ009476 CYP4D44 Culex pipiens XM_001851372.1

73% to CYP4D37, 71% to CYP4D38

MFWTRWKGILITYPTMGRMVDPDIVYIHLSEIRLPKSTSISLKRPYLKTGLPDLQCFDFVNLIQKLTDDYGDVVRFWMGP

QFTIYTGNPKWIEAILTNRNLTNKSDEYGFLSNWLGDGLLLSKRHKWHARRKIITPAFHFKILDQFVEVFDRNAAELVDV

LGKFAANGKTFDVFPYILLYTLDVICETAMGTSVDAMRNSDSEYVKAVKEAASISITRMYDVYMRTPLFYLTPGYQKLRK

AIKMLHAYTDNVIVSRRMQLEASSNQSAEVASEEHEYGGKKKEAFLDLLLKTSIEGRPLTNLEIREEVDTFMFEGHDTTT

SGVSFTLYNLAKYPAIQQKVHDEIIAVFGTDPHKPITMANLNELTYLEMVIKETLRLFPSVPIIGRKCVEEVTIEGKTVP

AGTNIIIGIYYMGRDPNYYDNPLEFIPERFEGEKSVEKFNPYKYVPFSAGQRNCIGQKFALNEVKSVISKLLRHYEFVLP

ADQNHEPPVLSSELILKPHHGIPLQIKPRAPLTH.

 

>pseudogene fragment CYP4D45P Culex pipiens 59% to CPIJ009476 N-term

between 325X5P and CYP325X6

MSWTHWKGLSIT*PTMGRMMDPDIVYIHLSEIRLQKST*ISLKWS*LETGLPDLQC

 

>Cyp4e1 D. melanogaster AC020402 44580-46698

MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPT

EILNRFFGWWHEYGKDNFRYWIGYYSNIMVTNPKYME

FILSSQTLISKSDVYDLTHPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENST

KFIDQLKKVADGGNIFDFQEEAHYLTLDVICDTAMGVSINAMENRSSSVVQAFKD

ITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTLKTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSR

KKMAFLDTLLSSKVDGRPLTSQELYEEVSTFMFEGHDTTTSGVGFAVYLLSRHPDEQ

EKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTEKDYVI

DGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQ

PERFDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGY

ISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLRMKQRLVCDST

 

>Cyp4e1 D. pseudoobscura ortholog of 4e1 INTRON 4 MISSING 73% to 4e1

MWFALYLVLALPLLWLAYLELKSLRRRRVLNKFKGPKVLPVVGNAHQLGRTPP

EILGQMFEWWYQHDKDNFRYWIGYYPNLMVTRTKYFE

FILSSQTLISKAEVYSLMQPWLGLGLLTSTGSKWHKHRKMITPSFHFNVLQDFHEVMNEKS

TKFIKHLKNVSGGGSIVDFQEQAHFLTLDIICETAMGVSINAMENQDSELVQAFKD

MCYNIKVRTFSSWKRNPTLYQFASDYPAYCKTL

KTLQDFTHDVIEKRLNAHKEGTVLASHGDEFSRKKMVFLDTLLSATVDGRPLTSQELYEE

VSTFIFAGHDTTTSAISFTLYLVSRHQDDEQR

KLFEEQRDVMGDSGLDREATFQEISEMKYLDLFIKEAQRVYPSVPFVGRYTEKDYVI

DGDLVPKGTTLHMGIFMLGYDDRVFKEPHKFRPQRFEEEKPGPFEYVPFSAGPRNCIGQKFAL

LEIKTVVSKIIRHFEVLPALDELASKDGYIRTTLGLPPTEKRKRDLQQHKYDPILLVAMS

LKSENGIYLRLKERF*

 

>Cyp4e2 D. melanogaster AC020402 41848-44099

MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPS

EILDTVFSWWHQYGKDNFVFWIGTYSNVLVTSSKYLE

FILSSQTLITKSDIYQLTHPWLGLGLLTST

GSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLD

VICDTAMGVSINAMENRSSSIVQAFKD

MCYNINMRAFHPLKRNELLYRLAPDYPAYSRTL

KTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRPLNSKELYEE

VSTFMFEGHDTTTSGVSFAVYLLSRHQDEQ

RKLFKEQREVMGNSELGRDATFQEISQMKY

LDLFIKEAQRVYPSVPFIGRFTEKDYVI

DGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFEYVPFSAGPRNCIGQKFALLE

IKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIRLKERH

 

>Cyp4e2 D. pseudoobscura INTRON 4 MISSING 86% to 4e2

MWFVLYLFLALPLLLVAYLELSTFRRRRALNKFKGPSRLPIVGNAHQAGKNPT

EILDQVFSWWHQYGKDNFRFWIGSYSNLIITNHKYLE

FILSSQTLITKSDIYNLTHPWLGLGLLTST

GSKWHKHRKMITPSFHFNILQDFHEVMNENSTKFIKQLKQVAAGDSIFDFQNETHYLTLD

VICDTAMGVSVNAMENRSSSIVQAFKD

MCYCINMRAFHPFKRNDLFFRLAPDYPAYCKTL

KTLQDFTNNIIEKRIKAHKDGTVSASQGDEFSRKKMAFLDTLLSSTIDGRPLTTQELYEE

VSTFMFEGHDTTTSGVSFAVFLLSRHKDEQRKLFDEQREVMGDSGMDRDATFQEISEMKY

LDLFIKEAQRVYPSVPFIGRYTEKDYII

EGDLVPKGTTLNLALVMLGYNDRVFKDPHKFR

PERFELEKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRHFEVLPALDELASKDGY

ISTSLGYPPEERKKRDLLRHKYDPLLSAVLTLKAENGLFIRLKERH

 

>Cyp4e3 D. melanogaster AC020324 73117-75125

MWLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPA

EILSTFFDWWYDYGKDNFLFWIGYSSHIVMTNPKQLE

YILNSQQLIQKSTIYDLLHPWLGHGLLTSF

GSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLD

VICDTAMGVPINAMEQRDSSIVQAFRD

MCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTL

KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEE

VSTFMFEGHDTTTSGVSFSVYLLSRHPDVQ

RKLYREQCEVMGHDMNRSVSFQEIAKMKYL

DLFIKEAQRVYPSVPFIGRYCDKDYDI

NGSIVPKGTTLNLALILLGYNDRIFKDPHHFRP

ERFEEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRL

NTYLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRERRS*

 

>Cyp4e3 D. pseudoobscura ortholog 81%

MWLAVLALLALPLLVLVYFELRASRRRRMLKVFNGPAPVPVLGNANRVGNTPA

EILATIFDWWQEYGKDNFVFWIGYTPHLAVTNPKYLE

YILNSQSLIQKSTIYELLHPWLGYGLLTSH

GSKWHKHRKMITPSFHFNILQDFHEVMNENSTKFIAQLRRDAAGDSIIDFQDHAHYLTLD

VICDTAMGVPINAMEHRNSAIVQAFKD

MCLSVNMRAFHPFKRSNRIYSLSPEYAAYQRTL

KTLQDFTYDIIEKRVETLQAGQNSSSADSSSPRKKMAFLDTLLSSTVDGRPLTRQEIYEE

VSTFMFEGHDTTTSGVAFAGYLLSRHPEAQ

QRMYQEQCNVMGSELDRDATFQEIAQMKYLDLFIKEAQRVYPSVPMIGRYADKDYMI

NGTLVPKGTTINLALVLLGYNDRIFKDPHHFRP

ERFEEEKPGPFEYVPFSAGPRNCIGQKFALLELKTVISKLVRSFEVLPAVDELLSTDGQL

NTYLGLSPAEKQKREAGRHKYDPILSAVLTLKSDNGLHLRLRERRH

 

>Cyp4e5 Drosophila mettleri U78486

MWFIVYILLALPIMLFVFLSCEWPKRNDAEQIEWSSGVPFLGNA                      HQMGKTPAEILNTFFEFWHKYNKDNFRIWIGYYANILVSNPKHLEVIMNSTTLIEKLD                      IYDMLHPWLGEGLLTSKGSKWHKHRKMITPTFHFNILQDFHQVMNENSAKFIKRLKEV                      SAGDNIIDFQDETHYLTLDAICDTAMGVTINAIEKRDTVDVVKAFKDMCHIINMRAFR                      PLQRSDFLYRFSPEYATYAKTLKTLKDFTNDIIAKRIKVHRTAAAKTNQEGSEFSRKK                      MLPDTLLSATIDGRPLNQQEIYEEVSTFMFEGHDTTTSGVAFAGYILSRFPEEQRKLY                      EEQQAVMGNELNRDATFQEISAMKYLDLFIKEAQRVYPSVPFIGRYTDKDYNIHGTIM                      PKGTTLNLGIIVLGYDDRVFEEPHRFYPERFEKQKPGPFEYVPFSAGPRNCIGQKFAL                      LELKTVISKLVRTFEVLPAVDELVSKDGNLNTYVGLPKEEKERKERMGYKYDPILSAV

LTLKSENGLHLRLR

 

>Cyp4e6 Ceratitis capitata AF028819

QKFAMMELKVTISKIIRHFNILPAVDDFLRDIHNLGDPNNKITNPYDARLGFFLTLKS

VNGLNIRLSRRSY

 

>Cyp4g1 D. melanogaster AC020093 comp(33262-34932) no introns

MAVEVVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSP

PELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGH

QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVA

RMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVK

LLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPA

SKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDT

TSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLY

PPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMA

NRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLE

NGFNVSLEKRQYATVA

 

>Cyp4G1 D. pseudoobscura ortholog NO INTRONS 93% IDENTICAL TO 4G1

MTVDTVQETLQHAATSTSGLGFSPMLTTLVGTIVALGLYEYWRRNTREYRMVANIPSPPG

LPLLGQAHMVAGLSNAEILNVGLGYLNKYGETMKAWLGNVLLVFLTNPNDIELILSGHQH

LTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKSVVGRM

GLETGKSFDVHDYMSTTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLL

YRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKQNFQEESRAIVDEVQAVSTPATKKE

GLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIIDEVNTIMFEGHDTTSAG

SSFALCMMGIHKDIQEKVFAEQKAIFGDNMLRDCTFADTNEMKYLERVILETLRLYPPVP

LIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRADIYPNPTKFDPDNFLPERMANRHY

YSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLENGFN

ISLEKRKYATVA

 

>CYP4G2v1 Musca domestica From Claus Tittiger 1/5/98

1 aa diff to EF615002

MTADTLVLET MDSAKNSTAG PATVLNPIWT ALLGIAVVVS LYEIWLRNTR

KYKLTANMPN

    PPMLPLIGNG HLVAHLTNAE ILARGIGYMQ TYGGAMRGFL GPMLVVFLWN

APDIELILST

    HTHLEKSIEY RFFKPWFGDG LLISNGHHWQ HHRKMIAPTF HQSILKSFVP

AFVQHSKKVV

    ERMAKELGKE FDVHDYMSQT TVEILLSTAM GVKKVPEDNK SLEYAKAVVD

MCDIIHKRQL

    KFFYRMDALY NLSSMSEKGK KMMDIILGMT RKVVTERQQN FNAESRAIVE

EDDEISKQKQ

    QAKKKEGLRD DLDDIDENDV GAKKRLALLD AMMAMSKNPD VEWTDKDVMD

EVNTIMFEGH

    DTTSAGSSFV LCMLGIYKDI QEKVLAEQKA IFGDNFLRDC TFADTMEMKY

LERVIMETLR

    LYPPVPLIAR RAEFDVKLAS GPYTIPKGTT VVIAQFAVHR NPQYFPNPEK

FDPDNFLPER

    MANRHYYSFI PFSAGPRSCV GRKYAMLKLK VLLSTIIRNY SVQSNQQEKD

FKLQADIILK

    IENGFNIMLN RRPEAMKAM

 

>CYP4G2v1 Musca domestica Nannan Liu 7/20/06 EF615002

ADTLVLETMDSANNSTAGPATVLNPIWTALLGIAVVVSLYEIWLRNTRKYKLTANMPNPP MLPLIGNGHLVAHLTNAEILARGIGYMQTYGGAMRGFLGPMLVVFLWNAPDIELILSTHT HLEKSIEYRFFKPWFGDGLLISNGHHWQHHRKMIAPTFHQSILKSFVPAFVQHSKKVVER MAKELGKEFDVHDYMSQTTVEILLSTAMGVKKVPEDNKSLEYAKAVVDMCDIIHKRQLKF FYRMDALYNLSSMSEKGKKMMDIILGMTRKVVTERQQNFNAESRAIVEEDDEISKQKQQA KKKEGLRDDLDDIDENDVGAKKRLALLDAMMAMSKNPDVEWTDKDVMDEVNTIMFEGHDT TSAGSSFVLCMLGIYKDIQEKVLAEQKAIFGDNFLRDCTFADTMEMKYLERVIMETLRLY PPVPLIARRAEFDVKLASGPYTIPKGTTVVIAQFAVHRNPQYFPNPEKFDPDNFLPERMA NRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIIRNYSVQSNQQEKDFKLQADIILKIE

NGFNIMLNRRPEAMKAM

 

>CYP4G2v2 Musca domestica Nannan Liu, 5 aa diffs to EF615002

4 frameshifts = &

ADTLVLETMDSANNSTAGPATVLNPIWTALLGIAVVVSLYEIWLRNTRKYKLTANMPNPPMLPLIGNG HLVAHLTNAEILARGIGYMQTYGGAMRGFLGPMLVVFLWNAPDIELILSTHTHLEKSIEY RFFKPWFGDGLLISNGHHWQHHRKMIAPTFHQSILKSFVPAFVQHSKKVVERMAKELGKE FDVHDYMSQTTVEILLSTAMGVKKVPEDNKSLEYAKAVVDMCDIIHKRQLKFFYRMDALY NLSSMSEKGKKMMDIILGMTRKVVTERQQNFNAESRAIVEEDDEISKEKQQAKKKEGLRD DLDDIDENDVGAKKRLAPLDAMMAMSKNPDVEWTDKDVMDEVNTIMFEX &

HDTTSAGSS &

FVLCMLGIYKDIQEKVLAEQKA &

IFGDNF &

LRDCTFADTMEMKYLERVIMETLRLYPPVPLIARR AEFDVKLASGPYTIPKGTTVVIAQFAVHRNPQYFPNPEKFDPDNFLPERMANRHYYSFIP FSAGPRSCVGRKYAMLKLKVPLSTIIRNYSAQSNQQEKDFKLQADIILKIENGFNIMLNR

RPEAMKAM

 

>CYP4G4 Manduca sexta Contig_4957_5'-truncated

sent to genbank

CA798770 AI187631 AI142166 AI187497

BE015410 BE015411 AY635178 = CYP4G4  aa 420 to the end

MSYAAAEHVVQSSTFSAVNLFYVLLVPALILWYTYWRMSRRRLYELAEKLNGPSGWPLLG

NALEFTGGSAEIFKNIVEKSIPYDQESVV

KLWIGPRLLVFIYDPRDVEVILSSHVHIDKADEYRFFKPWLGNGLLISTGQKWRSHRKLI

APTFHLNVLKSFIDLFNANSRAVVDKLKKEAKDFDCHDYMSE 

CTVEILLETAMGVSKTTQDQSGFDYAMAVMKMCDILHLRHTKIWLRPDLLFKFTEYAKNQ

TKLLDVIHGLTKKVIKRKKEEFQSGKKPSVLNNDVTSTEVPTSKTTSVEGLSFGQSAGL K

DDLDVEEDVGQKKRLAFLDLLLESSQSGVVITDEEIKEQVDTIMFEGHDTTAAGSSFFLS

MMGIHQDIQDKVIEELDQIFGDSDRPCTFQDTLEMKYLERCLMETLRM YPPVPIIARHLK

QEVTLPSNGKKVPAGTTLVVATFKLHRRPDVYPNPEKFDPDNFLPERSANRHYYAFVPFS

AGPRSCVGRKYAMLKLKIILSTLLRNFRIHSDLKESDFKLQADIILKRAEGFKVRLEPRK

RLAKA*

 

>CYP4G7 Tribolium castaneum (red flour beetle) XP_975951 MVVVEESLNHSLNLGNSVLISLGVVAVILAVYHFWLQSLRYTKLGNKIPGYDPLPIIGNAHMVMNKNPTQ VMELALRVASEKGSVVRFWFGSKLGVALLDPRDIELILGSNVHLEKSSEYRFFEPWLGDGLLISKGDKWR SHRKMIAPTFHQSILKTFVPVFNKNAMDLVEQLRNEALDQICDVHDYLSGATVDVLLETVMGVKKTKEAR TSYKYAKAVMDMCTILHFRHVKLWLRSDWIFSFTKLFKEQTSLLRIIHNLTDRVIKQKKKETEEENLKIK NEQTFNFGSGLRDDLDENDENLGEKKRLAFLDFMVEASQTEGNKLNDEEIREEVNTIMFEGHDTTAAASS FFICILGVYPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLETLRMYPPVPIITRVINEEVKLA SGDYTLPVGTTVGIGQFLVHRNPKYFPNPDKFDPDNFLPERCQQRHYYSFIPFSAGPRSCVGRKYAMLKL KILLASIVRNFKIKSVVKEKDFQLQADIILKRADGFRVILTSRT

 

>CYP4G8v1 Helicoverpa armigera (Australian cotton bollworm) U86002

EVDTFMFEGHDTTAAGSSFFLSMMGVHQDIQDKVIDELDKIFGD                      SDRPATFQDTLEMKYLERCLMETLRMFPPVPIIARQIKQDITLPSNGKQVPAGTTVVV                      ATYKLHRREDVYPNPTKFDPDNFLPERSANRHYYAFVPFTAGPRNCIGQ

 

>CYP4G9 Helicoverpa armigera U86003

EVDTFMFEGHDTTAAGSSFVLCLLGLHQDVQKRVYDELYEIFGD

SDRPATFNDTLQMKYLERVILETLRMYPPVPIIARELKRDAKIVTNNYTLPAGATVVV

CTYGIHRHPQHYKDPDTFNPDNFLPENMANRHYYSYIPFSAGPRNCIGQ

 

>CYP4G10 Helicoverpa armigera U86004

EVDTFMFEGHDTTAAGSSFVLCLLGVYKDIQAKVYNELYEIFGD

SDRPATFADTLEMKYLERVILNLCRLYPPVPVIARKLNRDVKIGSTTVLPAAATVVIG

TYKVHRSPKYYKDPDTFNPDNFLPENASNRHYYSFIPFSAGPRNCIGQ

 

>CYP4G11 Apis mellifera

MAAASATGFSASSVFLSLLIPALILYFIYFRISRRHLLELAEKIPGPPALPLIGNALDLFGSPD

AMFSQVLKKAENFKDVVKIWVGPKLVICLIDPRDVEIILSSNVYIDKSTEYRFFKPWLGDGLLIST

GQKWRNHRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENGKEFDCHNYMSELTVDILL

ETAMGVSKPTRDHNAFEYAMAVMK

MCDILHLRHTKIWLRPDWLFNLTKYGKNQIKLLEIIHGLTKKVIQLKKEEYKSGKRNIIDN

SAQKTESK

TNNIVVEGVSFGQSVGLKDDLDIDDDVGEKKRQAFLDLLIEAGQNGVLLTDKEVKEQVDTIMFE

GHDTTASGSSFFLAVMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERCLLETLR

MYPPVPLIAREIKTDLKL

ASGDYTIPAGCTVVIGTFKLHRQPHIYPNPDVFDPDNFLPEKTANRHYYAFVPFSAGPRSC

VGRKYAMLKLKIVLSTILRNFRVRSDVKESEFRLQADIILKRADGFKIRLEPRKQVASTA*

 

>CYP4G12 Trichogramma cacoeciae AF207949

TAAGSSFFLSMMGCHPDIQEKVIQEIDEIFGDSDRPATFQDTLE

MKYLERCLMETLRMYPPVPIIAREVKTDLKLASGDYTIPAGCTVVVATFKLHRQPHIY

PNPDVFNPDNFLPEKTANRHYYAFV

 

>CYP4G13 Musca domestica (house fly)

MDTIPTPKQM PLIGNGHMAF GQNNHQILKL MSQVFKDCGE TVRILLGHMN VVFLTNPADL

EIFLNGYKHL EKSVEYRYFQ PWFGNGLLIS KGHHWRHHRK MIAPTFHQSI LKSFVPTFVK

HSKAVSGRFA SKVGQEFDCH KYMSETTVDI LLTTAMGCKL QPETEKSAEY AQAVMDMCDI

IHNRQLKLFY RLDSTYSFTK LRERDNKLMN VILSMTRKVV EDRKKNFNAE EHGIVDRTAE

DAKLKAKAAK KEGLRDDLDD IDENDIGEKR RLALLDAMME MEKNPDIKWT DKDVMDEVNT

IMFEGHDTTA AGSSFALCML GIHQDVQQRV FEEQQAIFGD DLNRDCTFAD TLQMSYLERV

ICETLRLFPP VPLIARKAEE DVNLKSGPFT IAKGTTVVLL QYFVHRRADI YPDPEKFNPD

NFLPERTANR HYYAYIPFSA GPRSCVGRKF AMLQLKVLLS TIIRNYRVSS TRTQKDFQLQ

GDIILKMANG FNITLEKRPT AKV

 

>CYP4G13v2 Musca domestica AF355145, 98% to CYP4G13

METLQRESSQLPLGAATSSAGTWLSLVFGVGVIAILYEYYRRNT

RAYKLMDTIPTPKQMPLIGNGHMAFGQNNHQILKLMSQVFKDCGETVRILLGHMNVVF

LTNPADLEIFLNGYKHLEKSVEYRYFQPWFGNGLLISKGHHWRHHRKMIAPTFHQSIL

KSFVPTFVKHSKAVSGRFASKVGQEFDCHKYMSETTVDILLTTAMGCKVQPETEKSAE

YAQAVMDMCDIIHIRQLKLFYRLDSTIRFTKLREHDNKLMNVILSMTRKVVEDRKKNF

NAEERGIVDRTAEDAKLKAKAAKKEGLRDDLDDIDENDIGEKRRLALLDAMMEMEKNP

DIKWTDKDVMDEVNTIMFEGHDTTAAGSSFALCMLGIHQDVQQRVFEEQQAIFGDDLN

RDCTFADTLQMSYLERVICETQRLFPPVPLIARKAEEDVNLKSGPYTIAKGTTVVLLQ

YFVHRRADIYPDPEKFNPDNFLPERTANRHYYAYIPFSAGPRSCVGRKFAMLQLKVLL

STIIRNYRVSSTRTQKDFQLQGDIILKMANGFNITLEKRPTAKV

 

>CYP4G14 Tribolium castaneum (red flour beetle) XP_973423, AF263514,

MSTTVPTPDISTPSGILSASNVFYFLLIPALLLWYAYWRISKRHMLELAAKIPGPP

GLPILGNALDLVGKPHQVFSHVYQKSFEYKKVVKMWAGPKLLVFLTDPSDIELILSSYVHIDKSSEYRFF

KPWLGDGLLISTGQKWKAHRKLIAPTFHLNVLKSFIDLFNANSRDVIRKLQKEIGKEFDCHDYMSEATVE

MLLETAMGVSKKTQDQSGYDYAMAVMKMCDILHLRHTKFWLRPDIIFNQTKYAEYQKSLINTIHSLTRKV

IKRKRADFDKGIRGSTAEVPPELQTKNYDKTESKTVVEGLSYGQSAGLKDDLDVDDNDIGEKKRMAFLDL

MIEASQNGVVINDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGVHQDIQDKVVQELYDIFGDSDRPATFA

DTLEMKYLERCLMETLRMFPPVPIIARQLNQDLKLASGDYTVPAGCTVVIGTFKVHRLEEYYPNPDKFDP

DNFLPERTANRHYYSFIPFSAGPRSCVGRKYAMLKLKILLSTILRNYRIYSDLKEKDFQLQGDIILKRAE

GFKVRLEPRKMAKA

 

>Cyp4g15 D. melanogaster AC013897 comp(8972-10574 and 5306-6643) two pieces

MEVLKKDAALGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPAS

SVFRTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPWLGDGLLIST

GQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDCHDYMSEATVEILL

ETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLT

RYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALERER

EQNGGVDQTPSTAGSDEKDREKDKEKAS

PVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQN

GALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPATFQ

DTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHR

NPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCV

GRKYAMLKLKILLSTILRNYRVYSDLTESDFKLQADIILKREEGFRVRLQPRTS

 

>Cyp4G15 D. pseudoobscura ortholog (94%) intron #4 missing

MEVLKKDAAMGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFDVIGPAS

SVFKTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFFKPWLGDGLLIST

GQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDCHDYMSEATVEILL

ETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLT

RYYKEQGRLLSIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALERER

GQEQKQEQKQEQAEMGSAGGGKAAGEGT

PVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQN

GALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQEIQDRVIAELDGIFGDSQRPATFQ

DTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGDYVIPRGATVTVATVLLHR

NPKVYTNPNVFDPDNFLSERQANRHYYAFVPFSAGPRSCV

GRKYAMLKLKILLSTILRNYRVYSDLSESDFKLQADIILKREEGFRVRLQA

 

>CYP4G16 Anopheles gambiae CYPs1x5, 565 aawi AAAB01008885.1

MSATIAHTDGLNSSANIISPINMFYFLLTPALLLWFFYWRLSRRHMLELAERIPGPKGLP

LIGNALDLVGSSH 

SVFRTIIEKGKEYNEVIKIWIGPKLIVFLVDPRDIELLLSSHVYIDKSPEYRFFKPW

LGNGLLIST  GHKWRQHRKLIAPTFHLNVLKSFIDLFNENSRLVVKKMQKENGKVFDCHDYMSECTVEILL 

ETAMGVSKKTQDQSGYDYAMAVMKMCDILHLRHRKMWLYPDLFFNLTQY

AKKQVKLLNTIHSLTKKVIRNKKAAFDTGTRGSLATTSINTVNIEKSKSDSTKTNTVEGL  SFGQSSNLKDDLDVEENDVGEKKRLAFLDLLLESAENGALISDEEIKNQVDTIMFEGHDT  TAAGSSFFLSMMGVHQQIQDKVIQELDEIFGESDRPATFQDTLEMKYLERCLMETLRMYP  PVPIIARSLKQDLKLASSDIVVPAGATITVATFKLHRLESIYPNPDVFNPDNFLPEKQAN 

RHYYAFVPFSAGPRSCV 

GRKYAMLKLKIILSTILRNFRVYSDLKEEEFKLQADIILKREEGFQIRLEPRQRKSKTL*

 

>CYP4G17 Anopheles gambiae CYPs1x3, 562 aawi AAAB01008963.1 

MGIETIPERMAMDETVPGSWVLSVTVATVLLLVAGTLFHLWMQTRRYVQLGNLIPGPVAY  PLIGNANMLLGKTHNQIMEKAMELSYIYGTVARGWLGYHLVVFLTEPADVEIILNSYVHL  EKSSEYRFFKPWLGDGLLISSGDKWKSHRKLIAPAFHQNVLKTFIDVFNDNSLAVVKRMS  KEVGHVFDCHDYMSEVTVDILLETAMGSTRTGENKEGFEYAMAVMK 

MCDILHKRQLKIHLRLDPLFNLTGVKKEQERLLQIIHGLTRKVVREKKQLYERQMAEGK   MPSPSLTEIIGKEEKPGEGQLGGSPAFISQGSMLRDDLDDNDENDIGEKRRLAFLDLMIE  TANNGANISDEEIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDS  KRKATFGDTLEMKYLERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTY  KIHRREDLYPHPETFNPDNFLPERTQNRHYYSYIPFSAGPRSCV 

GRKYAMLKLKVLLSTVLRHYRVVSNLTEKDFKLQADIILKRTDGFQIQLEPRA* 

 

>CYP4G18 Diabrotica virgifera (western corn rootworm) a beetle AF243507

AGSSFFLSLMGIHPEIQDRVIQEIDEIFGDSDRPATFADTLEMK

YLERCMMETLRMYPPVPIIARQLRQDVKLVSGNYTLPTGATIVVGTFKIHRDSDTYPN

PDKFDPDNFLPERSANRHYYSFIP

 

>CYP4G19 Blattella germanica AY176056

MSVTVETATVESPASSISTFMVLLVSAVALFFAYWKISRRRFLQ

LAEKIPGPKGYPIIGNALDFLGSSSQVTDRMIQIGFQFTTIAKVWILHKLVVFIADPR

DIELILGNSTHLEKSEEYRFFKPWLGDGLLISSGQKWKSHRKLIAPTFHLNVLKSFVD

LFNANSRAVCDKMAKENGRTFDCHDYMSECTVEVLLETAMGVSKKTQNKSGFEYAMAV

MKMCNILHLRHSKVWLRPDWLFNLTKYGKEQVDLLDVIHGLTKKVIKNKKEIISSGTK

KYIEESVTQEEKAIASTPVKGLRDDLDEQDENDVGQKKRLAFLDLMIESAQNGVVLTD

EEIKEEVGTIMFEGHDTTAAGSSFFLCLMGIHQKYQDMCVQELNQIFGDSDRPATFAD

TLEMKFLERCLLEALRMYPPVPVIARKLAEDLTLASTGVVIPQGTTIVVSTVKTHRLE

EHWPNPDVYDPDNHLPEKAAERHYYSFVPFSAGPRSCVGRKYALLKLKIILSTILRNF

KVHSDISEDEFKLQGDIILKRADGFMIRLEPRKKTVAA

 

>CYP4G20 Mamestra brassicae antennal cytochrome P450 AY390259

MSYAAAESVVPTSTWAATSLFYVLLVPALILWYAYWRMSRRHMY

ELAAKLHGPPGLPLLGNALEFTGGSHDIFRNVIEKSIPYDGESVVKIWIGPRFWCSCT

ILVTWSLILSSHTHIDKADEYRFFKPWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKS

FIDLFNANSRAVVSKLKKEAGEFDCHDYMSECTVEILLETAMGVSKSTQDQSGFEYAM

AVMKMCDILHLRHTKIWLRPNLLFKLTDYAKKQTKLLDVIHGLTKKVIRRKKEEFNSG

KRPTILQDCTTTTTEEANKTTSVEGLSFGQSAGLKDDLDVDDADVGQKKRLAFLDLLL

ESSQSGVVISDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGIHQDIQDKVIDELDKIF

GDSDRPATFQDTLEMKYLERCLMETLRMFPPVPIIARHLKQDITLPSCGKQVPAGTTV

VVATYKLHRRPDVYPNPTEFDPDNFLPEKSANRHYYAFVPFSAGPRSCVGRKYAMLKL

KIILSTILRSFRVHSDLKESDFKLQADIILKRAEGFKVRLEPRKTTKAY

 

>CYP4G21_Contig4 Anopheles funestus 94% to 4G17 probable ortholog of 4G17

AY648704

311 EVDTFMFEGHDTTAAGSSFVLCLLGIHQHIQDRVYAELRQIFGDSKRKATFGDTLEMKYL 490

491 ERVIFETLRMFPPVPMIARKINEDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETF 670

671 NPDNFLPERTQNRHYYSYIPFTAGPRTASAR 763

 

>CYP4G22 Bombyx mori (silkworm) 64% to 4G19

MSYTNAENVVPTSTFSAINLFYVLLVPAVILWYAYWRMSRRRLYELADKLNGPPGLPLLGNALEFVGGSA ()

DIFRNIVQKSADYDHESVVKIWIGPRLLVFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLIST (1?)

GQKWRSHRKLIAPTFHLNVLKSFIDLFNANSRAVVDKLKKEASNFDCHDYMSECTVEILL (1)

 234 ETAMGVSKSTQDQSGFEYAMAVMKMCDILHLRHTKIWLRPDLLFKFTDYAKNQTKLLDIIHGLTKK 431 (0)

 988 VIKRKKEEFASGKKPSNLNETATTSEPSTGKLTSVEGLSFGQSSGLKDDLDVDDDVGQK 1164

1165 KRLAFLDLLLESSQSGVAISDEEIKEQVDTIMFE 1266 ()

1340 GHDTTAAGSSFFLSMMGIHQDIQDKVIEELDQIFGDSDRPVTFQDTLEMKYLERCLMET 1516

1517 LRLYPPVPIIARQVNQEITL 1576 ()

1680 SNGKKIPAGTTLVIATYKLHRRPDVYPNPNKFDPDNFLPERSANRHYYAFVPFSAGPRSCV 1862 (1)

1960 GRKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQVRLQPRKRMAKA* 2136

 

>CYP4G23 Bombyx mori (silkworm)  58% to 4G19 59% to CYP4G22

MTSLVDETEGYHVNSRVIFYPLLGLTTAIWILYRWQQNSHMHKLAELLPGPASIPIFGNALTLMRKNPHE ()

LVNLALGYAQTFGNVIRVWLGSKLIVFLVDADDIEIILNSHVHIDKATEYRFFKPWLGEGLLISS (1?)

GPKWRSHRKMIAPTFHINILKSFVGIFNQNSNNVVEKLKSEVGKTFDVHDYMSGTTVDILL ()

ETAMGISRKTQDESGFDYAMAVMK ()

MCDIIHQRHYKFWMRSEIVFKLTSFFKQQTKLLGIIHGLTNK ()

VIKNKKETYLENKAKGIIPPTLEEFTHHSGEILANNAKTLSDTVFKGYRDDLDFNDENDV ()

GEKKRLAFWDLMIESSQNGTNKISDHEIKEEVDTIMFE ()

GHDTTAAGSSFVLCLLGIHQDVQARVYDELYQIFGDSDRPATFADTLEMKYL

ERVILESLRLYPPVPVIARKLNRDVTI ()

STKNYVIPAGTTVVIGTFMLHRQPKYYKDPEVFNPDNFLPENTQNRHYYSYIPFSAGPRSCV (1)

GRKYALLKLKILLSTILRNFRTISEIPEKEFKLQGDIILKRAEGFQMKVEPRKRVPTNVAR*

 

>CYP4G24 Bombyx mori (silkworm)  71% TO CYP4G23

MSSLLNYNFEFDVPPIFHTLLLAIMIMWM

LHRWQQSSRLFRLGNKLPGPMALPLVGNSLLILGKKAEGW = BAAB01031491.1

VKYALDYSEKYG

TVVRAWAGPKLVVFLTDANDVEVILNSQIHIDKSPEYRFFKPWLGEGLLISSG = BAAB01016193.1

XKWRSHRKMIAPTFHINILKSFMGVFNENSKSVVKKLRSEVGKTFDVHDYMSCVTVDILL

ETAMGITKTTQDAASFDYAMAVMK

MCNIIHQRHYKVWLHFDAIFKLTSLFKKQRELLKTIHGLTNK (0)

VIKKKKFMYLQNKEKGIIPPTIEELTKIKDTNDSIMEDSAKTLSDTVFKGYRDDLDFNDEQDV ()

GEKKRLAFLDLMIESAQNHTCNISDHEIKEEVDTIMFE ()

GHDTTAAGSSFVLCLLGIHQEIQSKV

YDELFEIFGDSDRLVTFADTLQMKYLERVILESLRLYPPVPAIARKLTRDVQI ()

VTNNYIIPAGSTVVIGTFKIHRDPKYHKNPNVFNPDNFLPENTQNRHYYSYIPFSAGPRSCV (1)

GRKYALLKLKVLLSTILRNYKTTSEISEDQFVLQADIILKRYDGFKIRIEPRNKNHSNTV*

 

>CYP4G25 Antheraea yamamai AB196795

MSYTTAENVVPSSTFSAINLFYVLLVPAIILWYTYWRMSRRRLY

ELAEKLSGPEPLPIIGNALEFVGGSNDIFNNIIAKSLPFDDEAVVRLWIGPRLLVFIY

DPRDVEVILSSHVHIDKADEYRFFKPWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKS

FIDLFNANSRAVVDKLKKESGTFDCHDYMSECTVEILLETAMGVSKSTQDQSGFEYAM

AVMKMCDILHLRHTKIWLRPDLLFKLTDYAKNQTRLLDVIHGLTKKVIKRKKEEFQSG

KKATIMPEGNDVTNEVPSSKLTSVEGLSFGQSSGLKDDLDVDDDVGQKKRLAFLDLLL

ESSQSGVVITDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGIHQHIQDKVIEELDHIF

GDSDRPATFQDTLEMKYLERCLMETLRLYPPVPIIARHLKEEITLPSNGKKVPIGTTL

IVGTYKLHRRPDVYPNPHKFDPDNFLPERSANRHYYAFVPFSAGPRSCVGRKYAMLKL

KIILSTILRNFRVYSDLNESDFKLQADIILKRAEGFKVRLQPRKKQAKV

 

>CYP4G25 Antheraea pernyi (Chinese oak moth, Chinese Tussah moth) GU205081

MSYTTAENVVPSSTFSAINLFYVLLVPALILWYTYWRISRRRLY

ELAEKLGGPKPLPIIGNALEFVGGSADIFNNIIAKSLPFDHESVVRLWIGPRLLVFIY

DPRDVEVILSSHVHIDKADEYRFFKPWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKS

FIDLFNANSRAVVDKLKKESGTFDCHDYMSECTVEILLETAMGVSKTTQDQSGFEYAM

AVMKMCDILHLRHTKIWLRPDLLFKLTDYAKNQTKLLDVIHGLTKKVIKRKKEEFQSG

KKATIMPEANDVTNEVPSSKSTSVEGLSFGQSSGLKDDLDVDDDVGQKKRLAFLDLLL

ESSQSGVVITDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGIHQHIQDKVIEELDHIF

GDSDRPATFQDTLEMKYLERCLMETLRLYPPVPIIARQLKEEITLPSNGKKVPIGTTL

VVGTYKLHRRPDVYPNPHKFDPDNFLPERSANRHYYAFVPFSAGPRSCVGRKYAMLKL

KIILSTILRNFRVYSDLTESDFKLQADIILKRAEGFKVRLQPRKKQAKV

 

>CYP4G27 Ips paraconfusus (California fivespined ips, bark beetle) DQ471883

MSTATLSSAAAPGLLTSTNLFLFLLAPALALLYVYWKVSRKHMV

ELAERIPGPSGLPILGNALEFIGTPNQIFNTIYQKSFEFGRTIKVWVGPRLLIFLTDP

RDVEIILSSHVHIDKSPEYRFFKPWLGDGLLISTGQKWRAHRKLIAPTFHLNVLKSFI

DLFNKNSIETVNKLEKELGKEFDCHDYMSEATVEILLETAMGVSKKTQDQSGYDYAMA

VMKLCDILHLRHTKLWFRPDIIFNLTSTAKYQEKLINVIHSLTRKVIQKKKADFEKGI

RGSTAEVPEELKTQKYETAVPTKTTTLEGTSYGQSVGLKDDLDVDDDIGEKKRMAFLD

LMIEASQNGVVINDEEIKEQVDTIMFEGHDTTAAGSSFFLCQMAAHPEIQEKVLQEID

EIFQGSDRPATFADTLEMKYLERCLLETLRLFPPVPIIARQLQQDVKLASNPSYVLPS

GATIIIGTFKVHRLEEIYGPNADKFDPDNFLPERAANRHYYSFIPFSAGPRSCVGRKY

AMLKLKILLSTILRNYKIKSNLKESDYKLQGDIILKRADGFKIMLEKRKPIVSVKA

 

>CYP4G29 Leptinotarsa decemlineata (Colorado potato beetle) DQ117464

MSAATASVDLENPTTLLTPKNIFYFLLIPALVLWYAYWKISRRHMVELASKIPGPEGLPLLGSALEFVGT

SADIFKRMYAKSFEYGNTVKVWIGPKLLIFLVDPRDVEIILSSHVHIDKASEYRFFQPWLGDGLLISTGQ

KWRAHRKLIAPTFHLNVLKSFIDLFNANSREVVQKLKKEVGKEFDCHDYMSEATVEILLETAMGVSKKTQ

DQSGYDYAMAVMKMCDILHLRHTKVWLRPDFIFNLTNYAKKQEGLIGIIHSLTRKVIKRKRADFEKGIRG

STAEVPEELKTKNFDKNVSSKTVVEGLSYGQAAGLKDDLDVDDDVGEKKRMAFLDLMIEASQNGVVINDE

EIKEQVDTIMFEGHDTTAAGSSFFLSMMGVHQDIQDKVVQEIDEIFGDSDRPATFADTLEMKYLERCLME

TLRMYPPVPIIARQLRQDVKLASGDYTLPAGATIVIGTFKIHRQEDVYPNPDKFDPDNFLPERSANRHYY

SFIPFSAGPRSCVGRKYAMLKLKILLSTILRNYRIYSTVEEKDFQLQGDIILKRADGFRIKLEPRKRVLK

A*

 

>CYP4G30 RAG3: 81% to 4G23 Spodoptera litura (common cutworm) DQ350813

QVDTFMFEGHDTTAAGSSFVLCLLGIYKDVQAKVYNELYDIFGDSDRPATFADTLEMK

YLERVILETLRLYPPVPAIARKLNTDVNIVTNNYLIPASTTVVIGTYKVHRSPKHYKD

PDTFNPDNFLPENMANRHYYSYIPFTAGPRNCIGQ

 

>CYP4G31 SC2: 80% to 4G23 Spodoptera litura (common cutworm) DQ350812

QVDTFMFEGHDTTAAGSSFVLCLLGVHKHIQDKVYNELYEIFGDSDRPATFADTLQMK

YLERVILESLRMYPPVPIIARKLNRDVKIATNNYVLPAGTTVVVGTLKIHRNPQYYKD

PNTFNPDNFLPENTSNRHYYSYIPFTAGPRNCIGQ

 

>CYP4G32 SD2: 78% to 4G23 Spodoptera litura (common cutworm) DQ350812

QVDTFMFEGHDTTAAGSSFVLCLLGLHQDVQAKVYDELYQIFGDSDRPATFNDTLQMK

YLERVILETLRMYPPVPIIARELKRDAKIVTNNYVLPAGATIVIATYGIHRHPQHYKD

PDTFNPDNFLPENMANRHYYSYIPFNAGPRNCIGQ

 

>CYP4G33 Chironomus tentans (aquatic midge) AY880065

MAVEQIIQSSVFSSPLLMPLLAIVFVLAAVHFWQMSRRERKIGD

LLPGPPTVPIIGNAYLFMNGTNHEMFKKAVDLVNCYGSVVRGWVGHKLLVGLSDPRDV

EIILGSQVHIDKSDEYRFFRPWLGNGLLISSGDKWRTHRKLIAPAFHMNVLKSFMATF

NDNSRFVIKKLMKEAGKEFDCHDYMSEATVDILLETAMGSKRTSESEEGFKYAMAVMK

MCDILHRRQFKIFSRFEPFFTLTGMKEQQKKLLGIIHGMTQRVLNEKKAIFDKNLSEG

NLPSPSLQEIIKTDASVDQAIKKAKAKAQNIDAGLHDDLDDIDENDVGEKRRLAFLDL

MIETSHYNPQQLSQEEIKQQVDTIMFEGHDTTAAGSSFTLCMLGCHPDIQEKVYQEQK

AIFGDSDRDCTFADTLEMKYLERVIFETLRMYPPVPLIARKINKDIRLASCDQVVPAG

TTIIIATVKIHRRPDIYPNPDKFDPDNFLPERTSNRHYYGFIPFSAGPRSCVGRKYAM

LKLKVLLSTIVRNFYVKSTVPEKDFKLQADIILKRTDGFRIKLEPRKTKAN

 

>CYP4G34 Leptinotarsa decemlineata (Colorado potato beetle) DQ631644

AGPRRCVGRKYAMLKLKVLLAGVLRKFQIHCSETEEDFKLQADIILKKTGGFNISVTERKH

 

>CYP4G35 Aedes aegypti 1.318_1 AAGE01114834 100% to? AAGE01340100? 80% to 4G17

MVIFMTLVLVASALFHFWMISRRYVQLGNKIPGPRAYPFIGNANMLLGMNHNEIMERAMQLSYIYGSVARGWLGYHLVVF

LTEPADIEIILNSYVHLTKSSEYRFFKPWLGDGLLISSGEKWRSHRKLIAPAFHMNVLKTFVDVFNDNSLAVVERMRKEV

GKEFDVHDYMSEVTVDILLETAMGSQRTSESKEGFDYAMAVMK

MCDILHSRQLKFHLRMDSVFNFTKIKQEQERLLGIIHGLTRKVVKQKKELFEKNFADGKLPSPSLSEIIAKEESESKESLPVIS

QGSLLRDDLDFNDENDIGEKRRLAFLDLMIETA

KSGADLTDEEIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQDVQDRVYKEIYQIFGNSKRKATFNDTLEMKYLERVIFET

LRMYPPVPVIARKVTQDVRLASHDYVVPAGTTVVIGTYKVHRRADIYPNPDVFNPDNFLPERTQNRHYYSYIPFSAGPRS

CVGRKYAMLKLKVLLSTILRNYRVVSNLKESDFKLQGDIILKRTDGFRIQLEPRV.

 

>CYP4G36 Aedes aegypti 1.106_1 AAGE01072700.1? 88% to 4G16

MSATVAPADPVMANANIASPMNVFYFLLAPALLLWFIYWRISRQHMLKLAEKIPGPPG

LPLLGNALELIGTSHSVFRNVIEKGKDFNQVIKIWIGPKLIVFLVDPRDVELLLSSHV

YIDKSPEYRFFKPWLGNGLLIST?GHKWRQHRKLIAPTFHLNVLKSFIDLFNENSRLV

VEKMHKEAGKTFDCHDYMSECTVEILLETAMGVSKKTQDQSGFDYAMAVMKMCDILHL

RHRKMWLYPDLFFNMSQYAKRQVKLLDTIHSLTRKVIRNKKAAFATGTRGSLATTSIK

TAEFEKPKSNINTNSVEGLSFGQSANLKDDLDVDENDVGEKKRLAFLDLLLESAENGA

LISDEEIKNQVDTIMFEGHDTTAAGSSFFLSMMGIHQHIQDKVIQELDDIFGDSDRPA

TFQDTLEMKYLERCLMETLRMYPPVPIIARSLKQDLKLASSDLVVPSGATIVVATYKL

HRLETIYPNPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLKVILSTI

LRNFRVISDLKEEDFKLQADIILKREEGFQIRLEPRQRKPKAAKA*

 

>CYP4G37 Spodoptera exigua EF113593

EVDTFMFEGHDTTAAGSSFVLCLLGVHKHIQDRVYNELYEIFGD

SDRPATFADTLQMKYLERVILESLRMYPPVPIIARKLNRDVKIATNNYVLPAGTTVVV

GTLKIHRNPQYYKDPNTFNPDNFLPENTSNRHYYSYIPFFAGPRNCIGQ

 

>CYP4G38 Pediculus humanus humanus (body louse) XM_002423454.1

MTSTVISPETPVGYSASFIFYSLVVSTLVLWYAYFKISRRRMYELAEKLPGPPGIPLF

GNAFEFIGEAPAIFKHVYSHSNTFTDVCKFWIGSKLVVFLINPKDIE(0)LILGSNVH

IDKASEYKFFKPWLGNGLLISTGSHWRSHRKLIAPTFHLNVLKSFITLFNQNSRAVCD

KMNSLNGKEFDCHDYMSEATVEILLE(1)TAMGVNKKTQDKSGYEYAMAVMK(2)MCN

ILHLRHRKFWLKPDVIFNMTKYKKEQESLLDIIHSLTKK(1)VIKKKKEEWNSGIKKT

LASVSDMEQTTEQFKGKSSEVAASAHSYGQSAGLKDDLDVDDNDVG(1)EKKRMAFLD

LMIESAQSGVVMNDNDIKEEVDTIMFE(0)GHDTTAAGSSFFLSLMGLHQDIQEKIVE

ELNEIFGDSDRPATFQDTLEMKYLERCIMETLRMYPPVPLIARQINEDLKLE(1)SGD

YTIPAGTTVVVATYRLHRDANIYPNPEKFDPDNFLPEKSANRHYYAFIPFSAGPRSCV

G(1)RKYAMLKLKILLSTILRKFRVHSNIAEKDYQLQADIILKRAEGFKIRLEPRNKP

FAAAAAAAVA*

 

>CYP4G39 Pediculus humanus humanus (body louse)

MDDTVSQIDFLSATSIFYFLAGIVVLLYIAEKIQSLSRQFKISKSIPGPPGLPYIGVV

HFGLIQPEG(1)LVKFAFELGEAYGSVVKGVLGGKLYIFLSDPRDIEIILSSHTYIDK

SPEYKFFKPWLGDGLLISTG(1)DKWRSHRKLIAPTFHHNVLKSFIGLFNKNSKTIIN

KMEKEIGKTFDVHDYMSTVTVDILIE(1)TAMGINKSHQDNAGYDYAMAVMK(2)MCD

IIHQRMYKIWLRFEWLFQHTSNGVKQKKFLNTIHSLTSR(0)VIKEKKLAFAQNKSIL

SSDIFKMNDEEEAIKSTLEKESKTPFLKDDLDDDGDVG(1)EKKRKAFLDLMLQLQRE

SKLTDEEIKEEVDTIMFE(0)GHDTTAAASSFFLSILGLYPDIQ(0)EKVYKEQYEIF

GDSNRPVTFTDTVNMKYLERVIMETLRLYPPVPTIARQVFEDIKLA(1)SGDFTIPAG

AIVVIGTLKLHRAVEVYGPNAEVFDPDNFLPENIQNRHYYSFIPFSAGPRSCVG(1)R

KYAMLKLKILLSNVIRAYRIYSDIPEKDYCLTADIILKRKEGFQVRIEKRQPLVK*

 

>CYP4G43 Nasonia vitripennis (jewel wasp)

MSAAGPEVVAGSVAAAAASGFSATSVFFTLLVPAILLYYVYFRISRRHMIELS

DKIPGPKGLPLLGNALELIGSSDT(1)IFRNVYKRSFEFDQVIKLWVGPKLVI

FLIDPRDVEVILSSHVYIDKSPEYRFFQPWLGNGLLISTG(1)QKWRAHRKLI

APTFHLNVLKSFIDLFNANSRAVVQKMRKEDEREFDIHDYMSETTVEILLETA

MGVSKSTQDKSGFEYAMAVMK(2)MCDILHLRHTRVWLRPDWLFNLTKYGKEQ

VHLLDIIHGLTKKVIARKKEDYKSGKRNFVDTSAAAKDNKSTTVVEGLSFGQS

AGLKDDLDVDDNDVGEKKRQAFLDLLVEASQNGVVLTDEEVKEQVDTIMFEGH

DTTAAGSSFFLSMMGCHPDIQEKVIQELDEIFGDSDRPATFQDTLEMKYLERC

LMETLRMYPPVPIIAREVKTDLKLA(1)SGDYTIPAGCTVVVATFKLHRQPHI

YPNPDVFNPDNFLPEKTANRHYYAFVPFSAGPRSCVGRKYAMLKLKILLSTIL

RNFRVRSTVKEEDFRLQADIILKRAEGFKVKLEPRKRAAGLKA*

 

>CYP4G44 Nasonia vitripennis (jewel wasp)

MSTSYLPATLFWPLVLIAAALAAVHYYIETSRIVRLGNKLPG(1)PKTVPFFG

NALMALGVQPKDVLTEVMKYDIYGNVARAFLGPKLVVFLVDPRDVEIILGSHV

HIDKSPEYR(2)YFAPWLGEGLLISTGEKWRSHRKIIAPTFHLNVLKSFVPLF

YENSIDLVKRLKSEVGKEFDCHDYMSGITVDILLETAMGVRGTQKEKSSYDYA

MAVMK(2)MCNIIHQRQYNFMLRLDTFFQFTSFAKQQTKFLDIIHGLTKRVIK

KRNVEFKDKMDSPMMNSIMKELKKDSTEIVDEKQPEEQKMRYVRDDLDEIDEN

DVG(1)EKRRLAFLDLMLEMRKNGEQLTDEEIKEEVDTIMFE(0)GHDTTAAG

SSFVLCVLGIHQDVQ(0)DRVIEELNEIFKGSDRPCTFQDTLEMKYLERVILE

TLRLFPPVPAIARQLNQDVKLA(1)SGDYILPSGCTVVIPQFKIHRLKEYYPN

PDVFDPDNFLPDKTQDRHYYAYIPFSAGPR(2)SCVGRKYAMLKLKVLLSTIL

RNYKINSDLTEEDFKLQVDIILKRSDGFRIQIEPRNQAVIV*

 

>CYP4G47 Zygaena filipendulae GQ915319

MSYTTENVIQGGSWAFTSMFYVLLVPALILWYAYWRMSRRHMYE

LAEKLNGPKGLPLFGNALEFTGGSHDIFRNIVSKSTEFDDESVVKIWIGPRLIVFLYD

PRDVELILSSHVHIDKAEDYRFFKPWLGNGLLISTGQKWRSHRKLIAPTFHLNVLKSF

IDLFNANSRAVVEKLKKESGDFDCHDYMSECTVEILLETAMGVSKSTQGQSGFEYAMA

VMKMCDILHLRHTKIWLRPEILFKFTDYAKKQTKLLDVIHSLTKRVIKKRKEEFKSGK

KISLVSENSDGSSSVDAVTNTTTSVEGLSFGQSSGLKDDLDVDDNDVGQKKRLAFLDL

LLEASQSGVVISDEEIKEQVDTIMFEGHDTTAAGSSFFLSMMGIHQDIQDKVIEELDL

IFGDSDRPATFQDTLEMKYLERCLMETLRMFPPVPIIARDIKRDIILPSNNKIVPAGA

TIVIGTYKLHRRPDVYPNPDKFNPDNFLPEKSANRHYYAFVPFSAGPRSCVGRKYAML

KLKIILSTILRNFRVHSDLKEEDFKLQADIILKRAEGFRVSLTPRKKIAKAC

 

>CYP4G48 Zygaena filipendulae GQ915320

MSNIVDDDVAYHYSTSRLVFYPLLLFASGLWLLYRWQQQSRLFK

MGNRLPGPMALPLFGNALLAVGKRPDDLVNVALEYADKYGTVIRGWLGSKLIIFLTDP

DDIEVILNSQIHIDKASEYRFFKPWLGEGLLISSGEKWRSHRKMIAPTFHINVLKSFI

PIFNQNSKNVVEKLKPEIGRVFDVHDYMSEATVDILLETAMGITKKTQTESGFDYAMA

VMKMCDIIHQRHYKLWLRFDALFKLTSFYKQQIKLLNIIHSLTNKVIKSKQKVYLENK

AKGITPPTLEELTRSSDSHEPGAEGDTKTLADQVFKGYRDDLDFNDENDVGEKKRLAF

LDLMIESAQNGTNKISDHEIKEEVDTIMFEGHDTTAAGSSFILSLLGVHQDIQEKVYQ

ELYEIFGTSDRPVTFGDTLRMKYLERVIFESLRMYPPVPIIARKLKRDVKIATNNYVL

PAGSTIVIGTLKLHRDPKYYKNPNVFNPDNFLPENTQERHYYSYIPFSAGPRSCVGRK

YALLKLKVLLATILRNYKTISVVPEEEFKLQADIILKRSDGFRVRIEPRNRVPMSTA

 

>CYP4G49 Manduca sexta Contig_1986_FL sent to genbank

MTSFVDESTGYHVNSRLIFYPLLXLASGFWILYRWQQKSHIYKLGEKIPGPAAVPLFGNA

LIVLKKKPHELVDLGLNYAKQFGNVVRVWLGSKLIVFLTDADDVEVILNSHVHIDKSTEY

RFFKPWLGEGLLISSGEKWRSHRKMIAPTFHINILKSFVSVFNQNSKNVVEKMRSEVGKT

FDVHDYMSGVTVDILLETAMGITRKTQDESGFDYAMAVMKMCDIIHQRHYKFWMRFDAVF

KLTPFFKKQINLLNIIHGLTNKVIKSKKQTYLENKAKGIIPLTIEELTRNVESDENVLAN

SAKTLSDAVFKGYRDDLDFNDENDIGEKKRLAFLDLMIESAQNGTNQITDHEIKEEVDTI

MFEGHDTTAAGSSFTLCLLGIHQHIQDKVYDELYEIFGDSDRPATFADTLKMKYLERVIL

ESLRLYPPVPIIARQLKRDVKIPTKNYVLPAGSTVVVGTYKIHRHEKYYNNPDKFDPDNF

LPENTQNRHYYSYIPFSAGPRSCVGRKYALLKLKILLSTILRNYKSVSDIPEEKFSLQAD

IILKRADGFRMRIEPRKRVQSTAA

 

>CYP4G51 Acyrthosiphon pisum LOC100164072 CYP4G like 64% to CYP4G16

MVTNVQGVNPLFALSAFNLFFYLLTPAIVLWYIYFRMSRKQLYDLASKIPGSEGLPLLGNALDFMQDPHTIFEKIYERSF

EFEKNSPIKMWIGPRLLVFLTDPRDVEVILSSNVYIDKSPEYRLFEPWLGNGLLISTGDKWRAHRKLIAPTFHLNVLKSF

VTLFNVNSRDTVSKLRKMGSSTFDIHDFMSECTVEILLETAMGVSKKTQKKSGFEYAAAVMKMCDILHMRHTNLWLKPDF

IFNFTKYAKEQVGLLDLIHGLTNNVLAKKKEEFLKKKSLMKEVSDIPAASEEIVETSSTLEVEEVPYGNSFGQSAGLKDD

LDVEDDGIGEKKRVAFLDLLIECSENGVVLSDEEVREQVDTIMFEGHDTTAAGSSFFLCLMGAHQDVQQKVVDELYSIFG

DSDRPVTFQDTLQMKYMERCIMETLRMYPPVPIISRQIKEKVKLGEDITLPVGATIVIATFKIHRNEDVFPNPEVFNPDN

FLPEKSASRHYYAYVPFSAGPRSCVGRKYAMLKLKIILSTILRNFKINSNLTEKDWKLQADIILKRTDGFKLSLEPRKSL

AKTAA

 

>CYP4H1      Anopheles albimanus (mosquito) L38682

TASCISFACYYLSRNPVIQQKVYEEIQQIIGPDAKRIELTNSTL

QDLRYLDLVIKETLRMNPSVPIVGRRSAGDMTIDGVLVSKGMVFTVLIYALHNDPELY

PEPERFDPERFSEEAQASRPPYSYI

 

>CYP4H2      Anopheles albimanus (mosquito) L38683

TASCISFACYHLSRNPVIQQKVYEEIQQIIGADATRIELTNSLL

QDLRYLDLVIKETLRMNPSVPIVGRRSAGDMTIDGVLVPKGMVFAVLIYALHNDPELY

PEPERFDPERFSEEAQAARPPYSYI

 

>CYP4H3      Anopheles albimanus (mosquito) L38684

TTSCISFACYHLSRNPVIQQKVYEEIQQIIGPDAKRIELTNSTL

QDLRYLDLVIKETLRMNPSVPIFGRRSAGDMTIDGVPVPKGMEFGILIYALHNDPELY

PEPERFDPERFSEEAQASRPPYSYI

 

>CYP4H4      Anopheles albimanus (mosquito) L38685

TASCISFACYHLSRNPVIQQKVYEEIQQIIGVDAARIELTNSVL

QNLQYLDLVIKETLRITPSVPIVGRRSAGDMTIDGVLVPYGLEFTVLIYALHNDPELY

PEPERFDPERFSEEAQASRPPYSYI

 

>CYP4H5      Anopheles albimanus (mosquito) L38686

TTSGISFTILHLANDQDIQQRLYEEIDRMLGVDKRTTPLTHARL

QEFKYLDMVVKESLRLVPPVPIIGRKLLEDMEINGAMIPAGTSISIKIYNIHRNPAVF

PDPERFDPERFSEDNEIKRGPYDYI

 

>CYP4H6      Anopheles albimanus (mosquito) L38687

TTSGISFTILQLAKHQDVQQKLFEEIDSMFGASARSTVLTSATL

QELKYLDLVIKEALRLRPPVPFIGRKLLEDMEMNGTIIPAGTTISLNIYNVHRNSQVF

PDPERFIPERFSDENEVKRGPYDYI

 

>CYP4H7      Anopheles albimanus (mosquito) L38688

TTSGIAFTFYQLAKHPDIQERLYQEIVHTLGPDYRTVPLTYSTL

QNFKYLDMIVKESLRLLPPVSFIGRRLVEDLELNGVTIPAGTDITIPIYVIHRNPEVY

PDPERFDPERFADESTQRRGPYDYI

 

>CYP4H8      Anopheles albimanus (mosquito) L38689

TTSGISFTIYELARNPDVQERVYQEIVSILGPDHKTAELTYQNL

QEFKYLDLVVKEGLRMYPPVGIIGRALVEDLELNGTIVPAGQNVSVPIYVIHRNPEIY

PNPNQFDPSRFSEEAESKRGPFDYL

 

>CYP4H9      Anopheles albimanus (mosquito) L38690

TTSCLSFALYYLSRHPEIQQKVYDEIKTIYGGVGDLRNLRMTYA

 

SSQEHRYLEMVIKETLRLNPSAPMIGRSSSGDMVIDGVTIPAGTEVLIQIYVMQTDPD

NFPEPDRFIPERFAESAREGGSELGRIIPYSFI

 

>CYP4H12v1  Culex pipiens pallens (mosquito) AF157091 = old CYP4H23v1

MFEGHDTTTSGIAFTILQLAKHQHLRQKVYDEIVAILGQGGSKT

TPLTYNNLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGLDVTVPIYF

VHRNPDVYPDPERFDPERFAEGSEQQQRRGPYDYIPFWAGPRNCIGH

 

CYP4H12v2  Culex pipiens AF191731

TTSGIAFTILQLAKHQHLQQKVYDEIVAILGQGGSKT

TPLTYNNLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGLDVTVPIYI

VHRNPDVYPDPERFDPERFAEGSEQQQRRGPYDYI

 

CYP4H12v4  Culex pipiens pallens CB074950.1

NSLVIEVDTFMFEGHDTTTSGIAFTILQLAKHQHLQQKVYDEIVAILGQGGSKTTPLTYN

NLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGLDVTVPIYIVHRNPDVY

PDPERFDPERFAEGSEQQQRREPYDYIPFSAGPRNCIGQNRIPAA

 

CYP4H12v5  Culex pipiens pallens CB074949.1

GRGNSIEVDTFMFEGHDTTTSGIALTILQLAKHQDLQQKVYDEIVAILGQEGSKTTPLTY

NNLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGRDVTVPIYIVHRNPDV

YPDPERFDPERFAEGSEQQQRRGPYDYIPFTAGPRNCIGQNH

 

CYP4H13 Culex pipiens pallens (mosquito) AF160259

EVDTFMFEGHDTTTSRISFTIWHLAKYQDVQQRLYEEIDRILGE

DKKHAELTNLKVQESEYLDMVVKESLRLIPPVPIIGRCLLEDMEM

DGVTIPAGTNISIKICNIHTNPKIRPNPEKFDPERFSKTNEDKRGPYDYIPFW

AGPRNCIG

 

>CYP4H14 Anopheles gambiae CYPc2r1, 485aa AAAB01008987.1 

MILQALLIAGVVYLLISHLIERKKLQKINKHFPGPKPLPVVGNLLQFAWLDIP         GVFEKVVELHQTHGQDYMMWSLFNWTILMMTSRKNVEKVL                      LAKQTEKALLYQFIEPWLGTGLLIASGEKWFQRRKIITPTFHFKILEQFVRVFNTETDTM  VQLLRKHVGGKEFDIYDYVTLMALDSICETSMGTTVDAQHNPDNQYVQNVKR          MAVLVLLRTISIVGPYPTLYNLFHPNAWEQRRVIKQLHAFTDNVIRSRREQLAKEKAQN   VAFDLNEENLYSKRKLTFLDLLLNVTVEGKPLSNLDIREEVDTFMFEGHDTTTSGISFTI  YELARNPDVQERVYEEIVSILGKDHKTAELTYQNLQEFKYLDLVVKEGLRMYPPVGIIGR 

ALVEDLEL 

NGTTVPAGQNVLVPIYVIHRNPEIYPNPNQFDPSRFAEDAESKRGPFDYLPFSIGARNCI GQRYALMEMKVTLIKLIANYRILPGESLGKLRVKTDLVLRPDIGIPVKIVLRE*

 

>CYP4H14 Anopheles funestus cytochrome AY987354

EVBTFMFEGHDTTTSGISFTIYELARNQDVQERVYEEIVAVLGK

DHKTAELTYQNLQEFKYLDLVVKEGLRMYPPVGIIGRALVEDLELNGTIVPAGQNILV

PIYVIHRNPEIYPNPNQFDPSRFSEDAESKRGPFDYLPFTAGPXNCIGQ

 

>CYP4H15 Anopheles gambiae CYPc2r2, 500aa AAAB01008987.1

MFLVLLTTLLGIAVTCMVVTIIRNRATVAKLKKQLHNFTVIPAIPVLGSAYLFKDPTPEG  IFQTFTGFHRQFGRNLITQSLFNFPSMQVCDPKVIEQIMQARTIEKTIIYDFMVPWLGTG  LVVSTGTKWAQRRKIITPTFHFKILEDFLVIMNHQTDVLIEKLKQNANSTDFDIYEHVTY  CALDIISESAMGVKLNTQQQPNSEYVMAVKE                               ISDIILKRLFSFLREYKWAFQFTKSHRRQEELVKIVHDFAHNVISERKKQLQ          DEREQQLTQEKLEEEDVYGKRRMTLLDLLLNVTIDGKPLSDSDIREEVDTFMFAGHDTT   TSCISFAAYYLSRDATVQQRVYDEILAIVGPDAKTQELTYGTLQELKYLEMVIKETLRMN  PSVPIIGRRSAGDMLIDGVTIPKGMDFGILIYALHNDPELYPEPARFDPERFSEEASEKR  QPYSYIPFSVGARNCIGQRYAMLEVKTMLVKLVANYRFLPCEESNKLRIKTDMTLKPVNG 

TFVKIVPR*

 

>CYP4H15 Anopheles gambiae AY062190 4 aa diffs to CYP4H15 CYPc2r2

2 aa diffs to CYP4H15v2

EVDTFMFEGHDTTTSCISFAAYYLSRDATVQQRVYDEILAIVGP

DAKTQELTYGTLQELKYLEMVIKETLRMNPSVPIIGRRSAGDMLIDGVTIPKGMDFGI

LIYALHNDPELYPEPARFDPERFSEEASEKRQPYSYIPFTAGPRNCIGQ

 

>CYP4H16 Anopheles gambiae CYPn3r1 499aa AAAB01008964.1 

MFVLVAVFVVYLSYLLLKYHQKRQERLKLLRYFPGPQPEYILGCSYLFYNKSIT 

EIFDTIVDSHAQYGKDICLIGAFNMLELEIASAQNIEKVLLAKTTKKSYQYDFLEPWLG

TGLLLSFGEKWFQRRKIITPSFHFKILDQFMDVFNQEADTLVSKLERHVDQQEFDIYDHI

TLYALDSIC 

ATSMGVHINAQKDPNNEYTQGVKKVSEYVFRRIFSVLNQFPALFVLYSYAREQGRIIK

RLHDFTNTVIDTRRKQLARENKPVQVDDYSKHRDTFLDQLLKVRVNGQPLSTADIREEVD  TFMFEGHDTTTSGISFTILQLAKHQDVQQKLYEEIDTVLGESAKTIVLTNALLQELKYLD 

LVIKESLRLVPPVPFVGRKLLEDMEM 

NGTVVPAGTTISLNIFCLHRNPEVFPEPEKFIPERFSDANEIPRGPYDYIPFSAGSRNCI

  GQKYALLEMKVTIVKLLASYRILPGESIDQVRYKADLVIRPSGGIPVKLTRRS*

 

>CYP4H17 Anopheles gambiae CYPn3r3 506aa AAAB01008964.1

MMLLVAIVVVYLSYVLFKYHQKRQQLLEIAKYFKGPRADYFLGCFYLFRNKSVA  EIFDLLNDMHRKYGHDVTMIGAFNDLVLDISSTQNVEKVLLAKTTKKSFPYEFLEPW

LGTGLLLSFGEKWFQRRRIITPAFHFKILDQFMDVFNHEADVLVSKLEKRVNQGEFDIYD

YITLYALDSIC 

ATSMGVQINAQENPNNEYARGVKQMSEFIFRRVFSVLRQFPALFFLYPFAREQGR       VIKKLHDFTNSVINTRRSQLQAEQAVGKVEFNADEDELYSKRRDTFLDQLLKVTIDGKPL  STADIREEVDTFMFEGHDTTTSGISFTILQLAKHQEIQQKLYEEIDGMLGAEAKSTVLTS  ALLQDMKYLDLVVKESLRLVPPVPFIGRKLLEDMEM 

NGTTIPAGTTISLNIFNVHRNPKVFPEPEKFIPERFSDANEIKRGPYDYIPFSAGFRNCI  GQKYALLEMKVTLVKLLASYRILPGESIDQVRYKTDLVLRPTGGIPVKLVKRR*

 

>CYP4H18 Anopheles gambiae CYPn3r2 507 aa AAAB01008964.1 

MFWLVTLLAVYVAYLLLKYHQQRQKLLAIRAKFGGPESSYFLGTFYLFKDKSIP DIFDLVVGLHKRYGQDVAIIGAFNDLVLDLSSSKNVEKILLAKTTKKSFVYDYLEPWLGT

GLLISFGEKWFQRRKIITPAFHFKILDQFIDVFNEEADVLISKLQKHVGKGEFDIYDYVTLYALDSIC 

ATSMGVRIHAQDDPNNEYAQAVKQMSVFFLRRVFSLLRQFPSLFFLYPFAREQGRVIKKL 

HHFTNTVIESRRAQLEQEQRLGKQEFDVNEEDLYSKRRNTFLDQLLKVSIDGKPLSTADI 

REEVDTFMFEGHDTTTSGISFTILHLAKHQDVQQRLYEEIDRMLGEEKTNVPLTNALLQD  FKYLDMVIKESLRLVPPVPIIGRKLLEDMEI 

NGAIIPAGTSISIKIFNIHRNRTVFPEPERFDPERFSEANEIKRGPYDYIPFSAG

SRNCIGQRYALLEMKVTIVKLLASYRILPGESAGRIRYKTDLVIRPTEGIPVKLLKRTA*

 

>CYP4H19 Anopheles gambiae  CYPa1x1 514aa AAAB01008846.1 no introns 

MLVVVFLVTLLVLAVLREYRDRKRLQHIASHFQGPKPHWLLGYLPLFPVNDIPGIFETMV KLHDRYGQDLFNWGLLNDHMVVVTSAANVEKVVMAKKTQKSQIYEFIEPWLGQGLLISSG EKWFHRRKIITPTFHFKILESFVTVFNREAELLIEKLGQNADAGREFDIYEPISLYALDS ICETSMGVEINAQHNPENQYVRDVKRMSELVLLRIFHVLSAFPRTFWYTMPNAWEQRKLI GRLHAFTDSVIQSRRRQLLAAVEQGTVGNQETHADDLYGAKQRSSFLDLLLNVTVGGKPL SDADIREEVDTFMFEGHDTTTSGIAFTFYQLAKHPEIQEKLHQELQDVLGVDYRHVPLTY NTLQNFPYLDMVVKESLRLLPPVSFIGRRLVEDIQMNGVTIPAGTDFTIPIYVIHRNPAV FPDPERFDPERFSDANQHPPGPYDYIPFSAGSRNCIGQRYALLEMKVTVIKMLAHFRVLP GEQMPQVRFKTDLVLRPDKGIPIKLVRRKFDSIK* 9849982 

 

>CYP4H21v1  Culex pipiens AF208660

TTSGISFTIWHLAKHQDVQQKLCDEIDQILGTEKKTAELNNVKI

QEFEYLDMVVKESLRLIPPVPIIGRQLIEDLEMDGTTIPAGTQINIKIYNIHRNPKIW

PDPERFDPDRFSKTNEDKRGPYDFI

 

>CYP4H21v2  Culex pipiens pallens CB074948.1

GRGNSIEVDTFMFEGHDTTTSGISFTIWHLAKHQDVQQKLCDEIDQILGTEKKTAELNNV

KIQEFEYLDMVVKESLRLIPPVPIIGRQLIEDLEMNGTTIPAGTQINIKIYNIHRNPKIW

PDPERFDPDRFSKTNEDRRGPYDYIPFTAGPRNCIGQNH

 

>CYP4H21v3  Culex pipiens pallens CB270837.1

GRGNSIEVDTFMFEGHDTTTSGISFTIWHLAKHQDVQQKLCDEIDQILGTEKKTAELNNV

KIQEFEYLDMVVKESLRLIPPVPIIGRQLIEDLEMNGTTIPAGTQINTKIYDIHRNPKIW

PDPERFDPDRFSKTNEDKRGPYDYIPFTAGPRNCIGQNH

 

>CYP4H22v1  Culex pipiens AF190782

TTSCISFAAYHIARNTAVQHKLYDEMVQVLGPDFKNAQLTYSNL

QELKYLEMTIKEVLRIHPSVPVIGHKSAHDMIIDGSKVPPGIDVAILIYAMHNNPAVF

PEPTRFDPERFNEENSSKRHPYAYV

 

>CYP4H22v2  Culex pipiens AF190784

TTSCISFAAYHIARNPAVQQKLYDEMVQVLGPDFKNAQLTYSNL

QELKYLEMTIKEVLRIHPSVPVIGRKSAHDMIIDGSKVPPGIDVAILIYAMHNNPAVF

PEPTRFDPERFNEESSSKRHPYAYV

 

>CYP4H22v3  Culex pipiens pallens CB074946.1

NSLVIEVDTFMFEGHDTTTSCISFAAYHIARNPAVQQKLYDKMVQVLGPDFENAQLTYSN

LQELKYLEMTIKEVLRIHPSVPVIGRKSAHDMIIDGSKVPPGIDVAILIYAMHNNPAVFP

EPTRFDPERFNEENSSKRHPYASVPFTAGPRNCIGQNRIPAA

 

>CYP4H23v2  Culex pipiens AF190787

TASAITFILFSLAKHPDIQQKVYEEVRSVFGDAKDTPTTLSSLN

DLKYLELVIKESLRMFPPVPFISRNTSKQVSLAGLTVPPNTNISIGIYNMHHNPDYFP

DPERFVPERFEAERGAEKLNPYAYV

 

>CYP4H23v3  Culex pipiens AF191729

TASAITFILFSLAKHPDIQQKVYEEVRSVFGDAKDTPTTLSSLN

DLKYLELVIKESLRMFPPVPFISRNTSKQVTLAGLTVPPNTNISIGIYNMHHNPDYFP

DPERFVPERFEAERGAEKLNPYAYV

 

>CYP4H23v4  Culex pipiens AF190783

TASAITFILFSLAKHPDIQQKVYEEVRSVFGDAKDTPTTLSSLN

DLKYLELVIKESLRMFPPVPFISRNISKQVSLAGLTVPPNTSISIGIYNMHHNPDYFP

DPERFVPERFEAERGAEKLNPYAYV

 

>CYP4H24 Anopheles gambiae CYPa1x2, 509aa AAAB01008846.1 no introns 9849469

MSFVLFLLVILIVYGLAQVYRKRRRLHRIAAHFDGAKPHWLLGNVMEYPANDIPGIFE   TMVALHKRHGKDLFNWGLLNDHMITVSSAANVEKVVMAKRTEKSSVYEFIELWLGQGLLI SKGEKWFHRRKIITPTFHFKILESFVTVFNQEAEILIEKLSQNADTGREFDIYEPISLYA LDSICTTSMGVEINAQRHPENQYVRDVKRMSELILLRIFHVLSSFPRTYWYTMPNAWEQR KLIRRLHAFTDTVIHKRREQLLERSSQVSNEQECLDEEHLYTKRRETFLDLLLNVRVDGN SLSDLDIREEVDTFMFEGHDTTTSGIAFTFYQLAKHPEIQEKLYREIQDVLGGEYRHVPL TYNTLQNFPYLDMVVKESLRLLPPVSFIGRRLADDIEMNGVTIPAGTDFTIPIYVIHRNP VVYPDPERFDPERFSDGNTQRRGPYDYIPFSIGSRNCIGQRYALLEMKVAIVRMVSFYRI

LPGDTMHEIRLKTDLVLRPDKSIPIKLVARP* 9847940 

 

>CYP4H25 Anopheles gambiae CYPc2r3,503aa AAAB01008987.1

MFLVLLTTFFGIAITWLAVTIMRNRATVSKLKKQLPHFTVIPAIPVLGSAYHFKDPTPEG IFNTFTGFHKQYGRNLIAQGLFNVPSMQITDPKVIEQIMQARTIEKTIIYDFMIPWLGTG  LAISTGAKWAQRRKIITPTFHFKILEDFLVIMNHQTDVLIEKLKQNANSTDFDIYEHVTY  CALDIISESAMGVKLNTQQQPNSEYVMAVKE                               VSDIILKRLFSFLREYKWAFQFTKAHRRQEELVKIIHSFAYQVISERKKQLEDERERKRTQEKLEE

EDVYGKRRMTLLDLLLNVTIDGKPLSDSDIREEVDTFMFAGHDTTTSCISFAAYYLSRDA  TVQQRVYDEILAIVGPDAKTQELTYGTLQELKYLDMVIKETLRINPSVPIIGRRSAGDML  IDGVTIPKGMDFGILIYALHNDPELYPEPARFDPERFSEEASEKRQPYSYIPFSVGARNC  IGQRYAMLEIKTMLVKLVANYQLLPCDERNKLRIKTDMTLKPVDGAFIKIVPR*

 

>CYP4H26 Anopheles gambiae CYPc2r4, 507aa AAAB01008987.1

MAVSVLLLFLLATVLLLSALYIALKVVRNRNRAVALLKQLPNFRALPSVPLLGSAHLFLDTTPDG

TLRTIVDCHQRYGRNLLLQELGNEFKLLTCDPRVIEQVLQAKTIVKSNFYRFLLPWIGLS 

SVVVSGHRWHNRRKVINPGFNYRMLQGFLPTMDAQAAVLVAKLAPHAGGPAIDVDEPLRC 

MAMDIICETAMGVRLGCQSNPAVPFFKDCEE

LLDLIYKRIFNPLLTYDLVYACTRAGRRANATIRALHQFTRSVIRERVKQMQAVLPNSQQ 

PAPEESQEQQHRSTFLDLLLQTRLAGDKLLSDDDIRGEVNTFMFAGHETVTSCLSFT

LYYLSRYPDVQQRLYEEIATMAKAPVLTYGTLMELKYTELVIRETLRLNPSVPMIG

RMAAGDMEIDGVTIPTGTEVMLNIYVMQNDPQYYPDADQFRPERFLQEPPPYSYLP

FSTGVRSCIGQRFAMLEMKTVLVRLLSRFRFVPCGEENALQVKANLTLKPYHGAFVKLVDRH*

 

>CYP4H27v1 Anopheles gambiae CYPs3r1 511 aa AAAB01008944.1 plus strand 

MFLVLLSICLGTAFAWMIVTILRNRVAVLMLQKRLPNFKVVPAIPVFGSTYHFKDLSAEG  LFTTFIGLHKLYGKTLITQSLFNLPSLHVSDAKVIGQIMQARTVEKTIVYDFMTPWLGTG  LIVSTGSKWTQHRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY  CALDIIAESAMSVKLNTQQHPNSEYVLAVKE                               MTDIILKRLFSLFREYKWAFQFTKAHRRQRELVKVIHDFAYKVISDRKKQLYSDAQEQQR  AQKQLAEEAVYGKRRMTLLDLLLNVTMDGKPLSDSEIREEVDTFMFTGHDSTTSSISFTA  YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRINPPVPVIGR  RSVGDMVIDGVTIPKGLDFFIMIYLLHNDPELYPEPTRFDPERFSEEASVKRPPYSYMPF  SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKTDMTLKPVNGVFVKLVRR*

 

>CYP4H27v2 Anopheles gambiae 95% to to 4H27v1, AAAB01008530.1

MFLVLLSICLGTALAWMIVTILRNRATVLMLQKRLPNFKVVPAIPVFGSTYHFKDLSAEG  LFTTFIGLHKLYGKTLITQSLFNFPSLHVCDGKVIGQVMQARTVEKTIVYDFMTPWLGTG  LIVSTGSKWTQRRKIITPSFHFKILEDFIVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY  CALDIIAESAMSVKLNTQQHPNSEYVLAVKE                               MTDIILKRLFSLFREYKWAFQFTKAHRRQRELVKVIHDFAHKVISDRKKQLHSDAQEEQR  AQKQLAEEDVYGKRRMTLLDLLLNVTMDGKPLSESEIREEVDTFMFTGHDSTTSSISFAA  YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRINPPVPVIGR  RSAGDMVIDGVTIPKGLDFFLVIYSLHNDPELYPEPTRFDPKRFSEEASVKRPPYSYMPF  SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKTDMTLKPVNGVFVKLVRR*

 

>CYP4H28 Aedes aegypti 1.85_2 AAGE01082714.1 CYP4H28 4T2.2

MLAILVSLATVAFLWLVYQRRMARAAKIAAYFPHPKPVLPLLGNSLMFANKDAPAIFHTVLDLHKQCGQNLVTYGLFGDV

QLHISSPKAIERVLLSKVTKKNYIYEYLEPWLGTGLLLSFGEKWFQRRKIITPTFHFKILEQFLEVFNAETDRLVTKIEQ

HVGGEEFDMYQYITLHALDSICETSMGVSINALDNPDNAYVHAIKDFGSIVIQRTFSALRSFPLLYFLHPFYWRQQKLIK

TMHNFTNSVIKAKRQALEEKRHTEGETKEHNEDDGIYGKKRMSFLDLLLNESSMSDADIREEVDTFMFEGHDTTTSGIYF

SLMALAMHPDIQERLYGEIRQVLETEEERHAPLTNATLQQMKYLDMVIKEVLRVYPSVPIIGRELLEDVEINGCQVPRGT

AMVVIIHNVHRNAEVFPDPERFDPERFSDESGGKRGPYDYIPFSVGARNCIGQKYALLEMKVTLVKLLLAYRFIPGKSTD

SIRIQGDLVLRPFGNMALRIESR.

 

>CYP4H28 4T2.2 66% to 4H18, 57% to 4I1.8

 DTFMFEGHDT TTSGIYFSLM ALAMHPDIQE RLYGEIRQVL ETEEERHAPL

 TNATLQQMKY LDMVIKEVLR VYPSVPTIGR ELLEDVEING CQVPRGTAMV

 VIIHNVHRNA EVFPDPERFD PERFSDESGG KRGPYDYIPF SVGARNCIGQ

 KFA

 

>CYP4H29 Aedes aegypti 1.285_1 4H29? AAGE01010708 CYP4H29 4I1.8

MVPLLMLISLLASALIWVLSALVKNLLVYRELQRKLPNFVSTPTVLLLGNTHLFKKDPTPPGIFATFNQFHRTYGNDLIV

QGLLNRPALQITSAPVVEQVLQARTIKKSIIYEFMRPWLNEGLITSLGKKWAQRRKIITPAFHFKILEEFLAIFNERTEV

FVDKIKDQVGKGDFNIYEHVTLCTLDIISESAMGVKLNAQDDPNSSYVQAVKEMSEIIFQRLFGLLRMHKFFFQMSEAAQ

RQRAALKVLHKFTDSVIFQRKDQLDDEQARQESKQKLEETDIYGKRKMTLLELLLNVSVEGHHLSNSDIREEVDTFMFAG

HDTTTSCISFSAYHIARHPEVQQKLYDEMVQVIGKDFKNAELSYSTLQELKYLEMTIKEVLRIHPSVPIIGRKTTGDMRI

DGETVPAGVDIAVLIYAMHNNPEVFPEPEKFDPERFNEENSAKRHPYSYIPFSAGPRNCVGQKYALLEIKVTLVKLLGHY

RLLPCEPENEVKVKSDITLRPVNGTFVKIVPR.

 

>CYP4H29 4I1.8 66% to 4H16, 66% to 4H25, 57% to 4T2.2

 MFEGHDTTTS CISFSAYHIA RHPEVQQKLY DEMVQVIGKD FKNAELSYST

 LQELKYLEMT IKEVLRIHPS VPIIGRKTTG DMRIDGETVP AGVDIAVLIY

 AMHNNPEVFP EPEKFDPERF NEENSAKRHP YSYIPFSAGP RNCIGQKFA

 

>CYP4H30 Aedes aegypti 1.85_1 AAGE02005220.1 65% to 4H14

MITLVLVAGVVLYFLRSFLQKRNKLLKIANHFGGPKPLPVIGNLLEFNTDIP ?

GIFEKIVHLNHTYGPNLFVWGFLNENVLFLGDTKLVEKVLLAKQTQKSLLYSYLTCWLRTGLLLAS?

GEKWFQRRKIITPTFHFKVLEQFVTVFNREAQTMVDVMRKHVGGKEFDVYSYVTLMALDSVC

ETSMGTSVNAQKDPDNRYVRNVKR

MSVLFLLRVIHPLATHPELYSLIHPNAYEQRKIVRELHEFTDNVIATRRKQLKSGQM?

LDINRNVEDRYSKQKMTFLDLLLNVNIDGKPLTDLDIREEVDTFMFE?

GHDTTTSGISFTIYQLALNPHVQDKIYEEIVAILGKNHKTVELTYQSLQEFKYLEMAI?

KEGLRLFPSVPFIGRNLVEDLEF 

DDITLPAGQDILIPIYMIHRNPEIYPDPERYDPERFSDGTESKRGPYDYIPFSAGTRNCI?

GQRFAMLEMKAALIKLIGNYRILPGESLKKLRIMTDLVVRPEKGVPIRLEERV*?

 

>CPIJ007188 CYP4H30 Culex quinquefasciatus synonym Culex pipiens

69% to CYP4H30 Aedes, probable ortholog

XM_001849242.1

65% to CPIJ001886, 57% to CPIJ006721, 53% to CYP4H34, 55% to CYP4H38

MLLQAVLAGVVSYLVVKFVLQRNQLKKIAAHFGGPKPLPVIGNLLEFNTDVPGIFEKGIQLLHRHGPDMFVWGLLNQNVL

VMSSSTNAEKVLLAKATQKSVLYSFLQPWLRTGLLLSSGEKWFQRRRIITPTFHFKILDQFAAVFNREADTMVGNLRRHA

GREEFDIYAYVTLMALDSICETSMGISVNAQNDPNNKYVQNVKRMSVLFLLQVVNILGGYPTLFSILHPHAYEQRRIVRE

LHQFTDSVIARRRQQLADQTADLNQRSDGSEKQRMTFLDLLLNVTSEGEPLSDTDIREEVDTFMFEGHDTTTSGISFAIY

ELARNPAVQDKIYDEIVSILGKDPNSHEITFQVLQEFKYLEMVIKETLRLYPSVPFIGRNVVEPIKLDGITLPPGQDIIV

SIYMIHRNPRVFPDPERFDPERFADGAESRRGPYDYIPFSAGARNCIGQRFAMMELKVTLIKLIAAYRILPGESMAQLRL

KTDLVLRPDRGIPVKIVARVSDY.

 

>CYP4H30v1 Anopheles gambiae 4 DIFFS WITH 4H30v2, AAAB01008944.1 plus strand partial seq.

MFLVLLAMCLGVVFLWQMFFTICRNRATVLMLQKRLPNFKVIPAIPVFGLMYHFKDPSAE  GIFNTFCDFDTQYGKTLITQSLFNFPSIHVCDAKVIGQIMQARTIEKTIIYDFMTPWLGT  GLIVSTGSKWTQHRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVT 

YCALDIIAESAMSV

 

>CYP4H30v2 Anopheles gambiae 90% to 4H27, AAAB01008530.1 89454-91048 plus strand 

MFLVLLAMCLGVVFVWMFFTICRNRATVLMLQKRLPNFKVIPAIPVFGSMYHFKDPSAEG IFNTFCDFDTQYGKTLITQSLFNFPSIHVCDAKVIGQIMQARTIEKTIIYDFMTPWLGTG  LIVSTGSKWTQRRKIITPAFHFKILEDFLVIMNHQSDVLIEKLKTSANGTDCNIYNHVTY  CALDIIAESAMSVKLNTQQHPNSEYVLAVKE                               MTDIILKRLFSLLREYKWAFQFTKAHRRQRELVKVIHDFAHKVISDRKKQSDAQELQR    AQKHLAEEDVYGKRRMTLLDLLLNVTMDGKPLSESEIREEVDTFMFTGHDTTTSCISFAA  YHLSRDASIQQRVYDEILAIVGPDAKTVELTYGTLQKLKYLEMVIKETLRVNPPVPVIGR  RSAGDMVIDGVTIPKGLDFFIMIYLLHHDPELYPEPTRFDPERFGEEASAKRPPFSYMPF  SAGSRNCIGQRYAMLEVKTVLVKLLANYQLLPCEASNQLRLKADMTLKPVNGAFVKLVPR*

 

>CYP4H31 Aedes aegypti 1.48_5 AAGE01049176 67% to 4H14

MLFLAIVVGALLYLVVNFYVTRKPLERMAVHFSGPKPHYLLGNVLEFLNKDLPGIFETMVGFHRKYGQDILTWNVLNLNM

ISVTSAENVEKVLMAKQTKKSFLYSFVEPWLGQGLLISSGEKWFQRRKIITPTFHFKILEQFVTVFNKETDTMVENLKKH

VDGGEFDIYDYVTLMALDSICETSMGTCVNAQKNPTNRYVQNVKRMSVLVLLRTISVLAGSPLLYDILHPHAWEQRKIIK

QLHEFTISVIESRRRQLEADKLEQVDFDMNEESLYSKRKMTFLDLLLNVTVEGKPLTNADIREEVDTFMFEGHDTTTSGI

SFAIYQLALNPQIQDKLYDEIVSILGKNSSNVELTFQTLQDFRYLESVIKESMRLFPPVPFIGRTSVEDMEMNGTTVKAG

QEFLVAIYVIHRNPKVYPDPERFDPERFSDTAESKRGPYDYIPFSAGSRNCIGQRYAMLEMKVTLIKLLMNYKILPGESM

GKVRVKSDLVLRPDRGIPVKLVARS.

 

>CPIJ001886 CYP4H31 Culex pipiens 79% to CYP4H31 probable ortholog

MLIEIVLGGALLYLAVSFFITRKELKRVAAYFGGPKPHPVLGNVLEFANKDLPDIFATMVGFHKLYGQDLVTWSLFNLNQ

ISVTSAVNVEKILMAKKTQKSFLYSFVEPWLGQGLLISSGEKWFQRRKIITPTFHFKILEQFAAVFNKETDIMVQNLRKH

VNGKEFDIYEYVTLMALDSICETSMGTCVNAQNNPLNRYVQNVKRMSILVILRTVSPLAGFPLLYNILHPAAWEQRGIIK

ELHHFTDSIIKSRRKQLSQEKHEQVDFNMNEENLYSKRRMTFLDLLLNVTVEGKPLSDLDIREEVDTFMFEGHDTTTSGI

SFTIFQLAKHPDVQERVYDEVVSILGKDSTNKELTFQMLQDFRYLESVIKEAMRLFPPVPFIGRKLVDDIEMNGTTIKAG

QDFLVPIYAIHRNPKVYPDPERFDPERFSDTAESRRGPYDYIPFSAGSRNCIGQRYAMMEMKTTLIKLIHNYKILPGESL

RELRVKTDLVLRPDRGIPVKIMARN.

 

>CYP4H32 Aedes aegypti 1.283_1 AAGE01321728.1 JP_16 3aa

diffs use this seq 57% to CYP4H14

MFNFAVFLVILVVGLARFCINRSKLQQLAKHFPGPKPALLVGNLLQFPADIGGIFRRM

VYYHEKFGPDIVTWGIGNTLKFNVSSTRNVEKVLMAKTVQKSLSYSFIEPWLGKGLLT

STGRKWFQRRKIITPTFHFTILEGFAEVFNRNADTLIDKLKVHEGGSEFDVYRYVSLY

ALDSICETAMGVQVHAQDDPENQYVRDVNRLSELFLLRIFSFLGMFPTLYWYLHPNAW

EQRKLIRTLHQFTDNVIWKRREQLMNGPRNDEMDNTTSSKKKQTFLDLLLCMSVEGQS

LSNEDIREEVDTFMFGGHDTTSSAISFTIMQLALHQDIQDKLYAEIVSILKGQNLKTT

HLTFNNIQDFKYLDLIVKESLRLLPPISYVGRKLTEDTELNGATIPAGQDIFIPIYMV

HRNPKIYPDPERFIPERFAENAENLRGPYDYIPFSIGSRNCIGQKYGMMQLKMTVVRL

IANFRVLPSEATASVKLRTDLVLRPEYGIPIKIEARN.

 

>CYP4H33 Aedes aegypti 1.923_1 AAGE0107691 68% to 4H18

MLLILTLIFATVGYALFNYHRQRQKLLNIRSHFDGPDSHYLWGTFPMFIGKTIPDIWDIITDLHKKHGEDIAIIAAFNEL

VMDLSSSKNVEKVLLAKSIKKSFAYDFLEPWLGTGLLISTGEKWFQRRKIITPTFHFSMLEGFLEVFNKEANILVSKLKA

KAGKDEFDIYDYVTLYALDSICETSMGVQINAQDDPNNEYAVAVKQMSTFILRRVFSILRTFPSLFFLYPFAKEQKKVIL

KLHNFTNSVIDARRAMLEKEKSNKNVTFDLQEENMYTKRKMTFLDLLLNVTVNGKPLSREDIREEVDTFMFEGHDTTTSG

ISFTLWHLAKYQDVQQKLFEEIDRVLGKDKVNAELTNLQIQELDYLDMVVKESLRLIPPVPIIGRTLVEDMEMNGVTIPA

GTQISIKIYNIHRNPKIWEKSDEFIPERFSKTNESKRGPYDFIPFSAGSRNCIGQRYAMMELKVTIIKLIASFKVLPGDS

MDKLRFKTDLVIRPDNGIPIKLVERI*

 

>CPIJ011127 CYP4H34 Culex pipiens 98% to CYP4H34 Culex_quinquefasciatus

MLLFAILAGLLALALFQAYQTRQRVLRYTRKFGCPEPHWLFGHLLNFPKDPVGITMHTIEIQKQYGPDTVLWRLGNDHQL

IIGTAKNAEKVLMPKDTAKANVYGFVEPWLGNGLLISTGEKWFQRRKIITPTFHFKILESFVEVFNKETDVLVNNLRTHV

GKGEFDIYDPISLYALDSICSTSMGVHINALAEPTNQYVSDVKAMSELVLKRIFHPLNPYPKLFWLTTPNAREQRKLIAR

LHQFTDSVIKKRRQEMANQPKEPEPTDPSTDLYSKKRQTFLDLLLNVTVNGRPLSDSDIREEVDTFMFEGHDTTTSGISF

TIYQLAKHQDIQEKVYQEILSLLGAEDSKTAPLNQNTLQNFKYLEMVLKEAMRIMPPVAFIGRKIQADTEMNGVIVPAGT

DITVSIRQIHRNPAVYPKPDRFDPERFSEHAEHKRGPFDYIPFSVGSRNCIGQRYAIMEMKITLIRLLANYKILAGESLN

DLRFKMDLVLRPVDGIPIRVQARK.

 

>CYP4H34 Culex_quinquefasciatus_04

58% to CYP4H31 Aedes, 66% to 4H12v5 and 4H12v4

MLLFAILAGLLALALFQAYQTRQRVLRYTRKFGCPEPHWLFGHLLNFPKDPVGITMHT

IEIQKQYGPDTVLWRLGNDHQLIIGTAKNAEKVLMPKDTAKANVYGFVEPWLGNGLLI

STGEKWFQRRKIITPTFHFKILESFVEVFNKETDVLVNNLRTHVGKGEFDIYDPISLY

ALDSICSTSMGVHINALAEPTNQYVSDVKAMSELVLKRIFHPLNPYPKLFWLTTPNAR

EQRKLIARLHQFTDSVIKKRRQEMTNQPKEPEPTDPSTDLYSKKRQTFLDLLLNVTVN

GRPLSDSDIREEVDTFMFEGHDTTTSGISFTIYQLAKHQDIQEKVYQEILSVLGAEVS

KTAPLNQNTLQNFKYLEMVLKEAMRIMPPVAFIGRKIQADTEMNGVIVPAGTDITVSI

RQIHRNPVVYPEPDRFDPERFSEHAEHKRGPFDYIPFSVGSRNCIGQRYAIMEMKITL

IRLLANYKILAGESLKDLRFKMDLVLRPVDGIPIRVQARK

 

>CPIJ010075 CYP4H35 Culex pipiens 100% to CYP4H35 Culex_quinquefasciatus

5 aa diffs to 4H22v1 Culex pipiens partial seq

3 aa diffs to 4H22v2 Culex pipiens partial seq

8 aa diffs to 4H22v3 Culex pipiens partial seq

MLAILVSALVAVLVTWVVTTTARHLLLVRKLQRLLPKFGTVPSVPVLGNTFLYRKDPTPPGIFATFFGFHRRYGDDLITQ

SLFNQPVLQVTSAPVVEQVLNAKTVKKSIIYEFMKPWLNEGLITALGKKWAQRRRIITPAFHFKILEEFLDIFNRRSEDF

VRKLRTRVGKGDFNIYEDVTLCTLDIISESAMGVKINAQDNPDSPYVKAVKEMSNIIFRRLFSMMREYKIFFHLQKAAQR

QKAALAVLHSFTDSVIVTRKTQLESEQAREATQQKLEETDIYGKRKMTLLELLLNVSVDGHPLSNADIREEVDTFMFAGH

DTTTSCISFAAYHIARNPAVQQKLYDEMVQVLGPDFKNTQLTYSNLQELKYLEMTIKEVLRIHPSVPVIGRKSAHDMIID

GSKVPPGIDVAILIYGMHNNPAVFPEPTRFDPERFNEENSSKRHPYAYVPFSAGARNCIGQKYALLEIKATLVKLLGHYR

LGACDPANTVRIKTDMTLRPVNGTFVKIVER.

 

>CYP4H35 Culex_quinquefasciatus_08

74% to 4H29 Aedes, 59% to 4H15 Anoph., 59% to 4H25 Anoph.,

40% to 4D1, 44% to 4H34, 45% to 4D40

The 4H subfamily seems to need to be split

MLAILVSALVAVLVTWVVTTTARHLLLVRKLQRLLPKFGTVPSVPVLGNTFLYRKDPTPP

GIFATFFGFHRRYGDDLITQSLFNQPVLQVTSAPVVEQVLNAKTVKKSIIYEFMKPWLNE

GLITALGKKWAQRRRIITPAFHFKILEEFLDIFNRRSEDFVRKLRTRVGKGDFNIYEDVT

LCTLDIISESAMGVKINAQDNPDSPYVKAVKEMSNIIFRRLFSMMREYKIFFHLQKAAQR

QKAALAVLHSFTDSVIVTRKTQLESEQAREATQQKLEETDIYGKRKMTLLELLLNVSVDG

HPLSNADIREEVDTFMFAGHDTTTSCISFAAYHIARNPAVQQKLYDEMVQVLGPDFKNTQ

LTYSNLQELKYLEMTIKEVLRIHPSVPVIGRKSAHDMIIDGSKVPPGIDVAILIYGMHNN

PAVFPEPTRFDPERFNEENSSKRHPYAYVPFSAGARNCIGQKYALLEIKATLVKLLGHYR

LGACDPANTVRIKTDMTLRPVNGTFVKIVER*

 

>CPIJ008937 CYP4H36 Culex pipiens 100% to CYP4H36 Culex_quinquefasciatus

72% to CYP4H29 Aedes probable ortholog

MLALLVSALLAVSITWLVTTIVRNMLLVKKLQRLLPKFATIPSVPVLGNSLEFRKDPTPPGIFRTFFGFHRRFGENVITQ

SLFNFPSLQVTSGPVVEQVINTKTIQKSIIYEFMKPWLGEGLLTALGKKWAQRRKVITPAFHFKILEEFLDIFNQRSEDF

VGKLRDRVGKGDFNIYEDVTLCTLDIISESAMGVKINAQDNPDSSYVKAVKEMSDIIFRRLFSMMREYKVFFYMQKAAKR

QKAAVAVLHDFTDSVIVTRKTQLESEQARKATQQKLEETDIYGKRKLTLLELLLNVSVDGHPLSNSAIRAEVDTFMFAGH

DTTTSCISFAAYHIARNPSVQQKLHEEMTQVLGSDFKNTQLTYSMLQELKYLDMTIKEVLRIHPSVPVIGRKSAHDMVID

GQKIPPGIDIAVLIYAMHNNPGVFPEPDRFDPERFNEENSTKRHPYAYIPFSAGARNCIGQKYALLEIKATLVKLLGHYR

LLACDPENTVRIKTDMTLRPVNGTFVKIVER.

 

>CYP4H36 Culex_quinquefasciatus_09

72% to 4H29 Aedes, 60% to 4H15 Anoph., 44% to 4H34

MLALLVSALLAVSITWLVTTIVRNMLLVKKLQRLLPKFATIPSVPVLGNSLEFRKDPTPP

GIFRTFFGFHRRFGENVITQSLFNFPSLQVTSGPVVEQVINTKTIQKSIIYEFMKPWLGE

GLLTALGKKWAQRRKVITPAFHFKILEEFLDIFNQRSEDFVGKLRDRVGKGDFNIYEDVT

LCTLDIISESAMGVKINAQDNPDSSYVKAVKEMSDIIFRRLFSMMREYKVFFYMQKAAKR

QKAAVAVLHDFTDSVIVTRKTQLESEQARKATQQKLEETDIYGKRKLTLLELLLNVSVDG

HPLSNSAIRAEVDTFMFAGHDTTTSCISFAAYHIARNPSVQQKLHEEMTQVLGSDFKNTQ

LTYSMLQELKYLDMTIKEVLRIHPSVPVIGRKSAHDMVIDGQKIPPGIDIAVLIYAMHNN

PGVFPEPDRFDPERFNEENSTKRHPYAYIPFSAGARNCIGQKYALLEIKATLVKLLGHYR

LLACDPENTVRIKTDMTLRPVNGTFVKIVER*

 

>CYP4H37 Culex_quinquefasciatus_10

62% to 4H19 Anoph., 62% to 4H31 Aedes, 59% to 4H34

MIYLALGAGLLTIFAVRYLLEQRRLLRIAGHFSGPKAYPFVGSMLEFAGRDIPGIFQRMV

EMHDEYGRDFAVWGTGSELMFVFSSARSVEKVLMAKATQKSDLYTMIEPWLGRGLLISSG

EKWFHRRKIITPTFHFKILEGFAEVFNRETGVLVEKLRKHDGKEEFDVYDYVTLLALDSI

CETSMGVHVNAQQNPNNQYVCDVKRMSELILLRIFSVFSSLKTFYWYLMPKAWEQRKLIK

RLHQFTDSVIQKRRKQLQQDKQLGSVEFDLNEADMYSKRKQTFLDLLLNVTVDGKPLSDE

DIREEVDTFMFEGHDTTTSGIAFTILQLAKHQHLQQKIYDEIVAILGQEGSKTTPLTYNN

LNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGLDVTVPIYIVHRNPDVYP

DPERFDPERFAEGSEQQQRRGPYDYIPFSVGSRNCIGQRYAIMELKITIIKLLANYRILP

GDKLRDVRFKTDLVLRPAEGIPIKIVTRQ*

 

>CPIJ006721 CYP4H37v1 Culex pipiens 100% to CYP4H37 Culex_quinquefasciatus (green from other seq)

95% to CYP4H12v1  Culex pipiens pallens partial seq

2 aa diffs to CYP4H12v2  Culex pipiens pallens partial seq

5 aa diffs to CYP4H12v4  Culex pipiens pallens partial seq

9 aa diffs to CYP4H12v5  Culex pipiens pallens partial seq

60% to CYP4H28 Aedes probable ortholog

MIYLALGAGLLTIFAVRYLLEQRRLLRIAGHFSGPKAYPFVGSMLEFAGRDIPGIFQRMVEMHDEYGRDFAVWGTGSELM

FVFSSARSVEKVLMAKATQKSDLYTMIEPWLGRGLLISSGEKWFHRRKIITPTFHFKILEGFAEVFNRETGVLVEKLRKH

DGKEEFDVYDYVTLLALDSICETSMGVHVNAQQNPNN

QYVCDVKRMSELILLRIFS

HVFSSLKTFYWYLMPKAWEQRKLIKRLHQFTDSVIQKRRKQLQ

QDKQLGSVEFDLNEADMYSKRKQTFLDLLLNVTVDGKPLSDEDIREEVDTFMFEGHDTTTSGIAFTILQLAKHQHLQQKI

YDEIVAILGQEGSKTTPLTYNNLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIPAGLDVTVPIYIVHRNPDV

YPDPERFDPERFAEGSEQQQRRGPYDYIPFSVGSRNCIGQRYAIMELKITIIKLLANYRILPGDKLRDVRFKTDLVLRPA

EGIPIKIVTRQ.

 

>CPIJ015681 CYP4H37v2 Culex pipiens 99% to CYP4H37 Culex_quinquefasciatus (3 aa diffs)

This seq is missing the C-term 92 aa

Only 4 aa diffs to CPIJ006721

60% to CYP4H28 Aedes probable ortholog

MIYLALGVGLLTIFAVRYLLEQRRLLRIAGHFSGPKAYPFVGSMLEFAGRDIPGIFQRMVEMHDEYGRDFAVWGTGSELM

FVFSSARSVEKVLMAKATQKSDLYTMIEPWLGRGLLISSGEKWFHRRKIITPTFHFKILEGFAEVFNRETGVLVEKLRKH

DGKEEFDVYDYVTLLALDSICETSMGVHVNAQQNPNNQYVCDVKRMSELILLRIFSVFSSLKTFYWYLMPKAWEQRKLIK

RLHQFTDSVIQKRRKQLQQDKQLGSVEFDLNEADMYSKRKQTFLDLLLNVTVDGKPLSDEDIREEVDTFMFEGHDTTTSG

IAFTILQLAKHQHLQQKVYEEIVAILGQEGSKTTPLTYNNLNDFKYLDMVIKESLRLLPPVSFIGRRLLEDTEINGVTIP

AGLDVTVPIYIVHRNPD

 

>CPIJ001758 CYP4H38 Culex pipiens 99% to CYP4H38 Culex_quinquefasciatus,

79% to CYP4H33 probable paralog (3 adjacent genes)

3 aa diffs to 4H21v1 Culex pipiens partial seq

6 aa diffs to 4H21v2 Culex pipiens partial seq

7 aa diffs to 4H21v3 Culex pipiens partial seq

MWLVLSLIIATFGYLLFNYHKTRQKLLAIQSHFNGPPTHYFLGNFPIFIGKSIPDIFNIITKMHKVYGEDIAIIAAFNEL

VIDLSSSRNVEKVLLAKSIKKSFVYNFLEPWLGTGLLTVPTGEKWFQRRKIITPTFHFKMLDNFLEVFNREADVLVEKLK

VRAGKGEFDIYDYVTLYALDSICETSMGVQIHAQDDPGNEYAIAVKQMSTFILRRIFNPLRSFPRLFFLFPFAKEQKNVI

RKLHNFTNSVIDSRRKVLEREQASSTVAFDLQEENMYSKRKITFLDLLLSVTVEGKPLSREDIREEVDTFMFEGHDTTTS

GISFTIWHLAKHQDVQQKLCDEIDQILGTEKKTAELTNVKIQEFEYLDMVVKESLRLIPPVPIIGRQLIEDLEMNGTTIP

AGTQINIKIYNIHRNPKIWPDPERFDPDRFSKTNEDKRGPYDYIPFSAGSRNCIGQRYAMMELKVTLIKLLASYRILPGE

SMEKMRFKTDLVIRPNETIPIKLVERG.

 

>CYP4H38 Culex_quinquefasciatus_16

70% to 4H18 Anoph., 79% to 4H33 Aedes, 53% to 4H34

MWLVLSLIIATFGYLLFNYHKTRQKLLAIQSHFNGPPTHYFLGNFPIFIGKSIPDIFNII

TKMHKVYGEDIAIIAAFNELVIDLSSSRNVEKVLLAKSIKKSFVYNFLEPWLGTGLLTVP

TGEKWFQRRKIITPTFHFKMLDNFLEVFNREADVLVEKLKVRAGKGEFDIYDYVTLYALD

SICETSMGVQIHAQDDPGNEYAIAVKQMSTFILRRIFNPLRSFPRLFFLFPFAKEQKNVI

RKLHNFTNSVIDSRRKVLEREQASSTVAFDLQEENMYSKRKITFLDLLLSVTVEGKPLSR

EDIREEVDTFMFEGHDTTTSGISFTIWHLAKHQDVQQKLCDEIDQILGTEKKTAELTNVK

IQEFEYLDMVVKESLRLIPPVPIIGRQLIEDLEMDGTTIPAGTQINIKIYNIHRNPKIWP

DPERFDPDRFSKTNEDKRGPYDYIPFSAGSRNCIGQRYAMMELKVTLIKLLASYRILPGE

SMEKMRFKTDLVIRPNETIPIKLVERG*

 

>CPIJ001757 CYP4H39 Culex pipiens 92% to CYP4H13  Culex pipiens pallens partial seq

79% to CYP4H33 probable paralog (3 adjacent genes)

MLLFISLILATVGYALFNYHKRRQLLLNIRSHFDGPPSKYFLGTAPLFFGKSIPDIYDIITGWHKVHGEDVAIIAAFNEL

VLDLSSSKNVEKVLLAKSIKKSDPYDFMVPWLGTGLLISIGEKWFQRRKIITPTFHFKILESFLEVFNKGADVLIAKLDV

HAGKEEFDIYEQVTLYALDSICETSMGVQVNAQKDPNNEYAIAVKQMSTFILRRVFSALRSFPSLFFLYPYAREQKRVVQ

KLHNFTNSVIDSRRKMLEQDEANSKVSFEQQEEDVYTKRRITFLDLLLSVTVNGKPLSREDIREEVDTFMFEGHDTTTSG

ISFTIWHLAKYQDVQQRLYEEIDRILGKDKKTAELTNLKIQEFEYLDMVVKESLRMIPPVPIIGRCLLEDMEMNGVTIPA

GTNISIKICNIHTNPKIWPNPEKFDPERFSKTNEGKRGPYDFIPFSAGSRNCIGQRYAMLEIKLTIIKVLASYRILPGES

MDRLRLKADLVIRPDDIIPIKIVRREVC.

 

>CPIJ001759 CYP4H40 Culex pipiens 79% to CYP4H33 missing C-term probable paralog (3 adjacent genes)

MLLIISLLLATVGYVLFNYNKRRQLLLNIRSHFDGPESNYFLGTTPVFFGKSIPDIFDIITGWHKVHGEDVAIIAAFNDL

VLDLSSSKNVEKVLLAKSIKKSEPYDFLVPWLGTGLLISTGEKWFQRRKIITPTFHFKMLENFLETFNKEADILVAKLDA

HAGKGEFDIYEHVTLYALDSICETSMGVQVNAQDDPNNEYAIAVKQMSTFILRRVFSVLRSFPALFFLYPFAREQKRVIR

RLHNFTNSVIDSRRKMLEQEQANSKVSFEQQEEDVYTKRRITFLDLLLSVTVNGKPLSREDIREEVDTFMFEGHDTTTSG

ISFTIWHLAKYQDVQQRLYEEIHRILGKDKKTAELTNLKIQEFEYLDMVVKESLRMIPPVPIIGRCLLEDMEMNGVTIPA

GTNISHQDLQHPTRTPKSGPNPEKV

 

>CPIJ008936 CYP4H41 Culex pipiens 66% to CYP4H29, 72% to CYP4H36

MFTALLLALLLLVVTWLVTTLVRNYATTRNLRRNLPSFNVLPSVPLLGSSHLFKDGTEPPEIFATSSGFHRRFGNDLIAQ

SFLNQPSLQVTSPEVVEQIINTRTINKSQIYDFMKPWINEGLLTAVGKKWAQRRKIITPAFHFKILEEFLGTFNQQAEVL

VDKLREQVGQGDFNIYKYITLCTLDVISETAMGVKINAQDNPDSSYVKAVKEMADLILRRLFSVLREFRWLFPFLKMAKQ

QKRLLNVLHSFTDSVIVTRKNQLENESAQLITQKKLEESDIYGKRKLTLLDLLLNVSIDGHPLSNPDIREEVDTFMAAGH

DTTTSALSFGAYHIARNPPVQQKLYDEMVQVLGPDFKNTTLTNSMLQDLKYLDMTIKEILRIHPSVPIIGRMSTSDMTIN

GTKLPTGIEVIIFIYAMHNNPEVFPEPDRFDPDRFNEENSAKRHPYAYIPFSAGARNCIGQKYALLEAKTILVKLLGSYR

LLPCDPGNTVRIKSDITLRPVNGAFVKIVER.

 

>CYP4J1 Anopheles albimanus (mosquito) L38691

TAAAIMFTLLVLANEPDVQDRCYAELQNIDTTLAPMTVHDYQQL

PYLDRVLKESLRLYPPVAFISRATTGDLMIDEATFAHNTIARIHIYDLHRDPVQFPDP

ERFDPDRFLPEHVAKRNPYAYV

 

>CYP4J2 Anopheles albimanus (mosquito) L38692

MAAALVFICLQLAWEQEVQERIYHELHAFRQAKSYTTNGDQHFD

PQDFSSLKYFDRVIKECLRIWPPVAFISRAVTESVSLPDGRTIPRGCIANLHIYDLHR

DPEQFPDPERFDPDRFLPERMASRNPYAYV

 

>CYP4J3 Anopheles albimanus (mosquito) L38693

TSAALIFTLLLVALHPEVQERLYEEILHITLGKVDPDRELCQAD

YNEMKYMDLVLKESLRLYPPVPFISRSIIEDTFFGERFIPKGSIVNVHIYDLHRDASV

FPDPERFDPDRFLPENVAGRSPYAYV

 

>CPIJ016284 CYP4J4 Culex pipiens 2 aa diffs to CYP4J4v2

MGFWINFGLILGFLFAVLFLADLIDKQGRLFRAMEKFPGPPVRPIIGSVEEIMFLNQATTFEWTRRWAKRYQASYRFWLN

SSIFVLNVIRVREVEPLLSSTKNIDKSRFYFLHPLLGLGLLNSGGSKWLHRRRILTPTFHFNILNGFHRTFVEECELLVG

TLDEHAASGKATALQPVMSRFTLSTICETSMGVKLASMAGADEYRKKLYEIGEILVHRLMRPWLISDFVCKITGYQAVLR

KLLLPVHAFTTGIINQRRELFQRNPETFDDLTAEENVYTNTKKRYAMLDSLLRAEQDQLIDADGVREEVDTFTFEGHDTT

ASALVFIFFQLAREQTVQERIFNEIHALYDRKPQADKSLRPQDYAELKFMDRALKECLRLWPPVTFISRAITDDIVLADG

ALLPAGCVANVQIFDLHRDPEQFPDPERFDPDRFLPESVDKRNPYAYVPFSAGPRNCIGQKYAMMELKVVVVYTLLRFRV

LPVTRLEEINFVADLVLRSTNPIEVRFERR.

 

>CYP4J4v1 Culex pipiens pallens (mosquito) AF157092

EVDTFMFEGHDTTASALVFIFFQLAREQTVQEHIFNEIHALYDR

KPQADKSFRPQDYAELKFMDRALKECLRLWPPVTFISRAITDDIILADGALLPAGCVG

NVQIFDLHRDPEQFPDPERFDPDRFLPESVDKRNPYAYVPFTAGPRNCIG

 

>CYP4J4v2 Culex pipiens 96% identical to 4J4v1, AF190778

TASALVFIFFQLAREQTVQERIFNEIHALYDRKPQADKSFRPQD

YAELKFMDRALKECLRLWPPVTFISRAITDDIVLADGALLPAGCVANVQIFDLHRDPE

QFPDPERFDPDGFLPESVDKRNPYAYV

 

>CYPk2l2 = CYP4J5 Anopheles gambiae, 532 aa 65% to 4J2 62% to 4J1 54% to 4J8

MASDWNVVVQSPLVISTLSILLLLLLWFVWDVFDKRGPTYTALRQFAGPPVWPLIGTM

YHTRRLDAAKAFDAFRRWTSQYGGSYKLWLNRYLFILNITRCTEAEPFLSGSRNTEKS

LLYRFMYPFIGVGLLNSAGAKWLQRRRILTPTFHFNILNGFHRTFCEESEKLAAKIDS

KWDGCEGAAVEIELQSAMSQLTLNTICETSMGVKLDALDGAKEYREGIYRVGEMLLNR

AVRPWLYVDWIYWLLGYSRQLQRLLKPLHLFTASIIAQRRDLFAQGKLNDLSSSQDED

HSLYSTTPGGKKRYAMLDTLLTAEMQGQIEPDGIREEVDTFTFEGHDTTGSALVFILL

TLSWELEIQTRLHQELSQLATQNDLTDGHLSPNDLNSAKFFDRVIKECLRLWPPVAFI

SRSVTEEIHLPDGRIIPQGCIANLHIFDLHRDPAQFPDPERFDPDRFLPECVSQRSPY

AYIPFSAGPRNCIGQKYALLEVKTAVAYLVLRYRILPATKREEIRFIADLVLRSATPL

KVRFERRQNA*

 

>CPIJ001754 CYP4J6 Culex pipiens

3 aa diffs to CYP4J6v2 Culex pipiens partial PCR fragment

7 aa diffs to CYP4J6v1 Culex pipiens partial PCR fragment

MDYFTIFLVILLSLLLLYELYLRTSPGYRAAKQFPSPRPLPIFGDIFVLLSRDPVSTFMLARELAHRFNDSYGLLLGSGL

IVNVIKAKESEALLSSTRLIDKNMIYTFLHPFLGVGLLNSTGSKWFQRRKILTAAFHFNILPKFLNTFHEECEKLVQRLT

KDVEQGKTTSLQQLAARFTLNTICEAAMGVKLDSHTTADEYRAKIKVLVEYLVQRVMNPWLYENFVYKMLGLEARMNKVL

KPIHAFTNGIIKQRRKLFHATVKNLEDFSEENIYFNTNQRYALLDTLLASEARNQIDEDGVREEVNTFMFRGHDTTASAV

TFIFFVVAEHPDVQQKLYDEIEASRPHSQYTVKDYNELRYMDRVIKECVRLYPPVPFIGRTVSEDSWFAGRFVPKGSMAN

VHIWDLHRDPDQFPDPERFDPDRFLPENVEKRNPYAYVPFSAGPRNCIGQRFAMLELKSILTAVLREFRVLPVTKRDEIV

FVADMVLR

 

>CYP4J6v1   Culex pipiens AF190776

TASAVTFIFFVVAEHPDVQQKLCDEIEASSPHSQYTVKDYNELR

YMDRVIKECLRLYPPVPFIGRTVSEDSWFADHFVPKGSMANVHIWDLYRDPEQFPDPE

RFDPDRFLPENVEKRNPYAYV

 

>CYP4J6v2 Culex pipiens AF190781

TASAVTFIFFVVAEHPDVQQKLYDEIEASRPHSQYTVKDYNELR

YMDRVIKECLRLYPPVPFIGRTVSEDSWFADRFVPKGSMANVHIWDLHRDPDQFPDPE

RFDPDRFLPESVEKRNPYAYV

 

>CYP4J7v1 Culex pipiens AF190780

TASAFTFIFLLVAEHSDVQQALVDEILTVNSSRLDPLAQFTVKD

YNELRYMDRVIKECLRLYPPVPFIGRMINEDSWFGDRFIPKDSMANVLIWDLHRDPKQ

FLDPERFDPDRFLPENVGQRNPYAYV

 

>CYP4J7v2 Culex pipiens AF190785

TASAFTFIFLLVAEHSDVQQALVDEILTVNSSRLDPLAQFTVKD

YNEFRYMDRVIKECLRLYPPVPFIGRMINEDSWFGYRFIPKDSMANVLIWDLHRDPRQ

FLDPERFDPDRFLPENVEQRNPYAYV

 

>CYP4J8 Culex pipiens AF190788

TGSAFVFIFLSIANHQDVQERVYQEVHATLHDRSGPAEPLTIQD

YNNLKYMERVLKECMRVYPPVPFISRFVTEDVRYEDKWIPKGSVISVEIFDLHRDPEQ

FPDPERFDPDRFLPEHVEKRNPYAYV

 

>CYP4J8v2 Culex pipiens pallens CB074944.1

NSLVIEVDTFMFEGHDTTGSAFVFIFLSIANHQDVQERVYQEIHATLHDRSDPAEPLTIQ

DYNNLKYMERVLKECMRVYPPVPFISRYVTEDVRYEDKWIPKGSVISVEIFDLHRDPEQF

PDPERFDPDRFLPEHVEKRNPYAYVPFSAGPRNCIGQNRIPAA

 

>CYP4J8v3  Culex pipiens pallens CB074947.1

NSLVIEVDTFMFEGHDTTGSAFVFIFLSIANHQDDQERVYQEIHATLHDRSDPAEPLTIQ

DYNNLKYMERVLKECMRVYPPVPFISRFVTEDVRYEDKWIPKGSVISVEIFDLHRDPEQF

PDPERFDPDRFLPEHVEKRNPYAYVPFTAGPRNCIGQNRIPAA

 

>CYPk2l1 = CYP4J9 Anopheles gambiae,  506 aa retained intron before perf

MDILTVVLLLVAFLLILYELRVQLSTHYRAGKRFPGPRALPLLGNAHNLLFNDQRRTFQLPRGWAATYGDTYRILVRGILNLNAFQAKDVEPLLSSPKLIEKSMIYSLLHRFLGIGLLNSTGSKWQHRRRILTPAFHFNILPSFLLTFQEECRRLVAQIGQYADKGAPVALQPLATKFTLNTICETAMGIKLDSMTMANEYRSKIEAIGTMLLQRLMNPWLFEDFTYKLSGLQGRFEKLLQPVHAFTRSIIQQRRELFHQNWLKKLLNVHIFCRYTNLKQRYAMLDTLLAAEAKEQIDEDGIREEVDTFTFEGHDTTSAAVIFTLLLLAHSPDVQQRLYEELQEVAQSRTDADDEFTQRDYTELRYMDMVLKESLRLYPPVPFISRNISEDTMFGDRLVPKDTLFNVHIFDLHRDPAVFPDPERFDPDRFLPECVAERSPYAYVPFSAGPRNCIGQRFAILELKTVLAAILMHFRILPVTKREELVFVADLILRTKDPIMVRFERR*

 

>CYP4J9 Anopheles funestus AY987355.1

EVDTFMFEGHDTTSAAIIFTLLLLAHSPEVQQRLYEELQLIAVS

RSDADEAEFTQRDYNELKYMDMVLKESLRLYPPVPFISRNITEDTMFGDRLVPKDTLF

NVHIFDLHRDPAVFPDPEHFDPDRFCRKNVAERSPYAYVPFTAGPRNCIGQ

 

>CYPk2l3 = CYP4J10 Anopheles gambiae,  533 aa

MLLAVLVCVLGSCIAILLVRDYRSKQTDGYRAALRYPGGTIVPVFGSLFELLFKNPVQTFAYARANATRYGASYRQWIDGSVILNVTRVQEAEKILSSTQHTRKSILYRFLHPLMGDGLLCSKGAKWQQRRRILTPAFHFNILPKFLTIFQEESEQLVRRLDRLADGVQDVVLQPIVTSFALHTICETAMGVKLDAYREADEYKQKVYEVGEMLVHRTMSPWLYSDRVYRLLGYDGPLAKSLKPIHHFTRSIIRQRKETFQAAQLTADSTTEENMYFGSKQRYAMLDTLLAAEAKQQIDEEGIREEVDTFMFEGHDTTAAAIMFTLILLAIEQDVQERCYGELQEVLDRSSSDPRSVQDYQNLPYLDRVIKESLRLYPPVAFISRTTSGELVVGKNNWVGNWAGNSKWTSLSFISSSHLATDGTTFPHNTMSHIHIYDLHRDPVQFPDPERFDPDRFLPEVAEKRNPYAYVPFSAGPRNCIGQKFAQLEMKTVLVAVLERFRLKPVTRREEIVFMADLVLRAKTPLKVRLERR*

 

>CYP4J11_CONTIG1 Anopheles funestus AY648705

79% TO 4J5 57% TO CONTIG 7 probable ortholog of 4J5

60% to 4J9 and 58% to 4J10

    EVDTFMFEGHDTTASALVFIFLTLSWEPEIQQRLYQELQQFRTEK 629

628 GMADGHFPASDLNSLKFFDRVIKECLRLWPPVAFISRAVTEEVNLPDGRTIPKGCIANLH 449

448 IFDLHRDPAQFPDPDRFDPDRFLPERVAERNPFAYVPFTAGPRNCIGQ 305

 

>CYP4J12_CONTIG6 Anopheles funestus AY648706

80% TO 4J10, SAME SEQ AS CONTIG 7 (1 AA DIFF) probable ortholog of 4J10

54% to 4J9 and 53% to 4J5

568 EVDTFMFXXHDTXAAAIMFTIVLLATEQDVQERCYKELEELLNGMVTTSSESVRLSVQDY 747

748 QYLPYLDRVIKESLRLYPPVAFISRATTGELVVDGTIFPHNTITHVHIYDLHRDPAQFPD 927

928 PERFDPDRFLPEVAEKRNPYAYVPXTAGXRN 1020

 

>CYP4J12_CONTIG7 Anopheles funestus 83% TO 4J10, SAME SEQ AS CONTIG 6 (1 AA DIFF) probable ortholog of 4J10

206 EVDTFMFEGHDTTAAAIMFTIVLLATEQDVQERCYKELEELLNGMVTTSSESVRLSVQDY 385

386 QYXPYLDRVIKESLRLYPPVAFISRVTTGELVV 484

559 DGTIFPHNTITHVHIYDLHRDPAQFPDPERFDPDRFLPEVAEKRNPYAYVPFTAGPRNCIGQ 744

 

>CYP4J13 Aedes aegypti 1.869_1 AY431450 65% to 4J10

MFSSVLSLVIITLIVLLAVYEWYLRQRDGYRAALQYPGGPMLPVLGNILEVLIKDTVQTFNYARSNALKYGRSYRQWIFG

NVILNVIRIREAEPILSSTKHTRKSILYRFLEPLMGDGLLCSKGSKWQARRKILTPAFHFSILNDFLQVFQEEAEKLVGL

LDSCADAEEEVVLQSIVTRFTLNTICETAMGVKLDTFIGADKYRSQVYDVGERIVHRTMTPWLYDDGVYNLFGYQKPLED

AIEPIHDFTRSIIRQKREQLKQDSTMHIVDSDGIYGSKQRYAMLNTLLMAEENDAIDEEGIREEVDTFMFEGHDTTAAGL

IFSILLLATEQEAQQRVYDELLKARSTKSESEAFTIADYNNLKYLDRFVKEALRLYPPVSFISRNLSGPLEVDSTTFPHG

TIAHIHIYDLHRDPEQFPDPERFDPDRFLPEVAAKRNPYAYVPFSAGPRNCIGQKYALLEMKTVLCALLINYRILPVTTR

QEVIFIADLVLRAKTPIKVQFAKRKANATRS*

 

>CPIJ000294 CYP4J13 Culex pipiens

6 aa diffs to partial seq CYP4C23, 75% to CYP4J13 probable ortholog

51% to CYP4J14, 54% to 4J17, 50% to 4J15, 52% to CYP4J16

MLSPWLAAIFAALAALFLYDWRARQSESYRAALQYPGNRMLPVVGNLLEVLVKDPAQAFAYARSSAAKFGRSYRQWIFND

VIVNVTRVREAEPILSSVKHTRKSVIYRFLAPLMGDGLLCSRGDKWQGRRKILTPAFHFNILSKFLLVFQEEADKLVEGL

EESAASGDDVVLQSIVTRFTLNTICETAMGVKLDTYKSADIYRSKVYEVGEMLVHRTMTPWLYDDGVYNFFGYLKPLEDA

IVPIHEFTRDIIQQKRKQFLQDSTFVDKLDDHGGSKQRYAMLNTLLMAEADNAIDEEGIQEEVDTFLFEGHDTTAAGIIF

TVLLLANEQDAQRRVYEELSKARRLKPEHEAFTIADYTNLKYLDRFVKEALRLYPPVSFISRSLTGRLDVDSTTTLPHGT

IANIHIFDLHRDPEQFPDPERFDPDRFLPEVSAKRNPYAYVPFSAGPRNCIGQKFALLELKVVVCALLSSFRVLPVTTRD

EVVFVADLVLRAKIPIKVRFARR.

 

>CYP4J14 Aedes aegypti 1.869_2 AAGE01397643 AAGE02025842.1 ESTs DW194177.1 EB096538.1 use this seq

MDFLMDWWFAVLIIVIVLLAWDAIDKSGRPYRAMNKFPGPRVFPLIGTLSEILFKDQ     

AKTFQLAREWPKRYGGSYRFWVNSTLYVLNVVRVREAEPILSSTKNIDKSRFYKFLHPFLG?

LGLLNSTGPKWMHRRRILTPSFHFNILNGFHRTFVEECDQLLATIDEHVDKGVSTALQPV? 

MSKFTLNTIC

ETSMGVKLSTVSGADVYRTKLYEIGEALVHRLMRPWLLNDFLC

RLTGYKAAFDKLLLPVHSFTTGIINKKREQFQASSEPLVELTEENI

YLNPKKRYAMLDSLLVAEQKQLIDEAGIREEVDTFAFEG?

HDTTAAALVFIFFTLAHESAVQDRIYSEIRQVYNGKPQSDRVFTPQDYSEMKFLDRALKE?

CLRLWPPVAFISRNISEDIVLEDGAVIPAGCVANIHIFDLHRDPEQYPDPDRFDADRFLP?

EEVDRRNPYAYVPFSAGPRNCIGQKYAMMELKVVIVNALLKFRVLPVTKLEDINFVADLV?

LRSTNPIEVRFERR*?

 

>CYP4J15v1 Aedes aegypti 1.869_3 matches Nelson 223407477 on top AAGE02025843.1

MDFLTNWWFGALVIVTVLLVRDAIDKSGRIYRAINKFAGPPCLPLIGTLCEILFMNQ

ATTYQWARKWPKRYGGSYRFWFSSTLYVLNVVRVREAEHILSSTRNIDKSRFYKFLHPFLGLGLL

NSNGSKWMHRRRILTPSFHFNILNGFHHTFVEECDQLLATIDEHVDKGVPTALQPVMSKFTLNTIC

ETSMGVKLSTVSGADVYRTKLYEIGEVLVHRLMRPWLLNDFLCRLTGYKAA

FDKLLLPVHSFTTGIINMKRKQFQESLEPSVELTEENI

YLNPKKRYAMLDSLLLAEQKQLIDEAGIREEVDTFAFEGHDTTAAALVFIFFTLAREPAVQDRI

YREILQVYSNKPQSSRAFTPQDYSEMKFLDRALKECLRLWPPVTFISRSISEDIILDDGS

LIPAGCVANIHIMDMHHDPEQFPDPERFDADRFLPEQVDRRNPYAYVPFSAGPRNCIGQK

YAMMELKVVVVNALLKFRVLPVTKLEDINFVADLVLRSTNPIEVRFERR*

 

>CYP4J15v2 Aedes aegypti AAGE02030510.1 98% to AAGE02025843.1 6807-5100. 9 aa diffs

MDFLTNWWFGALVIVIVLLVRDAIDKSGRIYRAINKFAGPPCLPLIGTLCEILFMNQ

ATTYQWARKWPKRYGGSYRFWFSSTLYVLNVVRVREAEPILSSTRNIDKSRFYKFLH?

PFLGLGLLNSNGPKWMHRRRILTPSFHFNILNGFHHTFVEECDQLLATIDEHVDKGVPTA?

LQPVMSKFTLNTIC

ETSMGVKLSTVSGADVYRTKLYEIGEVLVHRLMRPWLLNDFLCRLTGYKAAFDKLLLP?

VHSFTTGIINMKRKQFQESLEPSVELTEENI

YLNPKKRYAMLDSLLLAEQKQLIDEAGIREEVDTFAFEGHDTTAAALVFIFFTLAREPAV

QDRIYSEILQVYSNKLQSALAFTPQDYSEMKFLDRALKECLRLWPPVTFISRSISEDIIL

DDGSLIPAGCVANIHIMDLHHDPEQFPDPERFDADRFLPEQVDRRNPYAYVPFSAGPRNC

IGQKYAMMELKVVVVNALLKFKVLPVTKLEDINFVADLVLRSTNPIEVRFERR*

 

>CYP4J16 Aedes aegypti 1.4503_1 96% to AAGE01005255, = AAGE02035951.1

MYVFTTVAGLLVFIFILYKIYLRSLPSYRAAKYFPGYPVYPIVQNLFTALFKSQTGAFQQARQWARIFNNRTYRLLIQGV

LYVQIIHHKDVEMLLSSSRLITKSPLYKLIVPFIGNGLLNSTGEKWHQRRKILTPTFHFNILQGFLQIFHEECRKLVNQL

DKDAAQGITTTLQPLSTQVTLNTICETAMGLKLDTSETAEVYKSNIREVGKVIQQRIMNPLLFEDWIYKITGYQAKFDKI

LRPIHAFTNSIIRQRRETFHETMKNVDSPSEENIYTNIKQRYAMLDSLLLAEAKQQIDGEGIREEVDTFTFEGHDTTGSA

FVFTFLLIAHEQLVQQRLFEEIERMFNLQPNPTQQDYNDLKYMDRVIKESLRIYPPVPFISRLITEDVQYDGKLVPRGTI

MNIEIYDLHRDPEQFPDPERFDPDRFLPEEVQRRSPYAYVPFSAGPRNCI GQRFAMLELKAILIGVLREFRVLPVTKRED

VVFVGDMVLRSRDPIVVKFERR.

 

>CYP4J17 Aedes aegypti 1.985_2 AAGE01216085 JP_4

MDWLTIVLLLILALLALYEVHLRLLLSNRAAKQFPGPRRLPVLGNALALLFNDQVSTFKLPRRWAQRYKESYRLVIRGGF

VINAIRARETEALLSSTKLIDKSILYTFLYPFMGKGLLTSTGPKWFHRRKILTAAFHFNILPKFLVTFQEECDKLLRKLD

ADVKAGNTTTLQSVAARFTLNTICETAMGVKLDSMSMADEYRAKIQEVIKLLLLRVMNPWLVEEFPYRLLGFRRRLMKVL

KPIHAFTRSIIKQRRDLFHANVKNVDDFSEENIYVNTNQRYALLDTLLASEAKNQIDEEGIREEVDTFMFEGHDTTASAF

TFIFLVIANHQEAQRQLVEEIETMIAGRSNPTEPLSMHDYGELKFMDRVIKECLRLYPPVPFISRAVLEDAQLGDRFIPK

DSMANVHIFDLHRDPEQFPDPERFDPDRFLPENVEKRNPYAYVPFSAGPRNCIQRFAMLELKAILTAVLREFRVLPVTKR

EDVVFVADMVLRSRDPIVVKFERR*

 

>CPIJ000293 CYP4J18 Culex pipiens, 99% to CYP4J18 Culex_quinquefasciatus

5 aa diffs to CYP4J8v1 Culex pipiens partial PCR fragment

4 aa diffs to CYP4J8v2 Culex pipiens partial PCR fragment

5 aa diffs to CYP4J8v3 Culex pipiens partial PCR fragment

MYVLGIAVALLFFALALGLYELYLRSLPSYKAAAQFPGARVYPLVQNVFTVMLKSQLEAFDDARKWARQYGASYRFLIRG

VLFVQAVRYKEVEMLLCSTRLIRKSPLYKLTFPFIGEGLLNSTGDKWHQRRRILTPTFHFNILQSFLQTFHEESSKLVLQ

LNEHADKDIVTELQPLSTQITLNTICETAMGIKLDSTETADVYKRNIRTVGTIIQHRLMNPLLYEDSVYKALGYQAKFDQ

ILTPIHAFTRNIIKKRRQMFHATVDNPADLSEDNVYTNIKQRYAMLDSLLLAEAKQQIDDEGIREEVDTFMFEGHDTTGS

AFVFIFLSIANHQDVQERVYQEIYATIHDRSDPAEPLTIQDYNNLKYMERVIKECMRVYPPVPFISRFVTEDVRYEDKWI

PKGSVISVEIFDLHRDPEQFPDPERFDPDRFLPEHVEKRNPYAYVPFSAGPRNCIGQRFAMLELKSILTAVLREFRVLPV

TKRDEIVFVADMVLRARDPIKVKFERRNV.

 

>CYP4J18 Culex_quinquefasciatus_14 XM_001841814.1 (called CYP4V3 in GenBank entry, this is wrong)

68% to 4J16 Aedes, 54% to 4J9 Anoph.

MYVLGIAVALLFFALALGLYELYLRSLPSYKAAAQFPGARVYPLVQNVFTVMLKSQLEAF

DDARKWARQYGASYRFLIRGVLFVQAVRYKEVEMLLCSTRLIRKSPLYKLTFPFIGEGLL

NSTGDKWHQRRRILTPTFHFNILQSFLQTFHEESSKLVLQLNEHADKDIVTELQPLSTQI

TLNTICETAMGIKLDSTETADVYKRNIRTVGTIIQHRLMNPLLYEDSVYKALGYQAKFDQ

ILTPIHAFTRNIIKKRRQMFHATVDNPADLSEDNVYTNIKQRYAMLDSLLLAEAKQQIDD

EGIREEVDTFMFEGHDTTGSAFVFIFLSIANHQDVQERVYQEIYATIHDRSDPAEPLTIQ

DYNNLKYMERVIKECMRVYPPVPFISRFVTEDVRYEDKWIPKGSVISVEIFDLHRDPEQF

PDPERFDPDRFLPEHVEKRNPYAYVPFSAGPRNCIGKAILLNPGSPQLTHLA*

 

>CPIJ001755 CYP4J19 Culex pipiens, 100% to CYP4J19 Culex_quinquefasciatus missing C-term

6 aa diffs to CYP4J7v1 Culex pipiens partial PCR fragment

8 aa diffs to CYP4J7v2 Culex pipiens partial PCR fragment

MEFLTLFFAAIILILLFYEAYLRMLPGYKAAKQFPGPKRLPIFGNIFDLLFNDQLSTFTLPRQWAARFGESFVLLIRGGM

IVNAIRARETEALLSSTKLIDKSVIYLYLHPFLGVGLLNSTGSKWFQRRKILTAAFHFNILPTFLETFHEECEKLVVRLD

DDVDGGQATVLQDVAARFTLNTICEAAMGVKLDSHTMADEYRAKIKEVVGFLVQRVMNPLLFENFTYKLLGFRARLDKAL

KPIHAFTSNIIKQRRELFHANVKNLDEFSEENIYFNTNQRYALLDTLLASEARNQINEKGIREEVNTFMFRGHDTTASAF

TFIFLLVAEHPDVQQALVDEILAVNSSRLDPTAQFTVKDYNDLRYMDRVIKECLRLYPPVPFIGRMINEDSWFGDRFIPK

DSMANVLIWDLHRDPKQFPDPERFDPDRFLPENVEQRNPYAYVPFSAGPRNCIGESVLG.

 

>CYP4J19 Culex_quinquefasciatus_12

59% to 4J9 Anoph., 71% to 4J19 Aedes

MEFLTLFFAAIILILLFYEAYLRMLPGYKAAKQFPGPKRLPIFGNIFDLLFNDQLSTFTL

PRQWAARFGESFVLLIRGGMIVNAIRARETEALLSSTKLIDKSVIYLYLHPFLGVGLLNS

TGSKWFQRRKILTAAFHFNILPTFLETFHEECEKLVVRLDDDVDGGQATVLQDVAARFTL

NTICGMRTGEAAMGVKLDSHTMADEYRAKIKEVVGFLVQRVMNPLLFENFTYKLLGFRAR

LDKALKPIHAFTSNIIKQRRELFHANVKNLDEFSEENIYFNTNQRYALLDTLLASEARNQ

INEKGIREEVNTFMFRGHDTTASAFTFIFLLVAEHPDVQQALVDEILAVNSSRLDPTAQF

TVKDYNDLRYMDRVIKECLRLYPPVPFIGRMINEDSWFGDRFIPKDSMANVLIWDLHRDP

KQFPDPERFDPDRFLPENVEQRNPYAYVPFSAGPRNCIGESVLG*

 

>CPIJ010480 CYP4J20 Culex pipiens, 100% to CYP4J20 Culex_quinquefasciatus

5 aa diffs to CYP4J4v1 Culex pipiens partial PCR fragment

MAFWVNFGLFLGFILIVLFLFDLIDKQGRLFRAMKKFPGPPVRPIIGSLDEIMFMNQATTFQWARRWAKRYQASYRFWLN

SSIFVLNVIRVREVEPLLSSTKNIDKSRFYQFLHPLLGLGLLNSGGSKWLHRRRILTPTFHFNILNGFHRTFVEECELLV

GTLDEHAASGKATALQPVMSRFTLSTICETSMGVKMASMAGADEYRKKLYEIGEILVHRLMRPWLISDFVCKITGYQAVL

RKLLLPVHAFTTGIINQRRELFQRNPETFDDLTADENVYTNTKKRYAMLDSLLQAEQDQLIDADGVREEVDTFTFEGHDT

TASALVFIFFQLAREQTVQEHIFNEIHALYDRKPQADKSFRPQDYAELKFMDRALKECLRLWPPVTFISRAITDDIVLAD

GALLPAGCVANVHIFDLHRDPEQFPDPERFDPDRFLPESVDKRNPYAYVPFSAGPRNCIGQKYAMMELKVVVVHTLLRFR

VLPVTRLEEINFVADLVLRSTNPIEVRFERR.

 

>CYP4J20 Culex_quinquefasciatus_13

54% to 4J5 Anoph., 50% to 4J13 Aedes

MAFWVNFGLFLGFILIVLFLFDLIDKQGRLFRAMKKFPGPPVRPIIGSLDEIMTFQWARR

WAKRYQASYRFWLNSSIFVLNVIRVREVEPLLSSTKNIDKSRFYQFLHPLLGLGLLNSGG

SKWLHRRRILTPTFHFNILNGFHRTFVEECELLVGTLDEHAASGKATALQPVMSRFTLST

ICETSMGVKMASMAGADEYRKKLYEIGEILVHRLMRPWLISDFVCKITGYQAVLRKLLLP

VHAFTTGIINQRRELFQRNPETFDDLTADENVYTNTKKRYAMLDSLLQAEQDQLIDADGV

REEVDTFTFEGHDTTASALVFIFFQLAREQTVQEHIFNEIHALYDRKPQADKSFRPQDYA

ELKFMDRALKECLRLWPPVTFISRAITDDIVLADGALLPAGCVANVHIFDLHRDPEQFPD

PERFDPDRFLPESVDKRNPYAYVPFSAGPRNCIGQKYAMMELKVVVVHTLLRFRVLPVTR

LEEINFVADLVLRSTNPIEVRFERR*

 

>CYP4K1 Anopheles albimanus (mosquito) L38694

TASAMTFLLYNVAKYPDVQERLYEEIMDEIGPEFTELTLSTLNN

LRYMDLVLKESLRLYPPVPIIARIATENTEVLGERITRGSSVALDIFLMHRCEDYFHD

PDRFDPTRFEGMRDASAFNPYTYI

 

>CYPe2r1 = CYP4k2 Anopheles gambiae, 509 aa 68% to 4K1 anoph. albimanus

MFYWAVVLGVIATLLAALDWKYKSYEHLPGPRRWPFIGNVVSFLGAGPVEIFDQLIAFASTYGKVYKLDFFYDYTIIYSSPEAAEAILTSPAFTAKSQDYDKVSEWIGNGLLISRDQKWFTHRKVITPGFHFKILENFVPVFNRQAEAFCAKLETLTGRSADAVNVFPELKLLTLGIICETAMGVGMDGEGQSTQQAYYTQIVEELSSILYWRMFNVFVNIDAVFRLTRTSRRFDELVKKSWQFTLGMIERRRKMNELEAPVEVRKEEETFGKQKRALLDTLLEARIDGRPLTDEEIREEVDTFTFAGHDTTASAMTFILYNVAKHPEIQERVYQEIVNEIGADFCELSLRAICLHTLSALNNLHYMELVIKESLRLFPPVPVIARIATEDTELLAERITRGTSVAIDIYTMHHSDDYFPDAERFDPDRFEGARDAQTFNPYTYIPFSAGSRNCIGQKFAQYELKSTLVKLLQRFQIRLADASYVPILKAEIVLKPAEGLPLRFIKRRV*

 

>CYP4K3 Aedes aegypti 1.283_8 AAGE01021812??51% to 4K2 correct PKG, 54% to 4K2 after first exon

MLIVVLLPLVITLCLVFAFVHRKLLQFPNLAGPPEWPIAGSATEIVNLSSI  2827

EIFKLLRRYAQQYGTAYKLSFWYQYTLVFAKPDIAE

KILNTQSYASKSEDYDKVAEWIGYGLLISKGEKWFKRRKVLTPGFHFKILESFVRVFNEKSDVLCRKLASYGGS

EVDVFPTLKLYTLDVLCETALGYSCNAQTEDSFYPAAVEELMSILYWRFFNLFASVDTLFRFTKQYRRFHKLIGDTREFT

LKIIEEKRKLLNELHDEGAVNEEDDEGKKKMALLDLLLRATVDGKPLSDDDIREEVDTFTFAGHDTTASALTFLLFNIAK

YSDVQQKLFEEI SSVVGSTSELSLHTL? NDLRYLDLVIKESLRLYPSVPMIARIATENTKLDDMPIPKGTCVSVDIFQMHR

DPDRFEDPESFIPERFDAIRDGGKHNAFTYIPFSAGNRNCIGQKFAQYELKIAVVKLIQTFRLELPSPDIEPILKAEIVL

KPAEKLPIRFITRTTK.?

 

>CPIJ009468  CYP4K3 ortholog Culex pipiens 66% to CYP4K3

MLIIALSVIVAIAAVTIVLHFRLTQFEKIPGPPAWPLVGSSLQFMNLSPVDIFNLLRKYSKMYGKAYKISFGYDYTLMFA

KPEIAEKILNTQSYADKSSDYDKVAEWIGHGLLVSKGEKWFQRRKVLTPGFHFRILESFVRVFNEHSDVFCRKLATFQGS

EVDIFPRLKLFTLDVLCETALGYRCNSQTEDPAYPRAVDEIMSILNWRFFNPFASIDVLFRFTKQYKRFHQLIRETHRFT

LDIINERRREASRASEVDEDEDLRDDGGCGTRKKKLALLDILLGATIDGKPLSDDDIREEVDTFTFAGHDTSASALTFIL

YNIAKHPEIQQRMYDEIVEIVGPDSTELTLHTLNELRFLDLVIKESLRMFPPVPMIARHATERTEIEGSVIPVGTIVGVD

IFEMHRDSDYFQDAERFNPDRFEAVRETGKSNPFTYIPFSAGSRNCIGQKFAQYEIKTAVTKILQNFTLELPSPNFEPAL

KAEIVLKPAGPLPIRFVPRAAAAP.

 

>CYP4L1 Manduca sexta (tobacco hornworm) L38668

TTSGIVYSLFCIAKHEEVQEKVYEEQMDILGDADVDPTYQNLHQ

MKYLDLVLKESMRLYPPVPLIERRMTRDVSIAGINLCKGDSPMVSIFHMHRNPELFED

PLEFKPERFSTNSTGSPFSWIPFSAGPR

 

>CYP4L2 Manduca sexta (tobacco hornworm) L38669

TTSGIVYSLFCIAKHEEVQEKVYEEQMEILGDADVDPTYQNLHQ

MKYLDLVLKESMRLYPPVPLIERRMTRDVSIAGINLCKGDSPMVSIFHMHRNPELFED

PLEFRPERFSTNSTSQPFPVGSRFSAGPR

 

>CYP4L4 MbraC5 antennae of the moth Mamestra brassicae

AY063501.1 Martine Maibeche

59% to 4L1

  MIVLLVFV VVVLALLVSW ISLVRVSRRF NVPGPSPLPL VGNAHLFVVK

SSEFLNLVQR LSEKYGHAFR VHFFSTPYVV ICHSKYAEPL VSSTEHITKG

RSYSFLTCWL GQGLLTATGQ RWKSHRKFLT PAFHFNILQN FLPVFCKNQR

ILTEKIRGMA DGRPIDMFPI IALAALDNVN ESIMGVCMDA QKHSQSEYVK

SIEELSAIVT MRMQIPFFGE DAIFNLLPYK TKQDKALKVL HGQTNKVINA

RRAELKKANI TTLNDSSDIG TKNKHTFLDL LLLAEIDGKK IDDESVREEV

DTFMFEGHDT TTSGIVYTLH CLSKRRDVQE KIYEELKTIF GSEIHRDPTY

HELQQMKYLE LVIKESMRLF PPVPLIERRI MKDCEVGGLK LVKGTSVVMN

IFQIQRQPDL FDDPLEFRPE RFEAPLKNPF SWLAFSAGPR NCIGQKFAMM

ELKITISEIV KNFFILPAAE EPELSADLVL RSKNGVNVKF LPRK

 

>CYP4L5 Helicoverpa armigera cytochrome AY571901

EVDTFMFEGHDMTTSGIVYSLYLLSKHRDVQEKIYEELKTIFGS

EMNRDPTYHELNQMKYLELVIKESMRLFPPVPLIERKILRDCEIGGLTLVKGTSVLIN

IYQIQRQPELYENPLEFRPERFEAPLKNPFSWLAFSAGPRNCIGQKFAMMELKITISE

MIKNFYILPAPQEPELSADLVLRSKNGVHIKLMPRK

 

>CYP4L6  Bombyx mori silkworm, 67% to 4L4, EU435135, NM_001114871

MYLILLICLLVLVLTVSWWSMLNRICKSNVPGPFPLPIIGNAHQFVVRST (1)

EFLGLLKSFTDKYGDVFRVHFFSYPYVLISHPKYAE (0)

 932 ALVSSADLITKGRSYSFLKAWLGEGLLTAS 1018 (1)

1506 GPRWRLHRKFLTPAFHFNILQNFLPVFCKKSEILRDKIRRLADGQPIDLFPITALAALDNVAESIM 1688 (1)

GVSVNAQQNSESEYVRAIET ()

LSQITTLRMQIPLLGEDFIFNLTSYKKKQNIALEVVHGQTKKVIEARRCELEKNNKTNISGTNE ()

IGIKNKHAFLDLLLLAEIDGKL ()

12  MDEQSVREEVDTFMLEGHDTTTSGI 86

85  LVYTLFGLSKHPDIQEKWYEEQLTIFGEEMDRTPAY ()

NELAQMKVLEWVIKESLRMYPSVP 264

265 LIERWITKDAE

VGGLKLSKGTSVVLNIFQMHRNPEVFEKPLEFIPERFDSLEHKNPFSWLAFSAGPRNCI ()

GQKFAMMEMKVTLSTLVRNFKLVPVDIEPILCADLILRSQNGVKVGFLPRTQSNSKT

 

>CYP4L8 Clone A4 Spodoptera littoralis AM086017

DTFMFEGHDTTTSGISYALYCLSQRRHIQEKIYEELQTIFGDNMDRDPTYQELGQMKYLE

MVLKESMRLYPPVAFIERRITRDCEIGGLKMVKDTSVILNIYQIQRQPDMFEDPLEFRPE

RFEESLKNPFSFLAFSAGPRNCIGQKIA 

 

>CYP4L9v1 Spodoptera litura (common cutworm) DQ350814

SA3: 97% to 4L9v2, 3 aa diffs,  87% to 4L4, 91% to 4L7, 88% to 4L8

DTFMFEGHDTTTSGISYTLYCLSKRRDVQEKVYEELKTIFGDDMERDPTYQELGQMKYLELVLKESMRLFPPVPLIERRITKDCEVGGLKLVKGTSVVLNIYQIQRQPDMFEDPLEFRPERFEESLKNPFSFLAFSAGPRNCIGQKIA

 

>CYP4L9v2 Spodoptera litura (common cutworm) DQ352133

RAG1: 97% to 4L9v1, 3 aa diffs,  87% to 4L4 89% to 4L7 86% to 4L8

QVDTFMFEGHDTTTSGISYTLYCLSKRRDVQEKVYEELKTIFGDDMERDPTYQELGQMKYLELVLKESMRLFPPVPLIERRITKDCEVGGLKLVKGTSVVPNIYQIQRQPDMFEDPLEFRPERFEEPLKNPFSFLAFTAGPRNCIGQ

 

>CYP4L10 Spodoptera litura (common cutworm) DQ352134

RT5: 98% to 4L8 2 aa diffs, 78% to 4L4 possible ortholog of 4L8

QVDTFMFEGHDTTTSGISYALYCLSKRRHIQEKIYEELQTIFGDNMDRDPTYQELGQMKYLEMVLKESMRLYPPVAFIERRITRDCEIGGLTMVKDTSVILNIYQIQRQPDMFEDPLEFRPERFEESLKNPFSFLAFSAGPRNCIGQKIA

 

>CYP4L11 Helicoverpa armigera AY588581.1 (2 aa diffs to CYP4L11 Ha-92N13-B)

EVDTFMFEGHDTTTSGIVYTLYCLSKHRDIQEKIYEELQTIFGS

EMERDPTYTELNQMKYLELVLKESMRLFPPVPLIERKIMRDCEIGDMKLVKGTSVLIN

IYQIHRQPDMFENPLEFRPERFEKPLKNPFSWIPFSAGPRNCIGQKFAMLELKITISE

IVKNFYILPASQEPELSADIVLRSKNGVHIKLMPRK

 

>CYP4L17 Zygaena filipendulae (zygaenid moth, Lepidoptera) GQ915317

Zygae_P450-12 49% to CYP4L4, 48% to CYP4L7, probable ortholog of other CYP4Ls in moths

MYLVLAVIVLFLYVTFSSWLRLINEAKRMNVPGPTPLPFIGNGYLFFGGITDFMDALLRLENKYRGGATLIHILSERHLVLSHPKYIKGIMTNQQTITKGDGYAVSKPWLGLGLLTSTGDLWRSHRKFLTPAFHFSILQTFLPVMIKNEKILLTKLRSLADGTSFDIFPIIALTAMDNITESTMGVHVGAQSNSESKYVTAIQMLTKILALRFFNPIFKSDMLFNLIPHKIKHDKYVDIIQSEIKSIIQSRRQKIIKEQVTGRLQKDSTENEIKSRNAFLDLMLLSGEKMDDESIKDEVNTFMFAGHDTISSTSSFCLFCLSKYQDAQKKVLEEQISIFGKGLQRETTFSDLQQMVYLDCFIKEALRLYSPVPFIIRKITRDIDIDGLLITKDTNVLIDIFNMHRNPEVYEDPLTFKPERFEKEVSLFSWLVFSAGPRNCIGKKYAMMELKLILSTIVRNFHILPSGIEPKLTVALVLTSANGVNIKLKPRGNLMI

 

>CYP4L18 Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder FN356973.1

MIVYVILAVLVIVAVLSWLSFMSDRKKTNLRGPVPYPFIGNGHLLAVDPCEFIKVLHRLQEEYEDTVLIYLASRRYVLSSDPRVAEAVLTSNELITKGNSYTFLQPWLGNGLLTSTGQKWKAHRKFLTPAFHFNILQNFLPIFCKNGRVLRNKLSGLADGSSVDIFPILALLALDNVTESIMGVSVNAQNDQHPEYVQAVEAVSQISSMRMRNPFVAPDAVFNLLPYKTAQDKALKVLHGQTMKVISSRKEELRKSNITDLGPNADTGIKNKHAFLDLLLLAEVDGRKISDENIREEVDTFMFEGHDTTTSGITYCLYCLSNREDIQEKVFMEQKSIYGDDFGRDPTYAEIQKMRYLESVIKESLRLYPSVPIIERAIAEDSDLAGYHVPKGTNLVLDFLNMQRNAALYEDPLEFRPERFLEVSRNAFHWLPFNAGARNCIGQKFAMMEIKVTVAMVVNNFKILPSSEEPELASTLILRSRNGVNIKLIPRK

 

>CYP4M1 Manduca sexta Contig_457_FL (sent to Genbank)

3 aa diffs to partial seq CYP4M1 (L38670), probably the same gene

MFIYLFGIIVILCVIHIIFNYNASARLLRRIPGPPDRFIVGNSPELLLSSVELMKLPRKY

AERWAKSGICRFWTFPWAAVMIYDPKDIEIVLSGMKHHEKSVIYKFLSPWLGDGLLVSAG

EKWQHRRKILTPAFHFNILRQFSVILEENSQRLVERLEKTVGQPIDVTPILSEFTLNSIC

ETAMGXQLNKETTGAGKAYXDAIYEXGQIXVQRFISFHLYSDIIFFSTSLXRKLKKHLXA

LHRFTERVISDRKDYLDYFGLNFGDEIVDDDKFIYKKRKKTAMLDLLIAAERDGEIDSQG

IQEEVDTFMFEGHDXTASGLTFCFMLLANNKHIQDKIVAELDDIFGDSXRPANMEDFAKM

RYLECCIKESLRLYPPVHFISRNINEPVKLNNYEVPGGTSCFVFIYDLHRRSDXFKNPSV

FDPDRFLPENSVGRHPYSYIPFSAGPRNCIGQKFAIMEMKSAVSEVLRKYELRPVTRPSD

IEFIADIVLRNSGPVEVTFVKRQK

 

>CYP4M1 Manduca sexta (tobacco hornworm) L38670 (397bp)

TASGLTFCFMLLANNKHIQDKIVAELDDIFGDSTRPANMEDFAK

MRYLECCIKESLRLYPPVHFISRNINEPVKLNNYEGQGDTSCFVFIYDLHRRSDLFKN

PSVFDPDRFLPENSVGRHPYSYIPFSAGPR

 

>CYP4M2 Manduca sexta Contig_1737_known_Msexta_3'-truncated

(sent to genbank)

100% to CYP4M2 (L38671), includes the N-term (join)

Contig_1980_known_Msexta_3'-truncated

only 1 aa diff to CYP4M2, X residues replaced by 4M2 seq

MFVIIAIFALFLCLIHILFNNNKKARLLKQIPGSKYNFIIGNALDFLKSPEQLFYF

MREYYETWKPLNRFWAFQIAFVNVYEPHDIEVVISSTKHNAKSPPYYFLKNWLRDGLLLS

KGPKWQSRRKILTPTFHFNILRQFCGILEDNSERLVQNVGKSLGKPVNIIPTISEYTLYS

ICETAMGSRLGEESKESQKSYKQSICALGRQFVYRITRIYLHSDFIYNLITFGKVKKDLD

VVHNFTTKVIKDRKEYVEKYGINMFGVSDIDDNNVYKKNKKIAMLDLLITAQKEGFIDDI

GIQEEVDTFMFEGHDTIALALTYTLMLLANHRSIQHTVIAEIDEIFGDSERQADLDDLSK

MRYLERCIKESLRLYPPVPAIGRLLSEDVTLSGYRVPEGAYCHIQCFDLHRRGDLYKDPL

VFDSDRFLPENCSDRHPYAYIPFSAGPRNCIGQKFAILEMKSAISSLLRHYELLPVTKPE

DLKFTADLVLRTTNPVYVKFVKKEKINNISTIKII

 

>CYP4M4 Helicoverpa armigera U86005

EVDTFMFEGHDTTAGGLTYCFMLLANHKEAQDKILEELKEILGD

KRPITMEDLPKMKYLERCIKESLRLFPPVHFISRSLNETVTLSNYKIPAGTFCHIQIY

DLHRRADLFKNPTSFDPDRFLPENSVGRHPYAYIPFTAGPRNCIGQ

 

>CYP4M4v2 Helicoverpa armigera

FMFEGHDTTAGGLTYCFMLLANHKEAQDKILEELKEILGDDKRP

ITMEDLPKMKYLERCIKESLRLFPPVHFISRSLNETVTLSNYKIPAGTFCHIQIYDLH

RRADLFKNPTSFDPDRFLPENSVGRHPYAYIPFSAGPRNCIGQKF

 

>4M5 Bombyx mori (silkworm) Kyoko Kikuchi

NSKAVMMNKVPGPKLSFILGNAPEIMMLSSVELMKLARKFASRWDGIYRIWAFPLSIINIYNPDDVEVIVSTTKHN

EKSSVYKFLKPWLGDGLLISKGEKWQQRRKILTPAFHFNILRQFSVIIEENSQRLVESLEKCIGKPIDIVPVVSEY

TLNSICETSMGTQLSDKTEDAWKAYKDAIYELGPYFFQRFTRVYLYFDIIFYLTSLWRKMKKPLKSLHGCYFYRYE

KKGKFTLNKMVLNSGEDVNDDDLYIYKKRRKTAMLDLLIAAQKDGEIDDHGIQEEVDTFMFEEHDTTASGLTFCFM

LLANHRAVQDKIVEEINYIMGDSTRRANLEDLSKMKYLECCIKESLRLYPPVHFISRNLNEPVVLSNYEIPAGSFC

HIHIFDLHRRADIYEDPLVYDPDRFSQENSKGRHPYAYIPFSAGPRNCIGQKFAMIEMKSSRCSKYCENMNLLPVT

RPSEIELIADIILRNSGPVEITFNKRTK

 

>CYP4M6 x32 (501 aa) Helicoverpa zea (corn earworm) AY113687.1

MFWFLLFFVGFLCLLHLLLNYNERARLIRKLPGPEDSFILGNGPAVMLSSVEVMKLARKLAQENSGIYRL

WMYPVAAVSIYNPEDIETIVSSMKYNEKSQVYRFLKPWLGDGLLLSKGQKWQQRRKILTPTFHFNILKQF

CEVISENTQRFVENLKEVSGRPIDVVPVISEFTLNSICETAMGTNLTEYDKTAASAYKEAIHNLGYIFYQ

RFIKVYYFFDFIFNLSSLSKKQDGYLKTVHSFTKKVIDERSAYIEKHGIKIPDENDDDDTYVYKSKKKTA

MLDVLISARKEGHISDTGVQEEVDTFMFEGHDTTAGGLTYCFMLLANHKEAQDKILEELKEILGDDKRPI

TMEDLPKMKYLERCIKESLRLFPPVHFISRSLNETVTLSNYKIPAGTFCHIQIYDLHRRADLFKNPTSFD

PDRFLPENSVGRHPYAYIPFSAGPRNCIGQKFAMMEMKIAVAEVLREFELQPVTRPSDIRMIADAVFRND

GPVEVTFVKRQ

 

>CYP4M6v1 Helicoverpa armigera AY588583 1 aa diff

EVDTFMFEGHDTTAGGLTYCFMLLANHKEAQDKILEELKEILGD

DKRPITMEDLPKMKYLERCIKESLRLFPPVHFISRSLNETVTLSNYKIPAGTFCHIQI

YDLHRRADLFKNPTAFDPDRFLPENSVGRHPYAYIPFTAGPRNCIGQ

 

>CYP4M6 Helicoverpa armigera AY588580

EVDTFMFEGHDTTAGGLTYCFMLLANHKEAQDKILEELKEILGD

NKRPITMEDLPKMKYLERCIKESLRLFPPVHFISRSLNETVTLSNYKIPAGTFCHIQI

YDLHRRADLFKNPTAFDPDRFLPENSVGRHPYAYIPFSAGPRNCIGQKFAMMEMKIAV

AEVLREFELQPVTRPSDIRMIADAVFRNEGPVEVTFVKRQ

 

>CYP4M7 x39 (502 aa) Helicoverpa zea (corn earworm) AY113688

MWLYLCAIIIFLCVLDLCLNYNERARMIKKLPGPPDDFIVGNGLRIIKSSVDVMKVRREYAKKWNGIYRI

WAYPFGAVLVFNPEDVELIMSSMKYGEKSIIYTILKPWLQDGLLLSNGAKWQERRKILTPAFHFNILRQF

CDIIQENTQRFLEKLEQTAGQDVDVVPILSEYTLNSICETAMGTQLSEDLTGTVQSYKQAIYDLGYVFCQ

RFIRIYLYPETVFNLTSLGRMQKRSVKTVKNFTEDVIKQRRDYVEQYGFHTIGDNNDSEEVFVYKKKKKT

AMLDLLLSAEKEGLIDKTGIQEEVDTFMFEGHDTTASGLTFMFMLLAHHKDIQDKIVEELNEILGDSDRW

LTMDDLAKMKYMERCIKESLRIYPPVHFISRKLNETTVLSGYQVPADTLCHIPIYDMHHREDLFEDPERF

DPDRFLPENSVGRHPYAYIPFSAGPRNCIGQKFAMLEMKIAVAEVLRKFELKPVTKPSEIEFIADLVLRN

NGPVKVNFVKRK

 

>CYP4M9 Bombyx mori (silkworm) BAAB01103156.1 BAAB01142776.1 BAAB01178932.1 57% to 4M5

GTKWQKRRKILTPAFHFNILKQFCVILEENSQRFTENLKDTEGKSINVVPAISEYTLHSII ()

675 ETAMRTQLGSETSEAGRSYKNAICELGNQFVHRLARLPLHNNFIYNLYTLGKQNKH

LNIVHSFTKKVIKDRRQYIRGNGGNNFDDEKDTQADEHSIYFNKKKTAMLDLLLKAERDGL

IDEIGVQEEIDTFMFE ()

1150 GHDTTATGLTYCIMLIANHKSIQVGALRKYID 1245 ()

295 GESTRAADIEDLSKMRYLERCIKESLRLYPPVPSMGRILSEEI 423 ()

1467 VLDGYTVPAGTYCHIQIFDLHRREDLFKDPLVFDPDRFLPHNTEGRHPYAYIPFSAGPRNCI 1282 ()

GQKFAILEMKSLLSAVLRRYNLYPITKPEDLKFVLDLVLRTTEPVHVRFVKRNKV*

 

>CYP4M10v1 Helicoverpa armigera Ha-33M07-C 99% 1 aa diff to CYP4M10 HaCypZ020a-v1Pep

MFLYLIGIIVFLCIVHILFNYNKRARLVRKIPGPKDDFIFGNGLTVIRSPVEIMKMGRTLSNAFKGIFRVWVYPMGAVF

IYNPEDIEIIMSGMKYGEKSFVYKFLKPWLRDGLLVSNGSKWQERRKILTPAFHFNILKQFCEIIEENSHRFLDSLKET

AGKPIDIIPVLSEFTLNSICETAMGTQLSDDNSGAAKSYKKAIYDIGQVFFERFVRIYLYVDFIHNLTSLGRLQTKYLK

IVHNFTEKVIQQRREYIDKYGPYLNEELEVDQDDSYVYKKKKKTAMLDLLLSAEKEGLIDKLGVQEEVDTFMFEGHDTT

AAGLTFCFMLIANHKDIQEKIVQELDDIFGDSDRPIKMEDLSKMKYLECCIKESLRMYPPVHFISRNLNEDTVLSKYTV

PAGTFCHILILDLHYRPDLFKNPHQFDPDRFLPENSVGRHPYAYIPFSAGPRNCIGQKFAMIEMKIAIANVLRNFVLEP

VTRPADIRFVADLILRNDGPVVVNFKERQKTAAP

 

>CYP4M12v1 Spodoptera littoralis (cotton leafworm) AM086015

DTFMFEGHDTTASGLTFCFMLLAHHKDAQNKIVDELKEVLGDFKRPITIEDLPKMKYLER

CVKESLRLYPPVHFISRSLHEDVILSDYLVPAGTFCHIHIYDLHRQPDLFPNPNKFDPDR

FLPENSVGRHPYAYIPFSAGPRNCIGQKI       

 

>CYP4M12v2 Spodoptera littoralis (cotton leafworm) AM086016

DTFMFEGSDTTASGLTFCFMLLAHHKDAQNKIVDELKEVLGDFKRPITIEDLPKMKYLER

CVKESLRLYPPVHFISRSLHEDVILSDYLVPAGTFCHIRIYDLHRQPDLFPNPNKFDPDR

FLPENSVGRHPYAYIPFSAGPRNCIGQKI

 

>CYP4M13v1 Spodoptera litura DQ352135.1 RT4: 83% to 4M6, 98% or 2 aa diffs to CYP4M12v1 possible ortholog

QVDTFMFEGHDTTASGLTFCFMLLAHHKDAQDKIVDELKEVLGDFKRPITIEDLPKMKYLERCVKESLRLYPPVHFISRSLHEDVILSDYLVPAGTFCHIHIYDLHRQPDLFPNPNKFDPDRFLPENSVGRHPYAYIPFTAGPRNCIGQ

 

>CYP4M13v2 Spodoptera litura DQ352136.1 SC4: 97% to 4M13v1, possible allele, 96% to 4M12v1, 81% to 4M6

QVDTFMFEGHDTTASGLTFCFMLLAHHKDAQDKIVDELKEVLGDFKRPIAIEDLPKMKYLERCVKESLRLYPPVHLISRSLHEDVILSDYLVPAGTFCHIHIYDLHRQPDLFPKPNKFDPDRFLPENSVGRHPYAYIPFTAGPRNCIGQ

 

>CYP4M14v1 Spodoptera litura DQ352137.2 R35: 79% to 4M6

QVDTFMFEGHDTTASGLTYCFMLLANHRKIQDKIIQELDDIFGDEDRPIKMEDLAKMKYLDCCIKESLRLYPPVHFISRNINEETVLSNYTIPAGTLCHILISDLHLRPDLFKNPTVFDPDRFLPENSVGRHPYSYIPFTAGPRNCIGQ

 

>CYP4M14v2 Spodoptera litura DQ352138.1 SB2: 99% (1 aa diff) to CYP4M14v1, 78% to 4M6, 89% to CYP4M15

QVDTFMFEGHDTTASGLTYCFMLLANHRKIQDKIIQELDDIFGDEDRPIKMEDLAKMKYLDCCIKESLRLYSPVHFISRNINEETVLSNYTIPAGTLCHILISDLHLRPDLFKNPTVFDPDRFLPENSVGRHPYSYIPFTAGPRNCIGQ

 

>CYP4M15 Spodoptera litura DQ352139.1 R31: 89% to 4M14v2, 81% to 4M6

VDTFMFEGHDTTASGLTYCLMLLANHKKIQDKIIQELDEIFGNEDRPIKMEDLAKMKYLECCIKESLRLYPPVHFISRNLNEDTVLSNYTIPAGSFCHILILDLHYRSDLFKNPKEFDPDRFLPENSVGRHPYAYIPFSAGPRNCIGQ

 

>CYP4M16 Spodoptera litura DQ355382.1 SD1: 65% to CYP4M14v1, 63% to 4M7

QVDTFMFEGHDTTATVLCFMIMRLANEPEIQDSIAEELKSIFGDSQRPPTLEDLSQMKYLDCCIKESLRLYPSVHFMSRCFTEDVKLGDVTVPYDTMCHFNVFDIHRNPDIFPDPEKFIPERFLPENCVSRHPYAYIPFSAGPRNCIGQ

 

>CYP4M19 Plutella xylostella (L.) (diamondback moth) EU189047.1, ABW34434

5 aa diffs to 4M11 this might be a CYP4M11 allele

MFEGHDTTATGLVYLLMSLACDKMIQDKVVEELKEIFGDSTRPA

TMQDLGKMKYLDCCIKESLRLYPPVPFIARILNEEVVLSGYKVPAGTQCNIHIYDLHR

RADLFENPSKFDPDRFLPKNSAGRHPYAYIPFSAGPRNCIGQK

 

>CYP4M20     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189048.1, GenPept ABW34435

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            75% to 4M15 Spodoptera litura

MFEGHDTTASGLVYFLMLLANHRDIQKKVTAELDSIFGSSDRPA

SMADLARMRYLDCCVKESLRLYPPVPFISRELQEPVVLSNYTIPSGMFVHIHIFDLHR

REDLFPDADRFDPDRFLPENSAGRHPYAYIPFSAGPRNCIGQK

 

>CYP4M21     Plutella xylostella (L.) (diamondback moth) EU189049.1, ABW34436

MFEGHDTTARALCFLLMSIANEPIVQDTISSELQDIFQGSDRPP

TVEDLHEMKYLECCIREGLRLYPSVPYIARLLKEDTVLSGYVVPAGTIVNIHVFDVHR

RAELFPEPEAFRPERWLAPPPHKYAYVPFSAGPRNCIGQK

 

>CYP4M22     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189050.1, GenPept ABW34437

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            65% to 4M19, 65% to 4M5

MFEGHDTTAMGLTFILMELANNPSVQDKVVQELREIFGQSARPG

SMQDMSQMKYLECCIKETLRLYPPVPFISRYITDTVTLSGHVIPRGKTLCHIHIFDLH

RRADLYPSPLVFNPEQFTAGNCASRHPYAYIPFSGGPRNCIGQK

 

>CYP4M23     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189051.1, GenPept ABW34438

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            62% to 4M6 Helicoverpa zea

MFEGHDTTSTALQMIFMLLANNVDSQDKIVEECDRIFGSSDRSA

TMDDLTQMKYLECCIKEGLRLFPPVFFIQRMLTEPMKFREHEVPAGTDCTVFILDLHR

RADQFDEPHSFRPERFLAESPSWHPYSYIPFSAGPRNCIGQKI

 

>CYP4M24     Ostrinia furnacalis (Asian corn borer) EU807990.2

MIVFISTFIVIALSLLYYVTTKNHNYWKKKNVVSCPNPKPIFGNYSDYILFKKFVGEVSQ

DICRALPNEPYIGTFYGSDPALLVQDPDILKIILTKDFYYFSSREVSQYTHKEVVTHQNL

FFTYGDRWKVLRQNLTPIFTTAKMKLMFGLIVDCCRILEKSLDLDTKASDAIEVRALAAK

YTIETIGSCGFGIETNSMLQSEQNPFIIIGNKIIDNSTIRGLVWNARVMWPSVFYGLGLK

SFPAEVYKFFDTVSTKIFKARDYKPTARNDFIDCILNLKNNKYITGDSIRSVKDGDNKKI

VMDVDNDMLVGLCMMFFTGGFETSSSTMSYTLYELAKNKEAQRRAQQEIDEYLKAHDNKL

AYDCVTSLTYTEACVDEALRLYPVLAVLTREVVEDYTFPSGLTLEKNSRVHIPLYHLHHN

PKYFPDPEAFKPERFLPENKQNIKPYTYMPFGDGPRICIGLRFAKMQTLAGLLTILKKYS

VELADGTPEKLQFDPRAVVTTPIGGIPLKFTPRDGWEQRTFNK

 

>CYP4M25    Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder

FN356972.1

DSSLRYSVALGQVARMIIIYLLIILVTVCILHFIFNHNEAARILKKIPGPKDVFLVGNAGDINVDPVALFKLRNKYAKEFNGIYRIWIYPLGIVNIYNPEDIEIVTSTNKHSDKSIIYKFLKPWLNDGLLVSKGTKWHERRKILTPTFHFNILRQFCTIMEENSSRLVNKLDTVLGQPVDVTPIITEYTLSTICETAMGTQLNKETTECGKSYKEAIYAVGDVLVNRFTNLRYYSDTYFNLSSLGRKQKKHLKTVHYFTKKVIEERKKLVTETNITETEDESVYMFKKKRRTAMLDLLIAAQRDGLIDQAGVQEEVDTFMFEGHDTTAVGLIFFLMVLANRKDIQDKIVAELKEIFGDSQKNITIEDLSKMRYLECCIKESLRLYPPVHFISRNISETVKLSNYTVPAGTICHIHIYDLHRQENLFENPLEFIPERFLPEKCIGRHPYAYIPFSAGPRNCIGQRFAIYEMKSFVAAILRNYKLMPVTRPEDIEFVSDIVLRSNGPVYVQFEKRVDSV

 

>Cyp4p1 D. melanogaster AC018129 comp(67703-69662)

MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLDLYGRDH

AGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTST

GKKWHARRKMLTPTFHFNILNQFQEIFK

TESQKFLLQFEGQDEVTITLHDVIPRFTLNSIC

ETAMGVKLDEMAEKGDRYRENFSQIEECFIRRLSNPLLWGDKLFEM

FAAKDFASALDVVHRFSSEIIAKRRDLLKDELDKSSSTADDDG

FVSKKRFAMLDTLIYAE

KDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHID

DDLSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHR

NAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCI

GKKYAMQEMKTLMVVLLKQFKVLKAIDPQKIVFHTGITLRTQDKIRVKLVRRT

 

>Cyp4p1 D. pseudoobscura ortholog 72% to 4P1

MIVFLLTVALCALVLWLYRINKDYYILAFFSRRVRTKDGRPVESILPSPKGRTIFANCFDMYGKDL

AGVFSYSRELSQRLGESYLEYGMGVPLLNIIDAENAENILNHPKLITKSLVYDFLQPALRTGLLTST

EKKWHARRKMLTPTFHFNILGQFQEIFR

AESLKFVQQFQSQDESIVSLSDLIPRFTLNSIC

ETAMGVKLDEMAEKGDRYREGIHMIEMSFIRRLSNPLLWNKTIYNW

FAAKTYDAFLKTVHEFSSEIIAKRRILLEEELEHRRSTQTADDDI

FGSRKKRFAMLDTLICAEKDGLIDHAGICEEVDTLMFEGYDTTSIGLIFSLMNMSLYPEKQELCYKEIEEHID

DSFDNLDNNQLSKLKYLEYFIKETMRLFPSVPIMARQTIQETELANGLILPERSQITIHVFD

VHRNPKYWDSPNEFRPERFLPENCQNRHTYAYIPFSAGQRNCI

GQKFAMQEMKTLIVVLLKKFRILPLIDPKTIVFNVGITLRTQNNIQVKLVRRK

 

>Cyp4p2 D. melanogaster AC018129 comp(70087-72192) revised 9/11/2000

MMICLLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANCFDLLGKDT

DQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTAT

EKKWHTRRSMLTRTFHLDILNQFQEIFI

AESLKFVSQFQGQNEVVVSLKDRISRFTLNSIC

ETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVY

NMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI

CVIRKKRFAMLDTLICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHIL

DDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHV

FDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCI

GQKYAMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRRNCV

 

>CYP4P2 D. pseudoobscura ORTHOLOG 78% to 4p2

TMIVVLWLTVALCVIVHWLYRVNKDYYIMAFFSRRVRTKDGRPVESIVPMIKGRTVFANCFDLLGKDT 

DQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIYNFLHPFLRTGVLTAT

EKKWHARRKMLTRTFHFNILEQFQEIFQ

AESLKFVQQFQSQDESIVSLSDLIPRFTLNSIC

ETAMGVKLDEMAEKGDRYREGIHMIEMSFIRRLSNPLLWNKTIY

NWFAAKTYDAFLKTVHEFSSEIIAKRRILLEEELEHRRLTQTADDDI

FVSRKKRFAMLDTLICAEKDGLIDHAGICEEVDTLMFEGFDTTSIGLIFSLMNMSLYPEKQELCYKELEEHID

DNFDNLDHNQLSKLKYLEYFIKETMRLFPSVPIMARQTIQETELANGLILPERSQIT

IHIFDVHRNPKYWDSPNEFRPERFLPENCQNRHTYAYIPFSAGQRNCI

GQKFAMQEMKTLIVVLLKKFRILPLIDPKTIVFNVGITLRTQNNIQVKLVRRN*

 

>Cyp4p3 D. melanogaster AC018129 comp(65426-67385) revised 9/11/2000

MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFDLYGKDH

SGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDFLHPFLRTGLLTST

GKKWHARRKMLSPTFHFNILNQFQEIFI

TESLKFLEQFKGNDEAIISLNEVIPRFTLNSIC

ETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFKM

FAEKDYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTAEDEL

FTSKKRFAMLDTLILAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANID

DELNILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDI

HRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCI

GQKFAMQEMKTLMVALLKQFQILPEIDPKTIVFQTGLTLRTKNQIHVNS

 

>CYP4P3 D. pseudoobscura 66% to 4p3

MITLWLTVALCVVIHWLYQVNKDYYILAFFSRRVYTRDDRPVESLVPSPKGRTIFAHCFDLYGKDN

AGVFKFTRDLSKTLGKSYVRYVVGMPIYNVIDAETAEMILTDQKSLIGKGCVYNFLHPALKTGLLTSQ

GDKWHARRRMLTPTFHFNILGQFQEIFQ

AESLKFVQQFQSQDENIVSLSELIPRFTLNTIC

ETAMGVKLDEMADKGDRYRESFHMIEKSFVRRLSNPFLRSTTIYN

LFVAKEYAPFLKVVHDFSSEIIAKRRILLEEELEHRRSTQTADDDI

FVSRHKRFAMLDTLICAEKDGMIDHAGICEEVDTLMFEGYDVSSITLIFTLMNMSLYPDKQELCFKEIQEHIE

DDFSNLDINQMSKLKYLEYFIKETMRLFPPIPLMGRQAVQETELANGLILPSGTQIHIHTF

DIHRNPKHWDSPNEFRPERFLPENSQNRSVYAYIPFSAGQRNCI

AQKFAMQEMKTLMTVILKKFEIQPLVDPNSIVFHVGITLRIKNHIRV

 

>Cyp4p pseudogene D. pseudoobscura This fragment most like CYP4P exon 1

YIMAFFSRRVRTKDGRPVESIVPVPKGRTIFANCLDLYGKDH

 

>CYP4Q1 Tribolium castaneum

MLLSTTLVCAIGLLGVFHLLAWIKFHASNYMKMCVIPGPPQKGILIGNMTYLQTTPEKIFLRLREATKNF

YPIYKLNALHKCAANILNPEDCELIMSNSAHNQKGQIYDLLRNWLKDGLLTSFGAKWQTRRKILTPAFHF

SILQQFVQIFNEEAEILVEDLKKDCSKSYISISSHITKFTLKTIAETAMGSKLKFETQKEIDYYQAVYDV

GKILLYRLTHPWFIFHYVNFFSPWYLQEVKVTKTLHNFTREVIKHREENFKDIELPTEEHEVYKGKKRLA

MLDLLLSAKHKEGIVENDGIQEEVDTFMFKGHDTTSAALCFALMLIASHSEVQESIVAEMREVLGDLSKK

PSYNDLQNLKYLERCIKETLRLYPSVHFISRTLGQDLITTGGYTLPKESNAIIHIYDVHHNADIYPDPEK

FDPDRFLPENVQKRHPYAYLPFSAGPRNCIGQRFAMLELKTAICAILANFTLQPIDTPETIILVVDIILR

TKEPIKIKFVPRS

 

>CYP4Q1 Tribolium castaneum (red flour beetle)

TSAALCFALMLIARHSEVQESIVAEMREVLGDLSKKPSYNDLQNL

KYLERCIKETLRLYPSVHFISRTLGQDLITTGGYTLPKESNAIIHIYDVHRNADIYPDP

EKLDPDRFLPENVQKRHPYAYL

 

>CYP4Q1   Tribolium 3 aa diffs

TSAALCFALM  LIARHSEVQE  SIVAEMREVL  GDLSKKPSY  NDLQNLKYLE

RCIKETLRLY  PSVHFISRTL  GQDLITTGG  YTLPKESNAI  IHIYDVHRNA

DIYPDPEKLD  PDRFLPENVQ  KRHPYAYL

 

>CYP4Q2 Tribolium castaneum

MFASTLILTTIFAIVSVLAFKRIKYHVKNYILLNKLPGPPPDGLFVGNMPYLQTTPEDIFNRLREANKKF

YPIYKLFAVHRMGANILSPEDSEIVLSNPIHNEKGYIYKLLHHWLKEGLLTSKGEKWQLRRKILTPAFHF

NILQQFIMILNEEAEKLVEGLRKECHKPYINITPHISQFTLKSITETAMGTKLDFTTKKEIRYKEAVYKI

GKILTYRITHPWFIEPLLNIFSPCFIQERRVTSTLHKFTKEVIEDREKNFKDFELPTEEHDVYKGKKRLA

MLDLLLSAKKKDGIIDNKGIQEEVDTFMFEGHDTTAVALNFALMLIACHKDVQETILQEMRDVLGDIHAK

PTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVRTQKGYLIPKDTITIIHIYDLHHNPDIYPDPEK

FDPDRFLPENCQNRHPFAYLPFSAGPRNCIGQRFAMLELKAAICAILANFVLEPIDTPETIVVVVDIVLR

TKEGIKIRFVPREQ

 

>CYP4Q2     Tribolium castaneum (red flour beetle)

TAVALNFALMLIACHKDVQETILQEMRDVLGDIHAKPTYSDLQNL

KYLERCIKESLRLYPSVHLISRALGEDVRTQKGYLIPKDTITIIHIYDLHHNPDIYPDP

EKFDPDRFLPENVQKRHPYAYL

 

>CYP4Q2 Tribolium 3 aa diffs at end

TAVALNFALM  LIACHKDVQE  TILQEMRDVL  GDIHAKPTY  SDLQNLKYLE

RCIKESLRLY  PSVHLISRAL  GEDVRTQKG  YLIPKDTITI  IHIYDLHHNP

DIYPDPEKFD  PDRFLPENVQ  KRHPYAYL

 

>CYP4Q3 Tribolium castaneum

MLLSSSVLFVISFFLVLYFFKKLKCVSAKLYNLGKLDGPSNHNIIIGNVLRLH

AAPEVIFKKLRQWARDYYPVYQLRAIHIPAACILAPEDFEAILSNPRHIEKSMVYLLLHDWLGTGLLTSG

GQKWATRRKILTPAFHFSILQQFITIFNEETDKLVDTFKQQCDQPIEITSHITQFTLKTIGETAMGTKFE

FTTRKQIEYKQAILEIGEILLYRLLNSWLISDYLNFFSPHRLREKRLVKTLHTFTRDVITEREKTFEKFQ

LPTEEHDVYIGKKRLAMLDLLLTAKNEERTIDEDGIREEVDTFMFEGHDTTSAALSFALMLLANHKNVQD

QIVDEMVTVLGDLHQKPTYNNLQEMKYLERAIKESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLH

IYDLHHNPDIYPDPEKFDPERFRPENSQKRHPFAYLPFSAGPRNCIGQKFAMLELKAAICGILANFILEP

VDTPESIVLVVDLVLRTKNGIKIGFIPRVK

 

>CYP4Q3 Tribolium 1 aa diff

TSAALSFALM  LLANHKNVQD  QIVDEMVTVL  GDLHRKPTY  NNLQEMKYLE

RAIKESLRLY  PSVHFISRKL  GEDFVTCNG  LKLPKSTITH  LHIYDLHHNP

DIYPDPEKFD  PERFRPENSQ  KRHPFAYL

 

>CYP4Q4 Tribolium castaneum

MFLAPIILCLVLLALLVSSLRKKGRFWECLAPIPQPPAYPIIGNLFDIMRTPEQMFLADRERGLKYYPIY

KLDVCGTGGVNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSRGPKWQNRRKILTPAFHFNILQ

EFIQIFNEETKRLVEDLEAESHKPYIDVVVPITQFTLLSIGETAMGIKLNASDNDKDGYKRAVYKIGQLL

TYRAPRPWIHNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEG

ANIDDEGIREEVDTFMFEGHDTTSVSICYTLMLLANHREVQEEILKEMEAVLDEEPPTYAKLQELKFMDR

VIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQIYDMHHNPNVFPDPEKFDPDRFLPENIQKR

HPFAYIPFSAGSRNCIGQKFAMLEIKTVLCGILKKFILEAVDTRKDMAFVSDLVLRPKGSIKVKFVPRRA

N

 

>CYP4Q4 Tribolium 1 aa diff

TSVSICYTLM  LLANHREVQE  EILKEMEAVL  DEKPPTY  AKLQELKFMD

RVIKESLRLY  PSVPFISRVS  GSEIQTKTG  YTIPKDCMVN  LQIYDMHHNP

NVFPDPEKFD  PDRFLPENIQ  KRHPFAYI

 

>CYP4Q5 Tribolium castaneum

MIQSTLLLIFIVILSVIIYIWWYQNFSRFFSLLNKVPGPPGYPIIGNIIQFLATPEELFKIDRELGRRFY

PIYKEWTLTYGAVNLLHPDDIELVLSNSKYNDKSAIYDFLHCWLGTGLLTSSGTKWQTRRKVLTPAFHFN

ILQQFLPIFNEETVKLIKNIKNDQPIDVIPPVTQFTLLSIAETSMGVKLDASPKSCDDYKNAIHVFGYAL

TYRLGRPWLHNPFVFFNLTRLGHLTKKSIKILHDFSRNVIEQKKRTFEGEKRGKRLAMLDLLLLAKHQGA

DIDDEGIAEEVDTFMFEGHDTTSIAICYTLLLLANHPDIQDELYSELKSVLSDPTQTPSYSDLKQLNLME

RCIKESLRIFPSVPFISRLLTEDLTTASGYVIPRGSMAHIHIYDLHNNPEIYPDPKKFDPDRFLPENCQK

RHPFAYLPFSAGPRNCIGQKFAMLELKVVLSGILGNFVLEAVDKPKDVTMITDLVLRCKGPIRVKFVPRY

KIN

 

>CYP4Q5 Tribolium

TSIAICYTLL  LLANHPDIQD  ELYSELKSVL  SDPTQTPSY  SDLKQLNLME

RCIKESLRIF  PSVPFISRLL  TEDLTTASG  YVIPRGSMAH  IHIYDLHNNP

EIYPDPKKFD  PDRFLPENCQ  KRHPFAYL

 

>CYP4Q6 Tribolium castaneum

MLSFYLLLTGVGLILLLQTWRFFRKYFKNKTILKKIRGPPETPIFGHMYIFTQDP 

DLLFSRIRKYSREYYPIFRFSALYVDIVNFLEPNDIELILSTTKHLSKSKIYTFLNNWLGTG

LLTSTGAKWHQRRKILTPAFHFNILQQFLNIFNDETEKLVLRLGEDCGRTIDVVPPVTNFTLQSIAETAM

GLSNINELTQKEYKKAIYKIGHIFLKRLSKPWYRLDAIYNYSKLAEEENATVKILHDFSNGIISEREKER

TTNLSQNLASYSKKKRMAMLDLLLAAKNEGADIDYEGIREEVDTFMFEGHDTTSMAISFILLTLANLQDV

QTKVREEILSVVGKEKIPTYNDLQELKYTERCIKETLRLFPSVPFISRYASEDFVTKTGYTIPEGTVLHI

HIFDLHRNAEIYPDPLKFDPDRFLPEKVNERHPFAYIPFSAGPRNCIGQKFAFLELKTVLCGILRKFKLE

KVDDMYEIEFRPDLVLRPKNDVKVRIEKL

 

>CYP4Q6 Tribolium 5 aa diffs

TSMAISFILL  TLANLQDIQT  KVREEILSVV  GKEKIPTY  NDLQELKYTK

RCIKETLRLF  PSVPFISRYA  SEDFVTKTG  NTIPEGTVLH  IHIFDLHRNA

EIYPDLLKFD  PDRFLPDKVN  ERHPFAYI

 

>CYP4Q7v1 Tribolium castaneum

MLVLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNILPLYTSAENIFKQLREWG

RLYYPIYKLNAAHLAAANILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPA

FHFSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFTLKTIAETAMGTKLRFTTRKETIYKQSI

VDMGEFLLYRLLRCWLISKCIYVFNPRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRR

LAMLDLLLTAKNKEGLIDDEGIREEVDTFMFEGHDTTAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIK

KKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKGSIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYLPFSAGPRNCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVDIV

LRTKEGIKVRFIPRV

 

>CYP4Q7v2 Tribolium castaneum

MLVLTTVLTAAAVFLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNIPPLYTSAENIFKQLREWG

RLYYPIYKLNAAHLAAANILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPA

FHFSILQQFVAIFNEETDKLVEVLKEECYKPFVNVNAHVAQFTLKTIA ETAMGTKLRFTTRKETIYKQSI

VDMGEFLLYRLLRCWLISKCIYVFN PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRR

LAMLDLLLTAKNKEGLIDDEGIREEVDTFMFEGHDTTAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIK

KKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKASIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYLPFSAGPRNCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVDIV

LRTKEGIKVRFIPRV

 

>CYP4Q7     Tribolium castaneum (red flour beetle)

TAAALGFALMVLAGHKEVQDKIVEEMNEVLGDIKKKPTYQDLQEM

KYLERCVKEVLRLYPSVHFISKRLGEDLVTHSGHKLAKGSIVNLHIYDLHHNPAIYPDP

EKFDPDRFLPENCQKRHPFAYL

 

>CYP4Q7v1 Tribolium castaneum 2 aa diffs old CYP4R1

TAAALGFALM  VLAGHKEVQD  KIVEEMNEVL  GDIKKKPTY  QDLQEMKYLE

RCVKEVLRLY  PSVHFISKRL  GEDLVTHSG  HKLAKGSIVN  LHIYDLHHNP

AIYPDPEKFD  PDRFLPENCQ  KRHPFAYL

 

>CYP4Q8 Tribolium castaneum

MVLENIIIGLAAATAICYLFKQLIEMALVIFFVQKMPGPRKFNLFYGNMRPLHSSPAEIFNVLRKWGLEY

YPIYKLWLFFVSVANIMSPEDLALILPDMKHSKKSIAYDLIHRWLGSGLLTSYGTHWQVRRKILTPAFHF

SILQDFILTFNESTEELVELLKKEVEKPFVEITPLITXXXXXXXX

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

PKFYEERKLIKLLHNFTNDIIAKRRKDFHQGIVASQ

KKKRLAMLDLLLTVQKEEGIIDDEGIREEVDTFMFEGHDTVSSAINFALMVLANHPTVQEEIVQEMKDVL

GDTKKKPVYNDLQELKYMERVIKEVLRLYPSVHYISRELGEDMVTTTGYKLRKGTILQLHIYDLHYNPVI

YPEPEKFDPDRFLPENCDKRHPYAYIPFSAGPRNCIGQRFAMLELKAVLCGILSNFTLQPVDTPESIVMV

EDIVLRTKENIKVKFVPREM

 

>CYP4Q8 Tribolium castaneum old CYPR22

VSSAINFALM  VLANHPTVQE  EIVQEMKDVL  GDTKKKPVY  NDLQELKYME

RVIKEVLRLY  PSVHYISREL  GEDMVTTTG  YKLRKGTILQ  LHIYDLHYNP

VIYPEPEKFD  PDRFLPENCD  KRHPYAYI

 

>CYP4Q9P Tribolium castaneum

MIILLIIVALVLALFLKPLGHYISIIKYVQQLPGPPCENFLHGNITHLYGPP 

EKMFKTVRKWGLEYYPIYQNWIAHVAVANVMNPYDFEV

ILSNMKH TSKSMIYDMLHCWLGTGLLTSDGIKWQTRRKILTPAFHFNILQEFIKIFNEETETLVQQL

KKHSNSSVDVTEYISAFTLNTIG 

ETAMGTSFGTETSTGREYKKSIQEIGEILKYKLLRPWLLSKFVYVCDPNYWKEIKLVKIL

HNFTNNVIANRQSNFKPVEQKSDEFSYSRRKRMAMLDLLLTAKNEDNLIDDEGIREEVD

TFMFEGHDT

TAVAICFALMCIACHPDIQ 

ERIFEEIEETFSDDTKPDYKSLQELKYMERCIKEVLRLYPSVPFIARSLGE

DIVTYSGHKLKAGSMVHLHIYDMHHNPQVYPDPEKFDPDRFLPENCLKRHNFAYVFP

SAGPRNCIGQKFAILEMKAVLVGILKEFTLEPVD

VDTPETLVMKTDLVLRAMNGVRVKFVPRICAK*

 

>CYP4Q9P Tribolium castaneum 1 aa diff at end old CYPS25

TAVAICFALM  CIACHPDIQE  RIFEEIEETF  SDDTKPDY  KSLQELKYME

RCIKEVLRLY  PSVPFIARSL  GEDIVTYSG  HKLKAGSMVH  LHIYDMHHNP

QVYPDPEKFD  PDRFLPENCL  KRHNFAFV

 

>CYP4Q10 P4Q53c63 Leptinotarsa decemlineata (Colorado potato beetle) DQ631651

49% to 4C3, 51% to 4C25, 66% to CYP4Q3 = XP_971112, 67% to P4G758106

GEGPSNCIGQKFAMLELKTVYCGILRNFILEPVDTPNTLRLIPDLILRTENVSLEVKFRLRHPQ

 

>CYP4Q11 P4G758106 Leptinotarsa decemlineata (Colorado potato beetle) DQ631652

53% to 4J9, 52% to 4C3, 68% to CYP4Q8 = XP_970987

PFSAGPRNCIGQKFAMLEIKAVLCGILRNFALEPQDTPDTIKIVPDLVLRTTDGKIRVKFRSRQ

 

>CYP4S1 Helicoverpa armigera (Australian cotton bollworm) U86001.1

EVDTFMFEGHDTTAMAIVLGLMLIADHEEVQDRIFEESVKIFPDAESTPSMSDLADM

KYLEAVIKETLRLYPSVPFIARAITEDFMLDDLLVKKGSEVSIHIYDLHRRADLFPEP

EAFKPERFLSGEAMHPYAFVRFTAGPRNCIGQ

 

>CYP4S2 Helicoverpa armigera (Australian cotton bollworm) U86000

EVDTFMFEGHDTTALALTFGLMLLADYEDVQERIYEECQSIVGESEHVTMSHLADM

KYLEAVIKETLRLYPSVPFIGREIVEDFKLGDLLVKKGSTVDVHIYELHHREDLFPDA

EAFKPERFLTNELKHPYAYVPFSAGPRNCIGQ

 

>Cyp4s3 D. melanogaster AC018488 comp(98620-101060) also AC015418 AC018487

MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKG

EILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESW

HRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICET

AMGIKKHAQLQSDSEYVQAVQS

ICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHD

ETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREE

VDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLR

IYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQ

MHPFAFAAFSAGPRNCI

GQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNG

IRLRILPRDENGTTA

 

>Cyp4s3 D. pseudoobscura ortholog

MNTWALMAFALWALFLRYLPQILTFLRLQRFAKTLPGPSVSELIANVKKG

EILNWLKELRERHGPVFRIWFGKDLMVMFSDPEDIRQLLGNNSLLYKSRNYALLEPWLGKGLLTNGGESW

HRRRKLLTPGFHFRILSEFKEPMEENCRILVSQLKERANGEAFDIYPYITLFALDAICET

AMGIKKHAQLQSESEYVKAVQT

ICRVMHKQSFSFWQRLNIFFKYTQAGQERDGALRVLHD

ETNRVIRLRREQLVKERQLQQRTEAAQDDVGSKRRLAFLDMLLLTQLEGGDELSDRDIRE

EVDTFMFEGHDTTSSAIAFALSLLSKHSEVQQRAYEEARDLEGREKESMPYLEAIIKETL

RLYPSVPFFSRKVFEDIQVGKHTIPKGASVNCLIYMLHRDCNNFPDPERFDPDRFYLNEK

QMHPFAFAAFSAGPRNCI

GQKFAMLELKCSLSSLLRSFQFMPDEDHQPIPLAELVMKSGNGVRLRIQPRSQH*

 

>CYP4S4 MbraB1 antennae of the moth Mamestra brassicae AY063500

Martine Maibeche 86% to 4S1

MLLTLALLGF ITFVIWRLLA DEENTLDQLP GPPRRPIIGC ALEFLKISPR

ELFLKMRQYK KEYGDRYVIK MMKRRILHLS NEKDVEVVLS HSRNIKKSKP

YTFLEAWLGT GLLLSSGAKW HRRRKILTPT FHFNILKSFT VVMKEKSRSL

VETLNNLEGT EVNLLPVISD YTLYTICETA MGTQLDADKS SKTLEYKTAI

LEIGNLLLGR LTRVWLHNEY LFKKFPIGRR FENCLEKVHS FADDVIMERK

KNWKPGQSEF TEDDVSIGGK KRYAMLDLLL EAENKGEIDL EGIREEVNTL

MFEGHDTTAM AIVLGLMLIA DHEEVQDRIF EECQKILGDS DRTPTMSDLA

DMKYLEAVIK ETLRLYPSVP FIAREITEDF MLDDLPVKKG SEVSIHIYDL

HRRPDLFPEP DAFIPDRFLS GAPMHPYAFV PFSAGPRNCI GQRFAMLEMK

CVFSAICRNF RLAPKVQGYR PALLADMLIR PEGPVYVKFS RR

 

>CYP4S5 Bombyx mori 66% to CYP4S4 from the moth Mamestra brassicae

MIWAVVLLIIFIFLIWKALEDEENPLDSLPGPERKPIIGATMRFVNLNT ()

3009 GEMFIKLREYHAMYGTRYVVKIFKRRILHLSNERDVE (0)

 365 VVLSHSKNIKKSKPYTFLSPWLGSDLLLST 454

GFKWHSRRKILTPTFHFNILKSFLEIIKDKSCDLVKRLEEYRGEEVDLMPVISDFTLFTIC

ETAMGTQLDSDKSAETSEYKMAILQIGSLLLDRLTKVWLHNDFIFRQFTVGRKFQKCLKQVHSFAHN

VIVERKRQRASGRDPTVVAEDVFG

RKKRLAMLDLLLEAEEKNEIDFEGIMDEVNTFMFE (1?)

GHDTTAVALTFSLMLVAEDDQVQ (0?)

DRIYKELQGIFGDSDRRPTISDVAEMKYLEAVVKETLRLYPSVPFIAREITEDFML ()

DDLKIKKGSEVAVHIYDLHRRKELFSDPEKFLPDRFLNGELKHPYSFVPFSAGPRNCI (1)

GQRFATLEMKCVLSEICRSFRLEPRTKGCGLPS*

 

>CYP4S6 Bombyx mori 94% to CYP4S5 missing C-term.

164 MIWTVVVLIIFIFLIWKALEDEENPLDSLPGPERKPIIGAALRFVNLNT 18 ()

     REMFIKLREYHAMYGTRFVVKIFKRRVLHLSNEKDAE (0)

     VVLSHSKNIKKSKGYTFLSPWLGSGLLLST (1)

1053 GFKWHSRRKILTPTFHFNILKSFLEIIKDKSCDLVKRLEEYRGEEVDLMPVISDFTLYTIC 1235

1966 ETAMGTQLDSDKSAETKEYKMAILQIASLLLNRLTKVWLHNDLIFDQLTVGRKFQK 2133

2134 CLKQVHSFAHNVIVERKRQRASGRDYSVVAEDVFGRKKRLAMLDLLLEAEEKNEIDFEGI 2313

2314 MDEVNTFMFE 2343 ()

2862 GHDTTAVALTFSLMLVAEDDQVQ 2930 ()

3158 DRIYKELQGIFGDSDRRPTISDVAEMKYLEAVVKETLRLYPSVPFIAREITEDFML 3325 ()

 578 DDLNIKKGSEVVVHIYDLHRRKELFADPEKFQPDRFLNGELKHPYSFVPFSAGPRNCI 751 ()

 

>CYP4S8v1 Spodoptera littoralis (cotton leafworm) Clone A2 AM086018.1

DTFMFEGHDTTALALTFGLMLLADHEDVQERIYEECQTILGDSEHVTMSNLSDMKYLEAV IKEILRLYPSCLSLDERSLKILSDITVKKGTTVDVHIYELHRRADMFPEPEKFMPERFLG

TEMKHPYAYVPFSAGPRNCIGQKI

 

>CYP4S8v2 Spodoptera littoralis (cotton leafworm) Clone A6 AM086019.1

DTFMFEGHDTTALALTFGLMLLADHEDVQERIYEECHTILGDSEHVTMSNLSDMKYLEAV

IKEILRLYPSCLSLDERSLKILSDITVKKGTTVDVHIYELHRRADMFPEPEKFMPERFLG

TEMKHPYAYVPFSAGPRNCIGQKI

 

>CYP4S8v3 Spodoptera littoralis (cotton leafworm) Clone A9 AM086020.1

DTFMFEGHDTTALALTFGLMLLADHEDVQERIHEECQTILGDSEHVTMSNLSDMKYLEAV

IKEILRLYPSCLSLDERSLKILSDITVKKGTTVDVHIYELHRRADMFPEPEKFMPERFLG

TEMKHPYAYVPFSAGPRNCIGQKI

 

>CYP4S8v4 Spodoptera litura (common cutworm) DQ355381.1

SB1: 84% to 4S2, identical to 4S8v1 except for a short

frameshifted region.

The CYP4S8v1 sequence is probably wrong in this region.

QVDTFMFEGHDTTALALTFGLMLLADHEDVQERIYEECQTILGDSEHVTMSNLSDMKYLEAVIKEILRLYPSVPFIGREITEDFKLGDITVKKGTTVDVHIYELHRRADMFPEPEKFMPERFLGTEMKHPYAYVPFSAGPRNCIGQKI

 

>CYP4S9v1  Spodoptera litura (common cutworm) DQ355383.2

RTH17: 78% to 4S4, 97% to 4S9v2

TLHVEGHDTTAMALVFGLMLLADHPEVQERIYEECQTILGDSDTSPTMSDLAEMKYLEAVIKEILRLYPSVPFIAREVTEDFMLGDVLVKKGTEVSIHIYDLHRLPELYPDPEAFKPERFLNQQPTHPYAFVPFSAGPRNCIGQKIA

 

>CYP4S9v2 Spodoptera litura (common cutworm) DQ355384.1

SA4: 78% to 4S4, 97% to 4S9v1

DTFMFEGHDTTAMALVFGLMLLADHPEVQERIYEECQTILGDSDTSPTMSDLAEMKYLEAVIKEILKLYPSVPFIAREVTEDFMLGDVLVKKGTEVSIHIYDLHRLPELYPDPEAFKPERFLNQQPTHPYAFVPFSAGPRNCIGQKIA

 

>CYP4S10 Plutella xylostella (L.) (diamondback moth) 1 aa diff to CYP4S10v2

DTFMFEGHDTTAMALTFALMLLAEHREVQDKIYEELEGIFGSSDRTPSMADQAAMKYLEA

VIKETLRLYPSVPFIAREITEDFMMGDLPVKKGTEVAVHIYDLHRRPYLYADPEVFRPER

FLGAGPKHPYAFVPFSAGPRNCIGQKI

 

>CYP4S10v2 Plutella xylostella EU189052

MFEGHDTTAMALTFALMLLAEHREVQDKIYEELEGIFGSSDRTP

SMADQAAMKYLEAVIKETLRLYPSVPFIAREITEDFMMGDLPVKKGTEVAVHIYDLHR

RPYFYADPEVFRPERFLGAGPKHPYAFVPFSAGPRNCIGQK

 

>CYP4S11 Spodoptera exigua EF113592

EVDTFMFEGHDTTALALTLGLMLIADHEEVQERIYEECQTVLGD

SEHVTMSNLSDMKYLEAVIKEILRLYPSVPFIGREITEDFKLGDLLVKKGTTVDVHIY

ELHRRADMFPEPEKFMPERFLGTEMKHPYAYVPFMAGPRNCIGQ

 

>CYP4S13 HAH006401 67% TO CYP4S5, 45% to CYP4M15, 45% to CYP4J9

EF591060 (3 aa diffs)

RRILHVHNVKDVEVVLAHSRNIKKSKPYTFLESWLGTGLLLSNGAKWHKHRRILTPTFHFNILKSFSIVMKERSKGLVEKIKTLENTDVNLLPLISDYTLFIICETAMGTQLDSDKSAKTQEYKSAILSIGNLLFARLTRVWLHNEYFFKMHSLGRRFQKCLEKVHSFADDVIMERKKNWKPGQSEFTEEDSVGGKKRLAMLDLLLEAESKGEIDLEGIREEVNTFMFEGHDTTAMAIVLGLMLIADHEEVQDRIFEECQKIFPDAESTPSMSDLAEMKYLEAVIKETLRLYPSVPFIARAITEDFMLDDLLVKKGSEVSIHIYDLHRRADLFPEPEAFKPERFLSGEAMHPYAFVPFSAGPRNCIGQRFAMLDMKCVLSGICRNFKLQPRVKGARPALLADMLIRPAEPIY

 

>CYP4S13 Helicoverpa armigera EF591060 (3 aa diffs to HAH006401)

MLLSLALVGFITFVLWRLLAEEENPLDKLPGPKKLPIVGSAFEF

MRMNPRDLFIKVRLFAEIYGDRYLIKILGRRILHVHNVKDVEVVLAHSRNIKKSKPYT

FLESWLGTGLLLSNGAKWHKRRKILTPTFHFNILKSFSIVMKERSKGLVEKIKTLENT

DVNLLPLISDYTLFIICETAMGTQLDSDKSAKTQEYKSAILSIGNLLFARLTRVWLHN

EYFFKMHSLGRRFQKCLEKVHSFADDVIMERKKNWKPGQSEFTEEDSVGGKKRLAMLD

LLLEAESKGEIDLEGIREEVNTFMFEGHDTTAMAIVLGLMLIADHEEVQDRIFEECQK

IFPDAESTPSMSDLAEMKYLEAVIKETLRLYPSVPFIARAITEDFMLDDLLVKKGSEV

SIHIYDLHRRADLFPEPEAFKPERFLSGEAMHPYAFVPFSAGPRNCIGQRFAMLEMKC

VLSGICRNFKLQPRVKGARPALLADMLIRPAEPIYVKFIRR

 

>CYP4U1 Coptotermes acinaciformis (termite) AF046010

MLLVALGLLLACLLAVLFLNDFKTRSRMQLADKIPGPKALPVLG

NLLDFGLRPDRYRELVEGLIYKHGTIVRLWSGAYLIVILTEAKYVEALLSSTSQIDKA

YTYRFVWPWLGSGLLTSTGQALGNPPQAADSSFPLQGTREFRGCVQQKWKILVEKFSR

HVNGPEFDVTPYMTLCALDNMSETSMGVTLNAQKDSDSEYVRAIHSLGEIVFTRSGKP

WYHSDTTFRLSTLGREQQKNLAILHSFTRSVIRSRKQELLVHLNNQSGEGVQNELGLK

RRHAFLDLMLQASQDGASLTDEEIREEVDTFMFEGHDTTTSALSFTMWCLAKYQDVQE

KAVVELKQIFGDSTRDATFRDLQEMKYLEQVIKETLRLYPSVNCFGRQLTENFTVGDY

VNPAGANVWIYPYHLHRRPEYFPDPERFDPDRFLPENCVGRHPYCYVPFSAGPRNCIG

QKFAILELKSTISQVLRSFKVIESDCNGNIRYKLDFVLRSASGLKVKLQPR

 

>CYP4U2 Coptotermes acinaciformis (termite) GenEMBL AF046011

DTTTSALSFTLWCLAKYQDVQEKAVVELKQIFGDSTRDATFRDL

QEMKYLEQVIKETLRLYPSVYVFGRQLTENLTVGDYVIPAGANVGIYPYSLHRRTEYF

PDPERFDPDRFLPENCVGRHPYCYVPFSAGP

 

>CYP4U3 Reticulitermes flavipes RfP4501V1 DQ279461

99% to CYP4U3v1 (only 1 aa diff)

98% to 4U3v2 (only 2 aa diffs)

52% to CYP4U1 Coptotermes acinaciformis (termite),

69% to CYP4U2 partial seq

47% to CYP4BN6 Tribolium

MLTVALSCILLGALALYMHFRARIRPMMMLSERMPGPRLHPVVGNALQFGFKTEDFLENLTRAVREHGTITRIWLGNELVILLWDPRYVETLLTNTRMLDKAFMYQFMHTWLGEGLLTATGTKWKEHRKLFTPAFHFKILEEFVGVFNSNDRIMIQKLDKHVNGPGFDIRPYISLCTLDMICETAMGVQVHAQEDSNSEYVRAVRGMADIIMQRTFKPWIQLDSLFRLSPLARQQTKYLAILHDMTNSVIKMSKEEYLQKRANSLTTEERNDIGAKRRLAFLDLLIQAQQDGATISDKEIREEVDTFMFEGQDTTTSGICFTLWALAKHQDVQAKALQEQRAIFGGSDRDATYTDLQEMKYLEQVIKEAHRLYPPVPLYGRRISENLTVGDYVLPAGSNVMVHAFMLHRNPDHFPDPERFDPDRFLTENCKDRHPYCYIPFSAGSRNCIGQKFAMLEMKATISAVLRHYKLSLEDPSETPWFVLEVVLTSLNGTRLKLEPRLWSAPGF

 

>CYP4U3v1   Reticulitermes flavipes (termite) #1V1

TSGICFTLWALAKHQDVQAKALQEQRAIFGGSDRDATYTDLQEMKYLEQVIKEAHRLYPPVPLYGRRISENLTVGDYVLPAGSNVMVLAFMLHRNPDHFPDPERFDPDRFLTENCKDRHPYCYI

 

>CYP4U3v2   Reticulitermes flavipes (termite) #1V2 DQ279462

TSGICFTLWALAKHQDVQAKALQEQRAIFGGSDRDATYTDLQEMKYLEQVIKEAHRLYPPVPMYGRRISENLTVGDYVLPAGSNVMVHAFMLHRNPDHFPDPERFDPDRFLTENCKDRHPYCYV

 

>CYP4U4P Reticulitermes flavipes pseudogene DQ279472

SALSFTV*CLSKFPEVQEKAVDELKQIFGDSTRDATFRDLQQMKYL &

EQVIIETLRPSVAMSGRQITDNLTVGDYVIPAGADALVLPYFVHRRPEYFPDPERFDPD &

RFLPDNCVGRHPYCYV

 

>Cyp4aa1 D. melanogaster AC020355 comp(15477-16779) AC007579 comp(38212-38842)

MHLRLLSPPQLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNCMLVTDKD

LMRRCAGKAFDLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVF

FYRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDAEAV

GTEINIAKYVNNCVLDILN

EAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLL

DGIYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRD

FTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMT

DLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIY

PDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPV

TGKTTIAATFRITLRASGGLWVRLKERDHPLIAH

 

>Cyp4aa1 D. pseudoobscura 79%

MQFYTRMTV

PQLERATRTELCSILALLVISLSIYLFYAHLDTYLRSVILSLRLSGPPTLPILGNCLLIKDKD

LMRNQAAKAFDLYGSLVRIWVLFFPFFVVLQPEDLQVILSSQKHTNKVFIYQLMHNFL

GDGLITSSGLKWSTHRRLIQPAFHLSLLEKFIGTFVDASQSLYESVGASAVGTDINIVSI

VNNCVVDILN

EAVLGVPIKKKGLDLVKIDESPFRQGKLMIPTRFSHPWLLFDGIYHWTKL

ANDELNQKKRLHDFTRQMIKIRREILANTGNNNAERKCLLDYMIEISESNPDFTEQDIVN

EACTFMLAGQDSVGGAVAFTIFLLAQNAECQEQCHEELERIFDYSDRAPTMSDLREMRYL

EMCIKEALRLYPTVPLIARKLGEEVRLSDHTLPAGSNIFICPYATHRLNNIYPEPEKFNP

ERFSPENSKDRHPYAFIPFSAGPRYCIGNRFAIMEMKTIVSRLLRSFQLLPVAGKTTFDV

SYRITLRASGGLWVRLKPRDHPISQTRDSDCFGL*

 

>CYPi2r2 = CYP4AA1 Anopheles gambiae, 512aa 55% to Drosophila 4AA1

MIDDLSRYEQGLCNVHASLHLEKSSAVELYTYLTLILVCVLLYIFSDYLKICALAFRLPGPKSYPIIGNCLDIARKDLITREMAQAYKNYGPLARVWIFVFPMFVVFDPNDLKMILSSKKHTNKSMFYKLLHNFLGRGLITSSGHKWSSHRKLIQPSFNIAILEKFIDTFTDSASFLIDKLPKEETVLNVTEYVNNCVLDILNEAVLGVPVKSVDKKEMEQSPFRQGKVVAPYRITHPWLLFNSIYKLTDAATAELNQKKQLDDFSRKMIRRRREILKTLSPSDRRCLLDFMIEISNENPEFTEDDIIDEACTFMLAGQDSVGAAVAFTLFLLARHQDQQAKCYEEIERHIGTDCSKPPSAEGIRELRHLEACIKESLRLYPSVPLMARKIGEDVRVGKYNLPTGTEIMILPYATHRLEHIYPDPERFDPERFGDGAPHQNPYAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAPGKEEVQPIFRMTLRARGGLWVKMTPRKVVS*

 

>CYP4AA1-de7b8b Anopheles gambiae CYPi2r1 AAAB01008888.1

nearly identical to 4AA1

IEI*NENPEFTEDDIIDEACTFMLA

GQDSVGAAVAFTLFLLARHQDQQAKCYEEIERHIGTDCSKPPSAEGIRELRHLEA

CIKESLRLYPSVPLMARKIGEDVRVGKYNLPTGTEIMILPYATHRLEHIYP

PDPERFDPERFGDGAPH*NPYAFLPFSAGPRNCIGYKFAYIEMKTVIARVLQNFHLSPAP

GKEEVQPIFRMTLRARGGLWVKMTPRKVVS*

 

>CYP4AA1 Apis mellifera

MGKVSSSLTSIYILYILRTYIRSIIYISQLNGPKTIPIIGNANSILKEN

FLYRLAYESQMYGRIVRIWLTIFPYVMFLEPEDIQLILNNAKHTQKVFFYKLLDNFLGKGL

ITRDIKSWRIHRRLLQPAFHLHVLEKFTNTFAKHADHLMNKILEKNNQEINITTFINDSVYNILS

ETVLGINRINRINEMDDLPFRK

GQIMLLYRMIRPWLLIEWIYRLTKYGREEEKQRKNLFDTCFKMVKEKRDLLQSKDRISNNDIKKNKNISLLEYMVEINEKNPCFSDEDIVEECCTFMLAGQDSVGTATAMTIFLLANHPEWQNKCIEEIDEIFNGDTRFPTISDLKEMKCLEMCIKESLRLYPSVPIIGRTLGEDIKI

GKHIIPAGCSVLISPYSTHHLPHHFPDPDTFKPERFNSENSEKRHPYAYIPFSAGPRNCI

GYKFAMLEMKSIISAILRKCRLQSIPGKKEIRPKFRMTIRAQGGLWVKIIERDQILKSIAA*

 

>CYP4AA1 ortholog Nasonia vitripennis (jewel wasp)

WDRDAQELWIYVALIVGTLAIYLLKDQIRIYWTIFQLNGPPTVPLLGNVDCLL

RKDI LEVMSHTAYKDYGPVARFWVTLIPYVILLEPDDIQAVLGSAKHTSK

IFVYRLLDNFLGKGLITSDVDTWRTHRRLLQPAFHLHVLQKFVGSFAERADRL

ADRLARYDNQQLDITKFVNDAVYEILNE TVLGVNVASTANEDGVVDLDDL

PFRK GQVLMTHRLIRPWLIFDWIYKLTSTGQQEKKQSQDLSAACHRIIQE

KRRLQRDSSSLTKKTSLLEYMMETSERNPEWFSDEDIINECCTFMLAGQDSVG

TATAMTLFLLANHPDWQDKCREELDEIFAEGETNRPPTMQDLRAMRWLECCIK

EALRLYPSVPIFARKLGEDVKVG KHVIPSGCGVIILPYSTHRLPHHFPDP

HSFRPERFSPENSEKRHPYAYLPFSAGPRNCIG NKFAILEMKAVISAILR

RYRLGGVEGKTEVRPKFRLTVRASGGLWLKISQRVDAR*

 

>CYP4AA1 Tribolium castaneum

MWTDICTYLVILAVMLMSIYFKNYIRSVYLAFQLSGPPAVPLIGNVL

LMKNDRSKYQFFRGHILS

EMYSPFMRCWLSIFPVFFIYEPKALQLIMGTNRYTSKNIFYNCLHNVVGDGLITSS 

GEIWKQHRKLIQPYFHISVLKVYFDIFYKWS

MAMVQDLENETEVNITKYANKFVFD 

SQYWAFLGKDQSRLLIGGNLVQHIHQ 

CQFLMLHRITRPWLLFNTIFKRTDFSKVEENQKNILQQYTKS 

ILDGKKQNSHGTAMNNLMEMMMEISNMNPEFTDDDIVNETCTFMLA 

GQDSVGAALSFALYSLAAHQDIQEKVVQELNGIFKDGNQAATFEDVAEMKYLEQCIKETLRLYPSVPM

ITRKITEDVPL

GKYTLPTGTNIVISPFVTHRLPHVFPDPLKFDPDRFS

PENKAKIHPYGFIPFSAGPRNCI 

GYKFAIIELKTVLSQILRKYHVSLVPGREKLILSYRMTLKAKKGIWLRLKKRSV*

 

>CYP4AA1 Lutzomyia longipalpis Jacobina (phlebotomine sandfly)

            GenEMBL AM096652 AM096653 AM096654 AM096655, EW993708.1

            63% to anoph. 4AA1, 62% to Drosophila 4AA1

4    FLKLLHNFLGNGLITSSGDKWNVHRKLIQPSFHLNILEKFIGTFNDSSQCLLDKFKSVEG  183

184  EVNITDFVNNCVLDILNEAVLGVPVFREDKEKEKSPFRQGKVVMPYRVTRPWLLLNWVY  360

361  KLTDTAASELNQKKQLDNFTRKMIHIRREAKRTGNLGERKCLLDYLIDISDQVPDFTEDD  540

541  IINEACTFMLAGQDSVGAAVAFSFFMLAQNPDCQKKCIEEIDNIFDGDTRAPTMRDLRE  717

718  MRYLEQCIKETLRLYPSVPLLARRLGEDIRVGEHTLIAGSHIFIVPYAIHRLPYIYPDPE  897

     KFDPDRFLPEEVEKRNPYAFLPFSAGPRNCIGHKFAILEMKTVISKILR  379

378  HFTLHPVEGKEDLHPSFRVTLRATVGLWIKLQRRDKV  268

 

>CYP4AB1     Solenopsis invicta (fire ant) AY345970

MPRQHLINLLFSLCDKYYPIFRTWAFFEGFVSIRHPDDLEVILN

SSTNIEKSRIYSVLHPWFGLGLLTSGGSKWHSRRKILTPTFHFNILQQFVEILIEEGE

SMTNSLKNAGSTITKDLVPLISEHTLNAICETAMGTSLQGMNSVQQEYRKAVHRMGEL

FIYRLVRHWLISDWIFALTSQGREQVKILKILHGFTNKIIAERKDYHKRTNGQYLKNF

NQSIITDNEEIVGSKKKRLAMLDFLIYASQEGHLTDVDIREEVDTFMFEGHDTTSTSL

CYTLALLAENKDIQDRVRQEVDLVMQENEGKLTIKSLQNLQYLERCIKESLRLYPSVY

FISRITTEEAQLKSHLIPVGTIMHLHIYGVHRDPNFWPNPDVFDPDRFLPENSRNRHP

YSYIPFSAGPRNCIGQRFAMLEMKAMIAPLIHNFCLEPVDLLKNLRVGPDLVLRPLGG

HRIKFIPIATKCI*

 

>CYP4AB2     Solenopsis invicta (fire ant) AY345971

MFIALLLIIIVVYLMCHCYAQYGPNGRLINKIPGPPGYPIIGNL

FNLLESREQFWETLSILNEQYYPIYKLRAFFNSLVFIRHPDDLEIILNNTKHISKSNL

YDALRPWLGMGLLTSGGSKWHLRRKILTPTFHFNILQQFVEILIEEGESMTRSLKNAG

GTITKDLVPFISEYTLNAICETAMGTSLQEMGSFQQQYRKAVHRMGELLVYRAMRPWL

KYDWIFSLTSKGREQKKLLKILHGFTEKVIAKRKDYHKRTKGQYLKNLNKDVVPNETE

TIGIKKKRFAMLDLLIQASQEGLLTDFDIREEVDTFMFEGFDTTGMAMCFILSLLAEH

KDIQDCVRKEIDAVMQENQGKLNMKSLQDLQYLERCIKEALRLYPSVYFISRITSEET

ELKTYLIPAGTLVILNFYITHRDSNFWPNPEVFDPDRFLPDNIRNRHPYSYLPFSAGP

RNCIGQRFALLELKAMLVPLIYNFYLEPVDYLENQRFGIDMILRSLDPCRLKFVPIAT

EGI

 

>CYP4AB3 Apis mellifera (honeybee)

MISAILFFIFLLATLHYFLLHHRKFGKMINLIPGPEPLPILGNIPTFHNISP (1)

SELWKFLTQLSKQYYPIYRMWTFLEAYVHICHPDDIE (0)

TILGNIKFTKKGFGYKYLKPWFNTGLLTSS (1)

GHKWHVRRKILTSAFHFNVLRQFVDIFIEDAERLIKTLESEEGIFVENLLQLTSEHTLNVIC (1)

ETAMGTSLKNKEKFQYEYRKAVYNMGCIFANR(2)

IVKPWFYYDFFFNLSPEGWQQSKLLKILHNFTRK(0)

IIQERKEYHDKTNGRYLNDFHENINENDNNNDYND(1)

FRRKRLAMLDLLIEAHRNNKIDDEGIREEVDTFMFR(0)

GHDTTAISFCFSIMLLAEHKEIQ(0)

DRARAEIKAAIEENGGKLNITVLQNLPYLERCIKESLRLFPSVPRISRKLETSVKL (1)

SNYEIPSNTIINVNIFDTHRDPKFWPNPNKFDPDRFLPENSKKRHPYAYVPFSAGPRNCI (1)

GQRFAMLELKTYLGLLLYNYYFEPIDYLKDVTFVSGIVLRLENPVRMKFIPVKKIC*

 

>CYP4AB4 Nasonia Nv4n32 515aa 12 exons SCAFFOLD4 minus

MIVEFLLLLLLAACIFHYYTRCGRVAKLTENIPGVRAWPIVGSLPGLMKSQG(

1)ELWPIFRKMSNDYYPTYKFWTTHEVVINIRHPDDIE(0)ILLSSVQHLEKS

TAYKLLHPWLKTGLLTSAG(1)NKWQARRKILTPAFHFNVLKKYMDIIVENSE

RMVRSLKTKASDGPIIDLLQFSTNYTLNVICE(1)TAMGTSLHGMEEFQEKYR

NAIHKMGDVLIYR(2)IARPWFRKESTFKWTQKGQEQTAALKVLHGFSEK(0)

IISERKEYHDQTKYNYLNQFMTDEVNDEEDNEIYGI(1)RKKRLAMLDLLISL

FRNGQIDDEGIQEEVDTFIFE(0)GHDTAAMGLSFALLLLAEHTDSQ(0)SRA

RDEVKEMFNKSGGKMGYSEIQQLQYLEMCIKESLRLYPSVPFISRQLKKDLQL

K(1)HYLIPSGAIMHVHIYDLHRDANFWPEPEKYDPERFSPDSIRNRHPFSYI

PFSAGPRNCIG(1)QRFAMMELKASIAHLLHHFILEPIDYAHEVPIRSDLVIR

PARPIRIKFVPIKHDALL*

 

>CYP4AB5 Nasonia Nv4n16 511aa 12 exons SCAFFOLD4 minus

MWLQILLTLLVVLFVIHYYIRGGRIGHYVNKMPGPPAYPLVGNLLSFMVPFD(

1)QLWQVVRKMNDDYYPLYRIWSTNVAVINLYHPDDAE(0)VLLSSTNHIEKS

FIYELLHPWFGTGLLTSTG(1)TKWQHRRKILTPAFHFNVLQKYMDIIIENDE

RFIDTLKAKGESVQNLLPLITNYTLNVICE(1)AAMGTSLQGKEELQARYRRA

IHDMGNILVYR(2)LVRPWLRWDRLFNLTPKGHEQKKALQVLHGFSTD(0)II

NERKEYHEKTESKFLNNTLASDESSKDNADTEVFGV(1)RKRRLAMLDLLIAA

YREKQIDDLGIREEVDTFMFE(0)GHDTSAMGVCFVLLLLAEHKDIQ(0)ARA

REEVEEVLGKTGGRIDLSAINQMSHLERCIKEALRLYPSVPFISRNINEDLHL

K(1)DYTVPRGTIAHIHVYDLHRDANFWPEPLKYDPDRFLPERTRNRHPFSYI

PFSAGSRNCIG(1)QKFAMMELKSITAHLLHDFHLEPIDLAHEVPIVCDLVLR

PARPIYMKFVPIEK*

 

>CYP4AB6 Nasonia Nv4n8 510aa 12 exons SCAFFOLD127 minus

MLIETIVVICMLLYAFHHYTRNDRIGRYVNKIPGPPTWPIVGNLPALSAPHE(

1)QLWPLGIKWDKQYYPIYKIWTTHKAVIVILHPDDVE(0)TLLTSMEHIEKS

IMYDMVHPWFGTGLLTSTG(1)AKWQKRRKILTPAFHFHVLQKYFDIIVENNE

KVMHSLKSNGSVINNLVELLTYYTLDVICE(1)TAMGTTLLDKEHQQKYRNVL

HDVSNAVIYR(2)LMRPWFQVDWTFRWTSVAEKQKKALEVIHGFSKK(0)IIK

ERKEYHEKTKGHYLNQLESDQSDDKKEDEEYFGC(1)RKKRLAMLDLLIAKQK

DGNQIDDAGIREEVDTFIFE(0)GHDTSAMAMCFAILLIAEHNDVQ(0)DRIR

AEVKEVLEKSEGKMGVPEIQQLNYLELCIKESLRLYPSVPFISRGVTKDLHLK

(1)NYIVPKGTLIQINIFSLHRDPNFWPDPEKFDPDRFLPDRFQGRHPYSYIP

FSAGPRNCIG(1)QKFAMMELKAFIAHLISEFYLEPIDLAHEVLITPDLVLRP

ARPVKVKIVPVNK*

 

>CYP4AB7 Nasonia Nv4n18 515aa 12 exons SCAFFOLD28 minus

MLVLTTLLLGILILGAIHVHIRGRRGRILAKMPGPSGWPIIGVLPSVLVPIE(

1)KLWMVGRNMDKQYYPLYKFWLANHVIVAILNPDDAE(0)VMLTSMQNIDKS

SVYNFLHAWFGTGLLTSTG(1)EKWQKRRKILTPAFHFNVLERYLTITVENSE

RAVKSLRGKGECVQDLVQFLTQHTLNIICE(1)AAMGASLSRKEESQKKYRKA

VHDMGSALVYR(2)LVRPWLYSSWTFGCTAAGRMQTDALKILHRFTKN(0)II

AERKEFHEKTDGRFLKNIVSKSSGADDDDEAVENEELHD(1)RKKRMAMLDLL

IAAQRDGQQIDELGIREEVDTFMFE(0)GHDTSAMGLCFALLLIAEHKDVQ(0

)ERIRQEVNEVLKNADGKLEMSELNKFNYLERVIKESLRLYPSVPFISRNITE

DMQLK(1)YLIPRGTLVDVRIYLIHRDPKHWPDPLKFDPDRFLPERIQGRHPF

SYIPFSAGPRNCIG(1)QKFAMMELKVFVALIVKNFILEPIDFAHEVPILPDI

VLRPARSVHVKFVPIAEK*

 

>CYP4AB8 Nasonia Nv4n19 513aa 11 exons SCAFFOLD28 minus

MAYYYLFTVLLGLVGLLFHFYIQLFSRTGKLVNKIPGPTAIPFFGNLLELHVP

LV(1)EINNALRKWSKIYYPIYRLWFGPKALVFILHPDDLE(0)IMLTSSKHI

NKQFAYEHFHLWLHSGLLTSNG(1)QKWHHRRKILTPAFHFNILKKYMEITNE

EGERAVTNTRKTTKETKVDLLQFCSKYTLNIICE(1)SAMGVPLDGDHKDKEA

SNKYKNAVYRMGNIIFFR(2)IIRPYIWDWMVPFIPKHNREVKEVVANLNNFT

DM(0)IVEERREYHASTNYEHLNFEKSEVNAYIGKSKRLAMLDLLLAAERDGK

IDDEGIKEEVSTFIFE(0)GHDTTAMSMCFIIMLLAENKHCQ(0)DLAREEVE

IILGPKNGQLETADLKHMNYLERCIKESLRLFPSVPSITRYLHEDVQLK(1)N

YKIPAGVNIIMHIIDVHRDPNFWPEPEKFVPDRFLPEEIAKRHNFAYLPFSAG

SRNCIG(1)QKFAMMELKSLISRILYNFHLEPIDYTRDVKLISDVVIRPSKPV

YTKFVRIDRQSNI*

 

>CYP4AB9 Nasonia Nv4n24 509aa 12 exons SCAFFOLD29 minus

MIRIFVLLLLLTLIACHIFTRYTRKGRLLNIIPGPAPLPIIGNLLQFAVTSAD

(1)DLWKIARKYSTDYYPITRFWTTGLCVVSVRHPDDLE(0)ILLNSQKTITK

GYIYNYLHSWLKSGLLTSTG(1)DKWRQRRKLLTPAFHFNILKEYLGPMNEEG

LRCVDDLKNDGESTIKDLVEFLSESTLNVICE(1)STMGVSLNRIETGLTTRY

KKAIHEMGYIVSFR(2)LCRPYIFDWIMNLPWKFGNLQRKSLKILHHFTNK(0

)FIQEKKIFNEESKGNYSDVTQHSEDNGEHSG(1)SKKRLAFLDLLLTAKKNN

MIDDEGIQEEVDTFTFE(0)GHDTTAMALTFTLMLLAENKEAQ(0)EKARAEA

KEVLDCSHGKLDVSDVQKLNYLDRCIKESLRLYPPVSTIMRYSADELQLK(1)

NALVPADTHIVVNFFDTHRDPNFWPEPNKFDPDRFLPERSVGRHPYAFVPFSA

GSRNCIG(1)QKFAMMEMKILIARILYDFRLEPTEHLADGYADIPLLADIVIR

PLNKIFTRFIKL*

 

>CYP4AB10 Nasonia Nv4n25 509aa 12 exons SCAFFOLD29 minus

MYLLFILFLGPLLFHIITRTNRRARILKKIPGLKPYPFVGNLLTFNVNCLN(1

)KFWELGRQFSNEYYPITRFWLFKTAVISVRHPDDLE(0)IIFTSQKFIDKGY

IYDYLHPWLKTGLLTSTT(1)NKWRQRRKILTPAFHFSILKKYLENMNEEGKK

IVNELKNEGQIIEKSLMPFCSSCTLNIICE(1)SALGVSLDSLDGKIVNKYKN

AVHDIGNVVLYR(2)MPRPFLTNWMMNFVWKMGSVQRNAVRVLHRFTDE(0)I

IKERKTYHKRMNNKYLKEYADNIKQNRSYEKDIN(1)QKKKYAMLDLLLAAEY

NGLIDYNGIKEEVDTFTFE(0)AHDTTGMAMAFALMLLAENHEAQ(0)NKARV

EIIEVLDRHNGEMELTNLQEMNYLDRCIKEALRLFPPVATVMRYTAEEVQLK(

1)NALVPADSHIMIHLYDTHRDPNFWAEPEKFDPDRFLPERSINRHPFAYLPF

SAGPRNCIG(1)QKFAMIELKSLISLILYDFYLEPIDRLDDMKLIADIILRPL

NPIRIKLIRIKK*

 

>CYP4AB11 Nasonia Nv4n26 508aa 11 exons SCAFFOLD29 minus

MIFYLSSLLLVLCIFHIITRYNRRGRLLSKIPGPTAYPIVGNLLMFNMSSMH(

1)DFWQLGRLTMKKYYPITRFWGLHSALISVGHPEDLE(0)ILLSSQKVIEKG

YVYWYLQPWLRTGLLTSTDDKWRQRRKILTPAFHFSILQKYFDITSEQGERFI

EDLKAEGDETIKSLMPLCSNYTLNIICE(1)SILGVVLNKMNDQEVKKYKQAI

LDVGSVVLYR(2)TVRPFIANWMLPFVWKIGHMQRNALKILHDFTDK(0)VLK

ERRKYHESTGYRYLNDEYTGEVKYDLGIG(1)RKRRLAMLDLLLAAEKNGLIQ

EDGIKEEVDTFTFE(0)GHDTSSMAMTFTLMLLAENKEAQ(0)DLARVEVIRV

LDKSGGKIGVTEIQELHYLERCLKESFRLYPPVATLMRYVSEELELK(1)NAT

VPADSHVMIHFWDTHRDVNFWPEPDKFDPDRFLPENAKNRHPYAYVPFSAGPR

NCIG(1)QKFAIMELKSLIARILYDFYLEPVDRTTDMRLIADIILRPLDPVHL

KFIKINKC*

 

>CYP4AB11-de7b8b10b11b Nasonia Nv4nP1 126aa 4 exons

(1)EKRRLSMLDLLLAAQQN*LIDDDGIKEEVDTFFFE(0)GHDTTGMAMTYL

LILLAENKEAQ(9)GPRNCIGNYAFRIRIITLLEEDTRANR(2)LIAQLLYDF

LDPVDRLADMNIADIVIRTLKPFRIKLTKINKD*

 

>CYP4AB12 Nasonia Nv4n7 507aa 12 exons SCAFFOLD22 plus

MFYLLLVILGVLIFHISTRYSRMGKLVNKIPGPRPIPILGNMLLLNVSSD(1)

KLFGIMRELINSYYPILKVWFCTNAMVGLRHPDDLE(0)VILSSQKAIDKSYV

YGYLEPWLKTGLLTSTG(1)DKWRARRKILTPAFHFQILKKYMDITSEQGEKM

IDALRQKKEMVENIVPMCSTFTLNIICE(1)SAMGVALDKIDAKELKEYKMAI

HDMGDVVVQR(2)SVQPYVLDWMMSPLIKLGRMQKNALTVLHKFTDK(0)VLK

ERRNYHNRTENKYLHELDDNAHDDDSDKVALG(1)RKKRLAMLDLLLLAEKKG

LIDEEGIKEEMDTFTFE(0)GHDTTGIALIFILLMLAENKEAQ(0)DKAREEV

SEMLNSTGGKISQTEIQDFNYLERCIKETLRLYPSVPNVLRHLTEDLQLK(1)

THTLPAGVDVICFLYDVHRDPNFWPDPEKFDPDRFLPESSAGRHPYAYVPFSA

GPRNCIG(1)QKFAMMELKSLVARILYNFQLEPIDRSADVKFTTDLVLRPTNP

IRVKFVRIDK*

 

>CYP4AB13 Nasonia Nv4n4 517aa 11 exons SCAFFOLD6 plus

MLFYIVLSALVAALVYFHISIRYSRQGRMLSKIPGPFSFPIIGSLHLFTDRTQ

R(1)GLWITIRMITDTWYPICKGWAMGLPLLSVRHPDDLE(0)VILSSQKACY

KEFPYKYLRSWLNDGLLTNKG(1)DTYRARRRMLTPAFHFNMLRRYVDIMNEQ

SGRLMTELRANGKEFVLDVLPIYADVSLNIIIE(1)SAMGIDLDKTDKKVIKD

YKEAIEDMGIVLTYR(2)MLRPYILDWMMTPFTEIGRKQIHALKVLREFTDKV

(0)IIKERRKYHEMLGGIKGYKEFTDSLENQDESESIYAIG(1)HKKKLPMLD

ILLSAEKDGLLDEKGIKEEVDTFLLG(0)GTDTTRMVMAYFTMLMAENKKCQ(

0)DKARAEVCKVLERSGGKRGMTELSQMPYLEQCIKESMRLYPIASTIFRHTV

DDIQLK(1)NYTIPAGVVVICQIIDAHRDPNFWTEPEKFDPDRFLPENCRHRH

PFAYLPFSAGPRNCIGQKFGWMEVKAVCSRLLYNFYLEPIDSTRDMQLIGDFV

LRPADPFHTKFIRIDRE*

 

>CYP4AB14 Nasonia Nv4n13 509aa 12 exons SCAFFOLD13 minus

MLLYFLIVALCSLACFHVYVRHGKYGRAIGKMRGPPALPIFGNMLSLNCGPV(

1)EFWNYLADAIKIYYPCGRIWFFTCAVVITQDPDDLR(0)ILLTDKTNITKG

FVYEYFHLMAKTGLITSTG(1)EKWQYRRKILTPAFHTHIIKKYMKITFEQGE

RFVKSIKAQGDETVQSLIPVCSDLTLSIILE(1)AAMGIQFQTIGNKAEEYRK

AIEHYFSSIAYR(2)ATRPYIKDWMLRYFSEGRRILATVKVLREFTDK(0)II

DERREYHKQTKQESFQKYVDDDMEHECTDGEG(1)RKKRLAMLDLLLMAEKEG

LIDEEGIKEEVDTFTAA(0)GYDTTGMEMVYLLMLMAENKDQQ(0)ELARAEA

NRILDASGGKISMKEINQMEYIERCVKESLRLFPTAPHIVRAVTEDIQLK(1)

NYMVPAGTDIFVPIHILHRDPKYWSDPLKFDPDRFLPGEAEKRYPFTYLPFSH

GPRNCIG(1)QKFAIAELKSLLACVLRNFYLEPVSYTKDLQFTLHVVLLPTVR

PHIKFISIKKND*

 

>CYP4AB15 Nasonia Nv4n30 508aa 12 exons SCAFFOLD15 plus

MLLYLLIAVLCVVGFHAYVRYGRYGKLINKLPGPTPLPILGNLLLLNKGPV(1

)DLWNFLHVKMKEYYPFGKIWFCTSAIILTQDPDDLK(0)ILLSDKVNIVKGF

MYKPLHLWAETGLITGTG(1)EKWQHRRKIITPAFHANIIKKYIEITSEQGER

FVEYLKTKGDETVESLIPICSNLTLSIIIE(1)AAMGTKFNTMGDKAEEYKKA

IEDYFHGVAYR(2)ATRPYIQNWMLRYFGRGRRILDCIKSLRGFADK(0)IIE

ERREYHNQTKHQSFQNYVDDVDDTNLLDGG(1)RKKRLAMLDLLLLAEKEGLI

DEQGIKEEVDTFTAA(0)GYDTTGMGMVYMLLLLAENKDVQ(0)KLARAESDR

ILSASGGRITMTEIQQMDYIERCVKESLRLFPTAPNISRTIIKDIQLK(1)NC

MVPAGTDVFVPIYDVHRDPKYWPDPLKFDPDRFLPEEVHKRHPFSYLPFSHGP

RNCIG(1)QKFAIAEMKALVARIVYNFYLEPVTYTKDLQFTAHIVLLSTVPPC

TKFIKRLRSKD*

 

>CYP4AB16 Nasonia Nv4n23 511aa 12 exons SCAFFOLD16 minus

MALLYLLLVFIVIGLIAFHVRVRYGRVGSMVAKIPGPYPLPFLGNLLSFAGNR

E(1)ELWNKLRALMKGCSIKRMWFPTRAWIFIQDADDME(0)VLLTSKVNVNK

GQAYNLALKWLHTGLLTSKR(1)EKWTERRKIVNTGFHYNVMKKYVEISIEYT

KQFVEEIKSHGDECVLNILPLLSDLTLQIICE(1)SALGISLDKLDNKVLQEY

KEAIREIDDIFVYR(2)GARPYITDWMMYFLPLGRRQDHAIKILHEFTDR(0)

IIRERKEYHANFQENRSYQHFVDDVEESAEDDSFKG(1)TKKRLVMLDVLLSA

EQDGLIDEKGIREEVDLLVLA(0)GHDTTSISMVIMLMLLAENPEAQ(0)DRA

RAEVIQVFSENGGKLDIKEIQKFEYLDRCIKEAMRLYPAIGNFIRHLNEDVQL

K(1)KYLLPAGVDVAFFVYDLHRDPKHWQEPEKFDPDRFLEENVKKRHPFAYM

PFSAGPRNCIG(1)QKFAMFEMKVILSHVLYNFYLEPVDLTASIRFEVNVILR

LSHPVHVKFIRRDV*

 

>CYP4AB16-de1b2b Nasonia Nv4frag3 72aa 2 exons SCAFFOLD16

LVLILACLILFHLCIRYGRVGRIIDEIPGMYPLPIFGNILSLVNAA()QVWN

AL

RKIRHKDYPITRL*FPTRAWIIVRDPDDTK (0)

 

>CYP4AB16-de1c2c11c12c Nasonia Nv4nP2 178aa 4 exons

MHLLLVLILSCLLVFHIWIRYRRIARIVNKIPGRFPLPFLGNLLSLAGSKG(9

)TTFL*CIQQLWTALRQITKEYPIARLWFLTRMWVLVRDPDGIEVQIAFKKSN

MSFHFLKYC(9)YLFAYIPFSAASRNCIG(1)KKFAMLEMKIMLAHILYNFYL

EPVDFPANVKLETNIILHLTHPVHVKFIR*

 

>CYP4AB17P Nasonia Nv4P3 506aa 12 exons SCAFFOLD16 minus

MTSVYLALILFGLVIFHAWIRYRRMGRIIDKMPGMRPLPFLGNMLSLMGDKD(

1)QLWNIMRSLAKEYAITRIWFFTRAWVAVRDPDDIE(0)ILLTNKANLNKRA

VYELALKWLETGLLTSG(1)EKWVHRRKIVNTGFHFNIMKKYVKISGEHAEKF

IEKIKSHGDEYVLDLVPLFSDLTLQIICE(1)SAFGVDLNKLDQKLVQQYKGA

LHVMYDMVIYR(2)STRPYIRDWMMNFLPIGWKQNRAINILHNFTNK(0)VIQ

ERREYYNKHASENRSYQSFVDDVDIESDYVADG(1)RKKRLVMLDVLLSAERE

GLIDAKGVREEVDIFTVA(0)

1728 GHDTTAVTMAFMMMLLAEN

SEIQ(0)

DRARAEVINHFEENGGKLNITEIQKFEYLDRCIKETLRLYPPISQFVRYMDKDIQLK(1)

KYLIPAGVDVLFLTYDTQRDPRHWTEPDKFDPDRFLPENAKKRHPFAYIPFSAGLRSCI(9)

1013 GQKFAMLELKAMLAHILYNFYVKPVDLTANMKLETYIVLQPSHPVHVKFIRRNVN* 846

 

>CYP4AB18 Nasonia Nv4n21 508aa 12 exons SCAFFOLD8 plus

MIVYFQLILLSLFVLHIWIRYRRMGRVVDKIPGLRPLPFLGNMLSFAVDKH(1

)QLWLTMRGLAKIYTITRVWFFTRAWVVTRDPDDFQ(0)ILLTSKVNLNKRAL

YEHCLKFAKTGLLTSNR(1)EKWSQRRKIVSTGFHFNIMKKYVEITGEHAELF

TKKIKSNGKESSLNVVPVCSDLMLRIICE(1)SAFGVNLNKLDPQLVDQYSEA

LHVVYDTVVYR(2)ATRPYIREWMMDFLPIGWKLNRAIKILHSFSDK(0)IIQ

ERRDYYNKQAESRTYQSFVDDVDTDNENTLGE(1)RKKRLVMLDVLLSAEREG

LIDAEGVREEVDIFTVA(0)GHDTTAVTMAFMLMLFAEHSEAQ(0)DRVRKEV

TKVFNECGGKLTITETQKLEYLDRCVKETLRLYPPFSIFARYIDEDVQLK(1)

KYLVPAGVDVLFLSYDAHRDHRHWPDPDKFDPDRFLPENVKKRHPYAYVPFSA

GPRNCIG(1)QKFAMHEVKSVLAHVLYNFNLEPVDNIADIKLETYIITQPCHP

FHVKFIARNAN*

 

>CYP4AB19 Nasonia Nv4n20 501aa 12 exons SCAFFOLD2 minus

MIAYVLLTCVFLLIVQILLWVTKEGRLWNKIPGPTPLPFVGNLLPLIGSTE(1

)HLWNALHDLAIKYYPIVRIWHTKTVMVLISHPDDLQ(0)VILSSKANINKPP

LYDLIKPWLGDSVILSKD(1)NKWTERRKILIPAFHLNILKKFIKVTNEHNER

FITFIQSFGDESVQNVSTLLPELTLKIFCE(1)SAMGVNQNDDLIKKYKHAME

EMFGVSIYR(2)ATRPFIKDWMMPFVKIGQIQKRAVETLHGFRDQ(0)MILER

RKYHESTGYQIYQPVDNESNSSNE(1)IQYKRTLSMIDLLFTLEKEGLIDEDG

INEEVDTFIVG(0)GHDTTAIASTFFLVLLAENVYAQ(0)DRARAEITEVLAN

NNGDITSQLHKLHYLERCIKESIRLYPSAPCIGRILTEDIQLK(1)NYLLPAG

TEVLCMLRAAHLDPNFWPEPNKFDPDRFLPENVKDRHPFAYSPFSQGPRNCI(

1)

GQKLAFLQIKILASGILSNFYLEPVDRTVDVKFRMNANLHTTKPLHVKFVKIR

KD*

 

>CYP4AB20 Nasonia Nv4n15 511aa 12 exons SCAFFOLD110 plus

MIIYFLLILLGLWVFKVYFQNKRSKELLDKIPGPPTVPILGNLLMFNVPIE(1

)KTWNVIRDLNKNYYPIAKFWLGPYPYVSIHHPDDLE(0)ILLSSTKHLEKGS

AYTVLHPWLRTGLLTSSG(1)SKWQQRRKILTPAFHFKILRKYMDITNEHGKK

FIEALRTENSETVQSLMPFCSNYTLHIICE(1)TAMGIALDKIDTKISKEYKN

AVADIANLIMYR(2)VMRPYLKEWMMLPVWTFGRLQTQTLRTLHKFTKT(0)V

LTERREYHKRSDNKYLKGFHDDTYDVNKDDVAIG(1)GKKKLAMLDLLLSAAQ

DGLTDDEGIKEEVDTFMFA(0)GHDTTGIALVYAIMLLAEHKEIQ(0)EKARA

EVIEVLTESNGEIGTLEIQKLHYLERCIKESLRIFPPVSALSRTVKEDIQLK(

1)NYVVPAGTEIGCHIFDLHRDPNFWPEPEKYDPDRFLPENIQGRHPYAYIPF

SAGSRNCI(1)

48642 GQKFAMMELKSLTARILYNFELEPVSQTKDMKLTLDLVTRPLEPVYTKFIRID

NNN*  48472

 

>CYP4AB21 Nasonia Nv4n17 509aa 12 exons SCAFFOLD18 plus

MYILLCVLGLIFCYIYNNRDDRKVKLINRIPGPPGLPVIGNLLIGLTPVD(1)

QLWDVVRSYTETYYPTIRIWLGNYYSIVSISDPDDVE(0)TLLTSQKHIEKGY

SYKNLQPWLKMGLLTSTE(1)KWRRRRKILTPAFHFNILKKYVDITNENAERF

VEKMRDDEGDDTVQDLAPLTSKYTLNIICE(1)SAMGVALDEIESKAAEKYKN

AVYTMGNITIYR(2)ITRPYLTDWVMNICWRLKKLQEKTLKTLHEFTDK(0)V

IMERKAQHKNTDYKYIKNLADDIKESEFDYVTSG(1)RKKRLAMLDLLLSAEM

DGLIDDDGIREEVDTFMFE(0)GHDTTGMAMTFTLMLLAENEEIQ(0)EKARA

EVIKVLTESSGKIGMRQLQEFNYLECCIKESLRLYPPVANISRYITEDLQLK(

1)KYLVPANTEVFVQLYPIHRDRKFWREPNKFDPDRFLPENLQGRHPFSYIPF

SAGPRNCIG(1)QKFALMELKSLIARILYNFKLEPIDRSADMKILLDIVIRPA

SPVRTRFVKINH*

 

>CYP4AB22 Nasonia Nv4n1 510aa 12 exons SCAFFOLD39 minus

MTIYFLLIFLVLLFHRIYARNIKYRSLLKKIPGPPTLPLLGNLLIFNVPVE(1

)KQWDIVRSLTKQYYPICKIWLGPRHAVVSLLHPDDIE(0)VLLTSSKHINKG

DSYTYLHTWLKTGLLTSSG(1)DKWRQRRKILTPAFHFNILKKYMDITNENSI

NFIEALRNEGEETIQNLTPLCSKYTLNIILE(1)SAMGIVLDKVDKKTADDYK

NAVYEIGRIIMYR(2)LARPYIREWMLNPLMNLARVQKRVLKTLHDFTEK(0)

VVKDRREYHERTENKYLDNFTNESHCDDVYAGTGG(1)RKKRMAMLDLLLSAE

RDGLIDDEGIKEEVDTFTFE(0)GHDTTAMAMTFALLLLAENKKAQ(0)DKAR

EEVTEILDRSEGNMGMAQIQEFNYLERCIKESLRLFPPVATMARTITEDLQLK

(1)NYLVPAGTEVMYHLWEIHRDPNFWEEPLKFDPNRFLPERSQGRHPFSYVP

FSAGPRNCIG(1)QKFAMMELKSLIGRILYNFKLEPIDKTADMPMLLDIVIRP

AKPVYTRFVRIDK*

 

>CYP4AB23 Nasonia

16417  MLMHLLLFIVLALTVFHFYIRYRRIGRLASAIPGPSPYPFIGNMLSFDISSP (1)  16286

VSMWLVLRQLSNQYYPITRVWMTTEALYSVRHPDDIE (0)

IALTSRKTIDKGWVYKYLHPWLRTGLLTSS (1)

GEKWRHRRKILTPAFHFNILRKYMDITQEQGEKLIKFLQCDGKESVQSLIPFCSKFTLNIIC (1)

ESAMGVALDSLDTKTIEKYKQAIYKIGEITVYR (2)

MPRPYIHDWMLKLVPFLPINRHRKQALSILHEFTAKVLKERKEYHDRTGNKYLQGLTEE

DKDGDEDVYM (1)

GCKKRLAMLDLLLSAEKDGLIDDEGIKEEVDTFTFE (0)

GHDTTGMAMTFILMLLAENKNAQ (0)

DKARAEVNEMLKKNNGILGIAEVQELHYLERCIKESMRLYPPVPTIFRDVSEDLQF (1)

KHGLIPGGSCVVCHFYDLHRDPNFWDEPDKFDPDRFLLENSSKRHPFAYIPFSAGSRNCI ()

13997  GQKFALLELKSILGRILQNFYLEPVTRLADIKLIADLVLRPSEPVHLKFVKIEKNT*  13827

 

>CYP4AB24 Solenopsis invicta (Lausanne fire ant) EE131689 EST

YPIIGNTIKLINLGVLRIWKYIICTSSDKYYPIWKLRSFFESLVIIRHPDDMETILN

NTKHINKSKLYDILHPWLGTGLLTSTDSKWHTRRKILTPTFHFNI

 

>CYP4AB25 Solenopsis invicta (Lausanne fire ant) EE142405 EST

MFVTLLILCVSIILLYFITYYGRFRRLIGKVPSKPDLPFIGNALEFFMYS

QEKIWEAERLANKTHTIYTFWCGPIAFIATRDPDDIEKILSNTTQHLSKGYIYNLLHPWL

GTGLLTSEGAKWRKRRKILTPTFHFTILKEFVDIFTEESNRMIKYLKNIEGSNIDNLMNF

ISHHTLNAICG

 

>CYP4AB26 Solenopsis invicta (Lausanne fire ant) EE148664.1 EE147029.1

TLNAICETAMGI

SLQGLGSFQQQYRKAVHQMGEFIVYRLLRQWLKNDWIFSLTPRGREQAKL

LKILHGFTEKIIKERKDYHKLTNGQYLKNLNKDAVADEEIIGIRRKRLAMLDLLIQASQE

GLLTDKDIREEVDTFTFEGHDTTSSGICFTLALLAEHKDIQERVRKEIDVIMKENQEKLT

MKSLQDLQYLERCIKEALRLYPGVFFISRNTSEKVQLKSYLIPAGTLLHLNIFGVHRDPK

FWPNPEVFDPDRFLPDNIRNRHPYSYLPFSAGPRNCIGQRFALLELKAMLVPLIYNFYL

EPVDYLENQRFGIDMILRSLDPCRLKFAPIATEGI*

 

>CYP4AB27 Solenopsis invicta (Lausanne fire ant) EE134101 EST

DGDHSTGSKWQSRRRLLTPIFHFNALQQFTEILIEEGESMANSLKNAADTITKDLV

PFISEHTLNAICEAVVGISPQKMGSFQHQYWTAVYRINEFIIYR

 

>Cyp4ac1 D. melanogaster AC017771 comp(24745-26507)

MWIALLGIPILLAVLTLLLKHINKTYFILSLTKRVRTEDGSPLESKVAIMPGKTRFGNNLDILNFTP

ASVFNFVRESTAKAKGQNYLWYFLYAPMYNVVRPEEAEEVFQSTKLITKNVVYELIRPFLGDGLLIST

DHKWHSRRKALTPA  FHFNVLQSFLGIFK

EECKKFLNVLEKNLDAELELNQVIPPFTLNNIC

ETALGVKLDDMSEGNEYRKAIHAIEEVLIQRVCNPLMYYNWYFF

VYGDYRKHLQNLRIVHDFSSRIIERKRQQFQQKQLGEVDEFGRKQRYAMLDTLLAAEADG

QIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDSDDISMF

QFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHF

PKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPA

TQLEDLTFENGIVLRTQENIKVKLSKRVK*

 

>Cyp4AC1 D. pseudoobscura deletion at heme 82%

MLIALLGTPLLLLGVWLLLQRLNRTYFILSLTRRVRTEDGSPLESKVAVMPGTTRFGNNLDVLNCTP

SSLFNFLRDSAAKAQGRNFLWYFLFAPMYNVIRAEEAEEIFQSTKLITKNVIYELLRPFLGEGLLIST

DQKWHSRRKALTPAFHFNVLQSFLAIFK

EECNKLIKVLDKKVDGELDLNQVIPQFTLNNIC

ETALGVKLDDMSEGNQYRRAIHAIEEVLIQRVCNPLMFYNW

YFFLIGDYRKQVQNLRIVHDFSSRIIERKRQQFKRKQLGVVDDFGKKQRYAMLDTLLAAE

AEGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEEVQERCLEEVSTLPEDTDSI

SVFQFNELVFLECVIKESLRMFPSVPFIGRTCVEECVVNGLILPKDTQISIHIYDIMRDP

RHFPNPHEFQPERFLPENTVDRHPFAFVP

EIKVLLAAVLRNFRILPVTRLEDLTFENGIVMRTQQNVKVKLVRR*

 

>Cyp4ac2 D. melanogaster AC017771 comp(22220-24109) revised 9/8/2000

MFLEVLFAAPLVIFIFRKLWAHLNRTYFILSLCKRIRTEDGSLLESKIYVAPSKTRFGNNFDLVNFTS

ESIFNFMRDASAKAKGRNYLWYFFHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLIST

DQKWHSRRKALTPAFHFKVLQSFLIIFK 

EECNKLVKVLHQSVNMELELNQVIPQFTLNNVC

ETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF

FLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEAD

GQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISV

FQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARH

FSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILP

VTLLDDLTFENGIVLRTKQNIKVKLVHRENK

 

>Cyp4ac2 D. pseudoobscura Contig3635_Contig7816.24 75% to 4ac2 74% to 4ac1

MFELLLGVPLIVLLCCVLLRRLNRKYFVLSLCKRLQAEDGSPLESKIAVMPGRTRFGNNFDLLNFTP

STVFNFMRDSCANARGRNYLWYFFGSPMYNVIRAEEAEEIFQSTKLLTKNVVYDLLRPFLGEGLLTST

DQKWHARRKALTPAFHFNVLQSFLAIFK

EECHKLVKVLHESVESEALVLNQVIPQFTLNNIC

ETALGVKLDDMAEGFQYRESIHAIEAVILQRICNPFLYNSLYFYLY

GDYRKHIDSLKIAHDFSSSIIERRRRDIKRKELGVVDDFGKKQRYAMLDT

LLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLSLHKDVQER

CLEEVSALPEDTDSISVFQFNELVFLECVIKESLRMFPSVPFIGRQCTEE

CVVNGLVMPKDTHINIHIYDIMRDPRHFPNPNAFQPERFLPENTVDRHPF

AFVPFSAGQRNCIGQKFAILEIKVLLAAVLRNFKILPDTRFEDLTIENGI

VLRTQQKVKVKLVQRVG*

 

>Cyp4ac3 D. melanogaster

MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTP 

ANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISI 

DQKWHTRRKTLTPAFHFNILQSFLSIFK 

EESKKFIKILDKNVGFELELNQIIPQFTLNNIC

ETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFF

LFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG

KIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMF

QFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHF

PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPA

TQLEDLTFENGIVLRTQQNIKVKFEARVK

 

>Cyp4ad1 D. melanogaster AC020402 comp(36565-39829)

MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPA

EYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQ

NILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERS

AIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVC

ENATGQDSSSLNGETSDLHGAIKD

LCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLRSELNR

IISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFIFT

GHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDI

NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCI

AEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRKR

 

>Cyp4AD1 D. pseudoobscura 87%

MFLIAIAIILATILVFKGVKIFNYIDHMAGIMEMIPGPTPYPFVGNIFQFGLKPA

EYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQ

NILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYMPAFERSAIEGYLRVVHR

TGGKFVQKLNELTETLEVFDAQELVAKCTLDIVC

ENATGLVSNSLNDEPSDLHGAIKD

LCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLRREIYR

IITQRRQQLADENTCGERTKKINKPFLDVLLAAKLDGRALKEREIIEEISTFIFA

GHDPVAAAISFTLYTLSRHTEIQQRVFEEQQRIFGQDLTAEADIGRLDQM

RYLELVIRETLRLYPSVPLIARTNRKPIDI

NGTKVAKRTTVIMCLIAMGYNEKYFEEPCVFRPERFETAGADVGIEAFKSVPFSAGPRRCI

AERFAMYQLKALLSQLLRNFEILPPVNGLSSGINDHSQVECVPQSEYDPVLNIRVTLKSENGIQIRLGKRAFVE*

 

>Cyp4ae1 D. melanogaster old 4e4 AL009194 16210-17867

MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAWQMRSFQPD

NLHDKFAEYVKRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLS

RGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAAL

DIITETAMGVNVDAQGADSEVVHAVKD

LTNILATRFMRPHLLFPHLFRLCWPSGFRKQQA

GVICLHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPLTDKQIRDEVNT

FIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCV

VKESLRLYPPIPAVARCLEKDLVI

DEGYIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPRNCIG

QKFALLEMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRPRLY*

 

>Cyp4AE1 D. pseudoobscura ortholog 71%

MLMALLLTMALTLIVAWLLQLALREMRHPLRGFVPSVSRVPLVGAAWQMRSFQPD

NLHEKFAEYVERFGRSFMASVCGQVIMVTAEPSHVDALLHSQKQLRKSSIYGALRGWLGNGLLLS

QGEQWHGMRKIITPTFHFSILEEFVEVFDKQSQLLVERLQPLSNGGMVAINIYPYVGLAA

LDIITETAMGVCVNAQLDADSAVVQAVKA

VTNTLATRFMRPHLLPPLLFRLCWPSGFRKQ

QEGIKCLHLFTNSIIEQRRQLLRRENAPGEPVARDRRNALLDTLLRATVDGQPLTDKQIR

DEVNTFIFEGHDTTTSAISFCLYLLSRHAAVQERLFDEVKGHFGRELDRCVVYSDFAALP

FLNCVVREALRLYPPIPALGRCLETDLAV

EGGRIPAGTNVILLLWQLLRDEMLFADPLIFRPERHLSNKATSKKGAYSNIPFSAGPRNCIG

QKFAMFEVKTMIIKMLRNFILLPIGPDVEPSIKIVLRSRNGVHFGLRPRVY*

 

>CYP4AJ1 Diabrotica virgifera (western corn rootworm) a beetle AF243506

ATGISWILRQLATHSEYQDQIYEEIITVLGDAQKQPDLNDLNEL

KVMERFIKETLRLFPPVPYIARTLDEDIELNGYLIPKEASIDIWIYDIHRNPKYWPEP

EKFDPDRFLPENCVNRHPFAYV

 

>CYP4AK1 Diabrotica virgifera (western corn rootworm) a beetle AF257100

SSAISFALYLLANHPLVQAKVYQEQKEIFGNLHNVKNTINDLQN

MKYLDLVVKETLRMYPSVPFYARKVTEDFIWGDIAFPKGIEIVVFPYVCQRNPEYFPN

PLQFIPERFVDIDGKNPYRYV

 

>CYP4AR1 Anopheles gambiae CYPe2r2 494 aa AAAB01008859.1 

MIVYALLIALCVLVLRFVAFRYKVYRTVGHLPGPPVNFLLGNTLELVRYDTQ 

VFFEKLFEYFQRYGMIVRLDMINKVWIIFSSPHDIE 

QIISSNEFNRKSMDYDILQEWLGNGILLDYGNTWFSNRRALTGAFHFKILDTYV

PVFEEQADVLVRKLLDAGGATVDIFALVKLYTLDVILETSMGVRCRAQLEDSDYVRAVSD 

LTHITFWRMYNAMGFSDWTFRLTKHYQTYRKSLQINREFTTSVIKQRRAELLAAGTSDTT

RPEKGRLSLLDILLRSDITGRTFSDEEVYSQVNNFMFA 

GHDTTSSAITFILYACAKHPEVQQRVYEEIVAELPDGEPVTQQRVNNL

KYLEQVIKESLRMFPPVPYYSRHIDHDTTQGGVRLEKGSTIVFGTYMLHHNPEYFPEPDQ

FRPERFADGETKRNPFAYIPFSAGSRNCI 

GQKFALNELKTALVKILRQCKVELPDPDFVPKMKMELVLKPVNGMQLRFLERKTIQL*

 

>CYP4AR2 Aedes aegypti 1.457_1 AAGE01044016 4I1.3 2aa diffs probable ortholog of 4AR1

MIAIIAFTAIFVLFVYVWQWRRRLSRPFRTVPGPPGLPLIGNCHQFIGKSST

NIFHMLIELERLYGSVFKVDVATGIWLFYMSPGDIERIMTGP

EFNCKSDDYDMLLEWLGTGLLISNGNKWFTHRKALTPAFHFKILDNFVQVFDEKSTILAR

KFLSYSGKVVGIFPLVKLCTLDVIVETAMGTESNAQTEESGYTMAVEDISEIVFWRMFNN

VYNTEFMFKLSNKYGTYKKCLETIREFTLSIIEKRRSTLNVFDKNGGTSEVCNDSTGLKK

KMALLDILLQTEIDGRPLTNEEVREEVDTFMFAGHDTTASAITFLLYAMAKYPDVQQKVYEEAVSVLGDSIDTPITLSALNDLKYLDLVIKESLRMFPPVPYISRSTIK

EVELSGCTIPTGTNITVGIFNMHHNPKYFPDPEEFIPERFEVERGVEKQHPYAYVPFSAG

GRNCIGQKFAQYEIKSTISKVIRLCRIELI

RPNYEPPLKAEMILKPQDEMPLRFFPR*

 

>CYP4AR2 Aedes 4T1.6 59% to 4D22, 99% to 4I1.3 1 diff, 57% to 4AR1

3 aa diffs to CYP4AR2

 DTFMFEGHDT TASAITFLLY AMAKYPDVQQ KVYEEAVSIL GGSIDTPITL

 SALNDLKYLD LVIKESLRMF PPVPYISRST IKEVELSGCT IPTGTNITVG

 IFNMHHNPKY FPDPEEFIPE RFEVERGVEK QHPYAYVPFS AGGRNCIGQK

 FA

 

>CYP4AR2 Aedes 4I1.3 58% to 4D22, 99% to 4T1.6 1 diff, 57% to 4AR1

2 aa diffs to CYP4AR2

 DTFMFEGHDT TASAITFLLY AMAKYPDVQQ KVYEEAVSIL GDSIDTPITL

 SALNDLKYLD LVIKESLRMF PPVPYISRST IKEVELSGCT IPTGTNITVG

 IFNMHHNPKY FPDPEEFIPE RFEVERGVEK QHPYAYVPFS AGGRNCIGQK

 

>CPIJ014579 CYP4AR3 Culex pipiens 100% to CYP4AR3 Culex_quinquefasciatus

100% to 4H23v2 Culex pipiens partial seq

1 aa diff to 4H23v3 Culex pipiens partial seq

2 aa diffs to 4H23v4 Culex pipiens partial seq MLALILFTALIIAVAYIWQQRSRLQQPFVSVPGPPALPLLGNVHQLVTKSSTEIFQYMQDLERAYGRVFKMDVMSQFWLF

FTDAKHIEQIMTGAEFNCKSDDYDMLVEWLGTGLLISCGNKWFTHRKALTSAFHFKILENFAQVFDAKSTILARKFLSFE

GKSVKIFPLVKLCTLDVIVETAMGITSEAQTKQSCYTVAVEDIAAIVFRRMFDILYNTKWIFQLTCSYEPYKKHLKTIHE

FTLGIIEKKRQALQEAGSTKVTNSKEDSDVGLKSKQALLDILLQAKIDGKPLTNEEVREEVDTFMFAGHDTTASAITFIL

FSLAKHPDIQQKVYEEVRSVFGDAKDTPTTLSSLNDLKYLELVIKESLRMFPPVPFISRNTSKQVSLAGLTVPPNTNISI

GIYNMHHNPDYFPDPERFVPERFEAERGAEKLNPYAYVPFSAGGRNCIGQKFAMYELKATISKVVRWCRVELDRPDYRVQ

LKAEMILKPMDEMPLRFHPRGE.

 

>CYP4AR3 Culex_quinquefasciatus_11

70% to CYP4AR2 Aedes, 45% to 4AR1 Anoph.

MLALILFTALIIAVAYIWQQRSRLQQPFVSVPGPPALPLLGNVHQLVTKSSTEIFQYMQD

LERAYGRVFKMDVMSQFWLFFTDAKHIEQIMTGAEFNCKSDDYDMLVEWLGTGLLISCGN

KWFTHRKALTSAFHFKILENFAQVFDAKSTILARKFLSFEGKSVKIFPLVKLCTLDVIVE

TAMGITSEAQTKQSCYTVAVEDIAAIVFRRMFDILYNTKWIFQLTCSYEPYKKHLKTIHE

FTLGIIEKKRQALQEAGSTKVTNSKEDSDVGLKSKQALLDILLQAKIDGKPLTNEEVREE

VDTFMFAGHDTTASAITFILFSLAKHPDIQQKVYEEVRSVFGDAKDTPTTLSSLNDLKYL

ELVIKESLRMFPPVPFISRNTSKQVSLAGLTVPPNTNISIGIYNMHHNPDYFPDPERFVP

ERFEAERGAEKLNPYAYVPFSAGGRNCIGQKFAMYELKATISKVVRWCRVELDRPDYRVQ

LKAEMILKPMDEMPLRFHPRGE*

 

>CPIJ009469 CYP4AR4 Culex pipiens 52% to CYP4AR1, 46% to CYP4AR2, 48% to CYP4AR3

MTPQPEVASRTIAFKEYTSYTAQAKFARFRQRFVRALKSIPGPPGVPLLGNSIELLRCDTTELHDKLVLWTSQYGPRIKI

DVCNTHWIMHTSPELAEQIVTNATFNRKAKDYEYMHEWLGIGILLDHGPNWFKHRKALTEAFHFRVLENFMPIYQEQSEI

LVEKLLSCGGRAVDVFPVFKLYTLDVILETAMGVRCRAQENDSDYVRAVAGMILTQITFWRMYNILGQSDVAFRFSRHYR

PYRQMIKVSNDFTMTVIRRRRSEMESAENQETERDFEEGSKRRSALLDKLLRMEIDGRRLTDEQIKDQVNSFMFAGHDTT

SSALTFIMYLLAKHPDVQRKLYKEVKEVFGDSKHPTFTQSTLNNLKFMDQVIKEALRLYPSVPFVSRTVDADTELAGVTY

PAGTTISLGIYFMHHNPAYFPEPTRFKPERFAPEAEQIERKNPYVYIPFSAGSRNCIGQKFAMNEMKTAVSHVVLRCELE

LEDPDFVPRLKDELILKPSDGMPIKFLARS.

 

>CYP4AU2 Bombyx mori seq gap before I-helix includes a small exon

MIILLLLFFVASLYWLYWTNKSKRMNK

MTASLPVPPTLPILGNATLFIGDTQKILKSLEDIADIAIKHKGSAKLWLG

PKLYVAIGDPEDAQVVLENCLDKDVVYRFLRPWLGHGLFVAPVCLWKSHR

KVLLPVFHNKVVEQYLQMISVQADILVERLNEKANKGEFDVLKYITACTL

DIVFETAMGERMDVQRSPDTPYLRARHTVMTILNMRFFKVWLQPDCIFNL

TSYSKQQKDNIDLTHKFTDEV

XXXXXXXXXXXXXXXXXXXXXXXXX

GKVRPVLDMLFGREIEFTDEQLREHIDSITIAGNDTTALVIAYTLVLLGIHQNVQEKV

YLEQRTIFGDSKRGADKVDVAQMQYLERVLKESMRLYTVVPIIARNVHKD

TYLPRCGVTLPAGIGAVVGPFAIHRSKSVWGPDADEFDPDRFLPERSLNR

HPAAFLPFSHGSRNCIGRNFGMLIMKSIVSTISRSYRIEADELGPLKIEM

LLFPIRGHQIRISRRETLA

 

>CYP4AU3 Heliconius erato (red postman or red passion flower butterfly)

         GenEMBL EST EL596754.1

MFVAVLICLFCCLYYLHFRRKRKQLYEFSKSI

PSVGNLPVVGHSHWFIGGPEKILKNIQTLAQMIEDSGGISSIWLGPTLYVVTMNPEDVQK

ILENSLQKDFSYKFLQEWLGNGLFVAPVDLWKVHRRLLLPVFHNRIIEDYIDVFGEQGSV

LVKRMGEKVGKSEFDVFPYITSCMLDIVFETAMGEKMDVQHNPDTPYLRARNTVISI

 

>CYP4AU4 Heliothis virescens GR960305.1

LSHKEGRKDILQLLLERKLAFSNIELREHIDSITIAGNDTTTLVISYALVLLGDHQDAQD

KVYKELQEIFGDSKRTPTKEDLTKMEYLERVIKETMRLYAVVPIIARTTQKELKLSTCTI

PAGVGCVVVPMVLHRSKKLWGPDADCFDPDRFLPENSVDRHPCAYIPFSHGTRNCIGRHF

GMLAMKSILATFLRTYKVSSKIPDRLKIEILLFPVDGHQITIEKRL

 

>CYP4AV1 Apis mellifera

MSSSTIIMGVSWLTMILSICLMTIVVLLLVRRGKFLYALRKVPCPPAFPIIGNAYELCCSPE

EAFKKMIKWGKELGDMYLIWVGMRPFIFLYKAEAIQPLLSSSVHIDKSLEYQYLQPWLGSGLVTST

GEKWHFHRKLLTPTFHSGLLELYLKTTIREAQILISCLRKEIGKPEFDIVPYAKRAALDIIC

DSSMGCNINAQKNFENEYVQAVNT

LASISQRRFLNVWMSFDPIFKLTSWGKRHDHALSVTHGFVNK

IIAERKAEWKDRKDTNFNEKSHKRQALLDLLLELSKDGKVLTDDDIRDEVNTFMFAGHDTT

ATSVSWILYALGRHPQYQ

ELIIEEYDETVGTKELTLDILSKLTWLEACIKESWRLYPVTPLIARQIYHPITIL

GHEIPIGSTVLVNSFLLHRDSRYFPEPDIYRPERFLPDGPKYPSYAFVPFSAGSRNCIGWK

YGTMIVKVLILYILKNFHVESLDTEDQLRFISELVLHNADGLRLKITPRK*

 

>CYP4AV5 Nasonia Nv4n9 513aa 5 exons SCAFFOLD4 plus (5121737-

MLVDEYAPPPPSLSSRLTFTLGLIVFLLLSRLAVRRAKFLYSLRNIPYPPALP

LLGNFVQLLCNLED(1)FFAKLTEWAQEFGDIYLLWVGLRPFVFVYRMEAVGT

LLSSRQHIDKSLEYEYLKPWLGSGLITSTGERWLARRKLLTPTFHSELLKGYF

RVTLREADTFVECLRSEIGKLEFDIVPFAKRAALDTICV(1)CAMGHQLNAQV

NRRNEYVQAVQR(2)LTAISQRRFTSILLKPELLFKVSTLGREHDRALRVIED

FVNGVITDTKRDWLGSRLRRARASNNNERKPRPETLLDLLLQMVQNGEKLTDN

DLRDEVNTFMFAGHDTVGMSVSWILYSLGRHPEYQERIIREVEDLLAAEGELG

FESYNRLHWLGACVKEAWRLYPVTPLIARQINSPITLQ(1)NHDIPVGTTVLI

NSYLLHRDPRYFPEPERFKPERFLPGASKPPSFAFIPFSAGSRNCIGYKFATI

EVKVTVLALLRAYRFRAILREDQLHLLSQVVLDNVGGIQLSITPRQPS*

 

>CYP4AW1 Phyllopertha diversa (scarab beetle) AY605086.1

            Maibeche-Coisne,M., Nikonov,A.A., Ishida,Y., Jacquin-Joly,E. and

            Leal,W.S.

            Pheromone anosmia in a scarab beetle induced by in vivo inhibition

            Proc. Natl. Acad. Sci. U.S.A. 101 (31), 11459-11464 (2004)

MFQTAILSLLCSLILWLVYWYYKINKYEKYLKTVPGPARTPIMGNIPDIGSPVSFLEDLLKLSYMYKGNFKLYIGAQPRVFLVEPKDLEFLLNSTSLLTKSKSYKFLYRWLGAGLLTSSGNKWKKHRKIITPAFHFQILEEFIDVFNSASDVLVEKLNAAPNKSSIDIYPFIARCTLDIICETAMGTSVDAQNDINSEYVNSVKILLGILVQRSLSPILANDLLYPFTTTYQKEKAALKVVHGYTKSVINKRKIEFYNNSKSEDRNVDSFGRKKKQAFLDLLLEYSANDPSFTEQHIQEEVDTFMFEGHDTTATSITFALYALAMNPHIQEKAYAELKEIFSNNSKRHASYRDLQEMKYLEMVIKETLRIYTTVPFYSRALEEDVNMNGQILPKGTMLNVFAYGVHHNPKIYKDPETFDPERFSIENSKERSPFAFIPFSAGPRNCIGQKFAMLEMKSSISDVLRNFKLLPSVPAHKVVLKSEAVLKSDNGVFVRLQKRMDS

 

>CYP4AW2 Phyllopertha diversa (scarab beetle) AY605087.1

            Maibeche-Coisne,M., Nikonov,A.A., Ishida,Y., Jacquin-Joly,E. and

            Leal,W.S.

            Pheromone anosmia in a scarab beetle induced by in vivo inhibition

            Proc. Natl. Acad. Sci. U.S.A. 101 (31), 11459-11464 (2004)

MLTVILLVILSPLIGWVIYWYYKVHYFEKYLHKIPGPKRLPLTGNALDIPSTLTMLPVLMDYYKQFRTNFKIYIGAQPYLFLTEPKDLEFVMIRRLYWRNPIYTSSSQRWLGFGLLTSGGNQWRKHRKIITPAFHFQILEEFIEVFNSQADVLVKKLKEESKKGTIDIYPFIARCTLDIICETAMGTSVNAQDDYDSEYVKCVNILLEIAMLRSFSPILRSVLYPFTSMCRRENSALKVVHDYTKSVIASRKQQFLSDADRNVESSDSLGRKRRRAFLDVLLEYSKTDPSFTEDHIREEVDTFMFEGHDTTATSITFALQAIARHPEIQKKVYEELQTVFADDPNRKATYRDLQEMKYLEMVIKESLRIYTTVPLLGRRIEKDVEWNGMTLPKGLMITMFVYCAQNSDSTFKDPAVFDPGRFNAENSKGRHPYAYVPFSAGARNCIGQKFAMFEMKATMSSILRNLELLPPVPDHKIALKNDGVLKSDNGVLIRLKMR

 

>CYP4AX1 Bombyx mori 50% to CYP4S4 53% to CYP4Sxx lower case is from CYP4AX2

MWFSLVVVAVIYALWKLFYKEDDPIDSLPGPTKLPIIGNMLDMFNMTP ()

GEKFKYERQLSKTYKQRYMQKIFYRRIVYVHHPDDVE ()

vvlshsknitknviydflkpwlgtglllst ()

GSKWFKRRKILTSAFHFDILKDFASLFEEKSRRLVDQLRANNGEPISLLPVMSNYTLFTLC (1)

ETALGTKLDTDRSVAAAEYKDAISKTAQISIYRLPRIWLYIDAIFNRTSAGREFAKNVDIIHSFADN

VIVQRKEQRLNSLDKGLVERDEFNRKKRTALLDLLLEAEAKREIDLEGIREEVNTFMFA ()

GHDTTGTALTFSLMLLSDHEEAQ ()

ERILEEYNEVMRGKETPTLSEFAEMKYLDAVIKETLRLYPNPHRVGRVLTEDITL (1)

GGVPIKAGTEIGVQIIDLHHREDFFPEPEKFRPERFLRGEIQHPYSFVPFSAGPRNCL ()

gqkfamleiksvlthicnnfklvpmkrnwrvetvsdivlkpaepiyikfvpr*

 

>CYP4AX2 Bombyx mori 94% identical to CYP4qq lower case is from CYP4AX1

CYP4rr 94% identical to CYP4qq lower case is from CYP4qq

MWFSLLVVAVIYALWKLFYKEDDPIDSLPGPAKLPIIGNMLDMFNMTP ()

GEKFKYERQLSKTYKQRYMQKVFYRRIVYLHHPDDVE (0)

VVLSHSKNITKNVIYDFLKPWLGTGLLLST ()

GSKWYKRRKILTSAFHFDILKDFASLFEERSRRLVDQLRANNGEAISILPVMNNFTLLTIC (1)

ETALGTKLDTDRSVNTAAYKDAISKIGQICIYRLSRIWLYIDAIFNRTSAGREFAKNVDIIHSFADN

VIVQRKEQRLNSLDKGLVERDEFNRKKRTVLLDLLLEAEAKREIDLEGIREEVNTFMFA ()

ghdttgtaltfslmllsdheeaq ()

ERILEEYNEVMRGKETPTLSEFAEMKYLDAVIKETLRLYPNPHRIGRVLTEDITL (1?)

GGVPMRAGTEVCVLTIDLHYREDFFPEPEKFRPERFLRGEIQHPYSFVPFSAGPRNCL (1)

GQKFAMLEIKSVLTHICNNFKLVPMKRNWRVETVSDIVLKPAEPIYIKFVPR*

 

>Cyp4AY1 Ips paraconfusus (bark beetle) IparaP450A3 D. Huber

revised, full length DQ471874.1

MILFEVVVVILTIWYIRKCRFREKVKWVATVPGHPILGVALDLTDPTKTLDRMTEYLTKY

NGMCYTEFMLCPTLVVSDLSFLKWFLTSNIPIHKGDIYAVLKNWLGGGLLISGGEEWRNS

RKILTPAFHFTILEQFIEVFEDATQVLGDVLSAEVTSKGVVDIYPYLTRYTLDVICQTSM

GVKLNIQQQSHSDYINAVAEMGKIIVERAFNPLKVYDFTYIFTSDYWKEKQYVKLLHQVS

NSIIEQRRQALEDQKFPEREGGKKKMAFLDHLLQYRDEQGKPLSDAFIRHEVDTVMFAGH

DTTAVALAFALYLLAKHPEVQAKARAEAREIVEGREKLTIKDIQNLNYLDLVVKETLRLY

PSVPFYSRALKEDMVYQEGKILPKGLVVLIVAYTVNRNPAVYQNPDQFIPTRFLDKEPVP

FSLLSFSAGPRNCIGQKFALLELKVALSKLLLRFEFVIPDSDASEPVVEAVTVLKPKNGI

RIKLNKLGSSN

 

>CYP4AY2 IparaCyp4A4, full length (Ips paraconfusus) 56% to 4AY1rev

DQ471875

MLFWLFQVVFALAAAFCIAFCLKKYNFKKKISWVPFVSGYPVIGAALELRDRKKILENIE

NHLNKHNGLCYMEVGTIPMLMASNPDFLKWFLSSNLPLAKSYSYGFLHNWLGGGLLISAG

ERWRRSRKLLNPAFHFSILEQFIEVFEDATKDLVRILEQEVGKDEVDIHYILTRYTLDVI

CQTSMGVQLKIQDRENTDYINAVASMGELIMERTFNPFKTFDLIYKLTADYRQEMAYVKL

LHEVSEGVINKRKQEIEAENKEDGKKKRKMAFLDLLLMYKDENGQPLSQDFIRHEVDTFM

FAGHDTTAAALGFALYLLAKHSNVQAEAFREVEPLGSTSKITIWDLQNLKYLDLVIKETL

RLYPSVPMIARHITEDLTYDGDKVLPKGLTVTVVISAVNKDDSIYNKPNEFNPSRFLEEE

PKPFSYLPFSAGPRNCIGQKFAILEMKMALAMILLNFELFPANPTFEPILESATVLKSQN

GIKVRLEKRS

 

>CYP4BD1 IparaCyp4A27, full length (Ips paraconfusus) DQ471876

MLFVLLALVTCILLGLFTLYIVAKIKKDTSKYLTNVPCSEQTFPFGNTLPFLKGSVVYLD

LIMQGVKELGRTSLFHDGPLSWVVITADPEFIELIYSSSTHITKGSQYDYFKRWLGQGLL

ISDGDKWRFHRKIITPTFHFSILQQFLTVFDTVGDNFVRKLQQHVGSTSVEISNLISLCT

LDIICETAMGVKMNALDMKDSENMEYIKGIRIMCKIIVDRMFSFLHPIFYPLTLNYYREK

RALKMVNGYVDNVISQKIQQRKELNQKEDKSQIDGIRTRLAFLDLLLEAKIDGTPLTKAE

LRDEVNTFMFEGHDTTSSAITFCLLMLATHPRVQDKVMAEQKEILEGDLKLAHPTSKELS

QMKYLENVIKETLRLYPSVPLFSRKLGEDVEFKGNLYPKGITLVLTPYATHRDPDIFPEP

EKFLPERFEESEMLKINPFAYTPFSAGSRNCIGQKFAMMEIKSTVSKVVRHFKLEPAHPE

HQIQLVSETTLNSKNGVKISLQAR

 

>CYP4BE1 IparaCyp4A20, full length (Ips paraconfusus),missing about 88 aa at N-term DQ471877.1

MIKAWLGPVPILFVVDPDSAKVILESNTLITKSSFYDKVADWIGTGLLISTNEKWQSRRK

LLTPAFHFNILKGYTEVMVKEGEVFVDQLDKLADTGREFNLYPYVKRCALDIICETAMGT

HINAQIGMNSEYVDAVTRVSDLTWTYIRFPFFWIKPIWYASSYGFEFDRLVKLTNDFTRK

VINERREALREEGILESGPKISTKQRMAFLDLLLMHQAASNLNDEDIREEVDTFMFEGHD

TTAAGMAFAIWLIGQNAEAQAKVHAEVDSIFGDSSRPPEEADVTKLVYLERCIKESLRLF

PSVPLFARRLTHDITIKDTVLPEGLNLILAPLATHRDPEQYERPWEFYPDHFTQEAIAKR

HPYAYFPFSAGPRNCIGQKFALSEEKIVLSWFFRRFRVESSEPMPGNRPLPELILKPSDG

VLCKIYRRRH

 

>CYP4BE2 IparaCyp4cod6, (Ips paraconfusus), most of gene, seeming missing small part of 5' end, a few ambiguities 65% to 4BE1, DQ471878.1

FCVFDPKRNGLIKGWVGPIPLVFAVTPDHCKTILESNTLISKPSQYDIISEWIGTGLLTS

TNEKWFGRRKMLTPAFHFNVQKGYNEVFARQGELFTEQLESVSDTGREFDLFPYIKRCAL

DIICETAMGTCINSQIGGNTEYVDAVVRISDILWSYERFPWLWLKPIWYGCGMGFEFDRL

VKLTNDFTRRVINERRSAMSDEGMLDETSTKDMSEAEVKKRKLVFLDLLLMKQKSASLTD

EDIREEVDTFMFEGHDTTSSGMAFTAWYVGQYPEYQARVHEELDAVFGDSNRSPEEADLK

KLVFLERCIKEALRLCPSVPLLARRASHDVKLGXVTXPENTTXVLAPFATHRLPDHWERP

DDFYPDHFTTEASTGRHPYAYFPFSAGPRNCIGQKFAISEEKTVLSWLFRKYRVETVEPV

PGNRPVPEIILKPSKGVQCRLYKRKAAV

 

>CYP4BF1 IparaCyp4A25, full length (Ips paraconfusus) 50% to 4BE1,

DQ471879

MGFWVPVVVLLLFVYATLRIWPWILKRKRLIQMVDRIPGPTAIPILGCAYQFRPKIEDFS

YELLEYARLHKDSEVVRFWLGPIPIVCAFGPESVKTVLESNKVITKGDEYDILERWLGTG

LLISTGNKWRSRRKMLTMAFHFNVLNGFMDTYDKEARIFLDQIREFADTNEPFDVCPFIK

RCALDIICETSMAHKIDAQVDHNHPYVNAVAQMNTLSFLYARSPWFWIKPIWRFFGHEEN

YERNLKLVTDFTQNVIAERRKELHTAKKTVQENKSGTEEIGGKTRRAFLDLLLSIQDEGK

LTDEDIREEVDTFMFEGHDTTSSGMSWTIWCLAHHLDYQNKVIQEIDAVFGNSDRNCTNE

DLKELKYLEQCIKEAMRLYPPVPLISRKVEEDFHCAGYDVPRDATILISPLVLHRDPALY

ENVESYNPENFSPSAIARRHAYSFIPFSAGPRNCIGQKFALMEERTVLSWFFRRYCVRSS

EEFLSNIPCAKIILKPSKGVPIKIYRRNAAH

 

>CYP4BG1 IparaCyp4cod43, full length (Ips paraconfusus) 43% to 4J9

DQ471880

MKMFIGVLCGLVAVIFLFLLRKYNKLRKKRCRIPNPPGHWLLGNLTLNNLNSGELFDQLR

NFARDYGPIYRISIPFLDIVNFFHPADLEIILSQKKHMKKSLLYQFLEGWLGKGLLTSTG

SKWQFRRKLLTQAFHFNILQKFVRVFNEETTHLVKRIEEINLTGQSQAGISVLPLITHLT

LQSVTETSLGVSNIEKETLKAYRENIYKMGDFLIDRLRKPWRLFNFIYHFTEASKQEQLT

INKLHQFTYQVIKEREEVLQSDKTQSVMTSTYSGRKIYKMLDLLLHEKLQFGSIDYEGIR

EEVDTFMFEGHDTTSAALVFLLHNLASNLAIQEKVRQEIKTVERIPTFQTLQNLPYTDRV

IKESLRLYPSVPFISRIASEDFITHTGYSISKGTVLYMHIFDLHRNPEIYPDPLTFDPDR

FLPEKVKERHPFAYLPFSAGPRNCIGQKFAMLELKAVLWGLLHKFRLTLDPSTTQINFQV

DLILRTQGEIKINFQPLE

 

>CYP4BH1 IparaCyp4A6, full length (Ips paraconfusus) 43% to 4AW1

DQ471881

MFFLTVFTALATVLAYYVGRWWMKLHNARNKLASWMPTAPGHPLIGSVFEFGDNTVFTTN

LHRLTDNPCKSCYVEVMGEWMILTRDHDLLDLVLSSNKILTKGGDYRTTAPWLGQGLLTS

NGLQWKSHRKMITPAFHFSILEQFVDIFNSQGDTLVNKLQRDALEKTSIDIYQYVTACAL

DIICETAMGVNLNSQENHDLEYVQAVKDMCRIIMDRTFSLWKSFDCLYNLSKLGKKQEQV

LEILHNFTNSVINKRRKETTEQLKNVKQDDVGRKRKMAFLDLLLSTNIDGRPPTQEEIRC

EVDTFMFAGHDTTSSAMSSAFYVLAKKTQIQKMVRDELQGVFGKDGSTQITHKSLQELKY

LELFIKEVLRLYPPATVISRVTEEDVQYKNHTIPKNTLIEMLIYSANRDPDYHENAEEFK

PERFLDTSGKKRPFAYIPFSAGPRNCIGQKFAMLEMKTIISKVLMNFEVLPSIPEREMVM

TTEVVLKAKNGVHVQLKPL

 

>CYP4BJ1 IparaCyp4A1 (Ips paraconfusus) missing C-term DQ471882

revised

MNPTVWLLVVFLTFLFLYWKRLWLAFRERRRFTHMINQLPGPMG

LPLVGSALNFSPDTEKCTYQMELYFRTYTEDIDSSGIMRVWIGPKPLVFIYKPETAKV

ILESQTLITKPGEYGILERWLGTGLLTSTGEKWHTRRKMLTPTFHFSILNNFMKVFNR

QANTLIENLDRHAADGYPFDFYKVIKALALDVICEAAMGMNIGAQRGQNTTTYRRCGK

CASSASCGCAHRGYGRSWRGGCPDDAQTTTAVTWRYKRFIRDVIADRKAKYQAAKQRG

SEKKAATEEKKRLAFLDLLLDLQYETGRLNDEDIREEVDTFMFEGHDTVSSSMGFFVF

SMSQRLHLQEKVYEEMLEIFGNDEERDVTSEDISQMKYLEQCIREVMRLLPTVPIIGR

IISEDTNIGGYMVPKNTTAMIAPFAVQRDKRFYHNPDAFDPDHFTPERVKQRNPFAYI

PFSAGPRNCIGQKI

 

>CYP4BM1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966563

           poor match 42% to 4C3

MDFTYLLLFTFFTIGFVNFCKWLKDRKRIWDAIEPIGGEKWYPLIGTCLELIKTKRKDFYDVYCARNMKY

GPFFRTWMGFIPAVHVMKPDHVERILSSTVNLTKGDNYRFVVPWLGEGLITGSNHKKWRVHRKLITPTFH

FSILDNMMEVMAEKGQFLAEQLVPKANGQFFNIYPFLTLCELDIICETAMGVEVNAMKHSQSEYVRSVYG

ISDIMLYRMFHPYLHPDFVFNLSSKGRQHKKYLSILHGFTRKVIQERKEKLTSGRDVVQELSEEDKLLGK

KKRLAFLDLLLEANKNSEGGLTDEDIREEVDTFMFAGHDTSTVTVGWTLFTLSNYPEYQEKVHQELDEIF

QGEERPITPQDVLKMQYLDKVIKETQRLIPVVPVIARTLDQDLEIVASSRTIPAGVMVVIHLARLHKDPD

QFPEPDRFDPERFLPENVSKRHPYSFVPFSAGPRNCLGQKFALRNTKVLLASILRKYKVRAEKKIDEMKY

NIEIVLRPQGGLSVALEPRRR

 

>CYP4BN1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971854

           66% to 4BN4, 48% to 4AW1, 48% to 4BH1

MGALALVVFAVTTLLFLIWFIRLVRKNNDYYKDIPGPRPLFFFGNVFEVSTTRDILNVMHKYALQFNGLY

KIHLGPVRKLIIASDYKFLECVLSSMKILNKSEDYLYLRPWLGTGLLTSDGPKWKKHRKIITPAFHFQIL

EQFVEVFESGGNRFVQQLQKEVGKKSVDIYPYVTLCTLDIICESAMGISINAQFDDNSDYVRSVKAMCRI

TMERLFHLLEMNDVTYPLTKNYYTQKKSLNVLHNQTNSVINRRRKELENKTEAINVTNEDKADNNDTLFG

RNKKAFLDLLLQATVDGRPLTQEEIREEVDTFMFEGHDTTASAISFAIYCLANNADVQAKAYEEQIALFG

GNKSPAVTYSDLQSMKYLELVIKETLRLYPSVPMFARKTSEPVQYENIFIPEGVTVNIFAYGIHRDPKYF

KDPEKFDPSRFETVDGKLPYAYIPFSAGPRNCIGQKFAMLEMKSTISKVLRNFELQPATPTHTVQLAAES

VLKSANGVKIALKNRN

 

>CYP4BN2    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971905

           72% to 4BN5

MILPILLCLIFSFLIWSLYQTCKKNSFYKNIPGPSGVPIFGIAFEFKSTQ (1)

DVLINLTSYIKTYGDIVTAKIGPFR

86921 RYLLVSDYNFLECVLSSTKLIKKSHHYTFFQGWLGTGLLTAD (1)

GAKWKTHRRILTPAFHFQILEQ 86682

FIEVFEKCGDVLVKKFENEVGRKSFDIYPYVTLHTLDVICESIMGISVNAQNNSTSEYVNSVKNICKIFV

ERSVSPLQMCRFMYPFTKNYWAEQKALKILHQHTNSVIDARRKELHKAENGHNTNPKKSKKPFLDLLLET

KIDGIPLTQEEIREEVDTFMFEGHDTTASAISFTLYSLANNLHVQEKAVDEQKKIFGERKDVTAAYADLQ

NMKYLENIIKESLRLYPSVPFYNREITDDIMFDNKLLPKGDTIMVFAFAIHRNAKYFDNPEQFNPDRFND

LENKLPYAYIPFSAGPRNCIGQKFAMLEMKSTISKILRKYKLLPADPQHELNLVSELILKSSNGIKISIE

PRC

 

>CYP4BN3    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966858, XP_975914

           56% to 4BN1

MALLTDVFLPLVIILLIFWYWYRSQKNKKYYQNVATPPTVPILGNALDFTTTTELLGTFMRYRKDYGGLV

KVHIGPLRHFLLVSDYKMLEYLLSSPKIVDKSEDYKFLSSWLGTGLLLADGGPKWKKHRKILTPAFHFQI

LEQFVDVFDSCSNVLIQKLDKEVGNTSVDVYPFVTLFTLDVICESTMGTKINAQDDVTSDYVQSVKHMCR

IIIERSISPVQMYDFLFVFTRNYFIQRRALRILHDKADGVISQRLRELQAQTKTDSEGDSEGIKKKKAFL

DLILEAKVDGKPLSQDDIRQEVETFMFAGHDTTASAISFTLYCLANYPEVQKMAYEEQLSIFEDNNEPDV

TYANLQSMKYLELVIKETLRLYPSVPIIGRQSGEDFQF

DNSWIPKGDTMLLFLYGIHRDPKYFKDPEVFD

PNRFENPDNKMPYSYIPFSAGPRNCIGQKFAMLEMKCVLSKILRKFELQPAVPQHNLLLTAETVLKSANG

IKIGIKLRK

 

>CYP4BN4    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971963

           66% to 4BN1, 52% to 4AW1, 51% to 4BD1

MCCCFPLALAALHWPRDARVDDCRLCYPMPMRDAGQQLLQHQKLSGTLRMDTQAAAKTPTLALRHDAMQS

FNRPTFYLVLDIMMKYMKIYGGVVKFHGGPIDKTLLVSDYNFLENVLSSTKILNKTDDYKFLHSWLGTGL

LTSAGPKWKKHRRILTPAFHFKILEQFIDVFESAGNKLVKKLEKVVGKDSVDIYPFVTLCTLDIICETAM

GIKINAQDNGESEYVRSVKQMCKIIIERSFSLLQMINLTYPLTKNFYIEKNALKILHQQTNSVINQRRQE

LKNQSKNIEQENDLGTKTRKAFLDLILEATVDGRPLTDTEIREEVDTFMFEGHDTTASAISFALFCLATH

PEVQARALEEQKALFGDTKNPTPTYTDLQNMKYLEQVIKEALRLYPSVPFHGRKTNEAVEFNNGTVVPKD

VTITVFTYGIHRNPEYFKDPEKFDPSRFDTIDGKLPYSFIPFSAGPRNCIGQKFAMLELKSTLSKVVRKF

ELRPATPEHKLQLTAETVLKSVNGIKISLKLRQ

 

>CYP4BN5    Tribolium castaneum (red flour beetle)

           GenEMBL XP_967939

           72% to 4BN2

MITIVIILIFILVSINFITKYLKKLKQNKDFYQNIRGPRGLPILGSALDFKTTK (1)

DVLQNLINYTRDYGEVVTAQIGPFHRYILVSNYDFLECVLSSTKLSSKSHNYNFLRPWLGTGLLTSD (1)

GAKWKTHRRILTPAFHFQILEQFIEVFEKCGNTLLEKLRNEVDKETCDIYPYVTMCTLDIICESIM

GISINAQEDSTSDYVQSVKNVCRIMVERSISPLQMCPFMYPLTKNYWTEKKSLKILHKQTNDVINARRKE

LESSKEVSSYEENFTKKKKPFLDLLLETKIDNRLLTQEEIREEVDTFMFEGHDTTASAVSFTLFCLANNL

ESQQKAFEEQQAIFGNIQNVTASYTDLQNMKYLEQVIKEALRLYPSVPFYGREITENVEYDGKLLPKGDI

LLIFAFGIHRNEKYFPNPEKFDPDRFHNMDNKTPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKVLRQYKL

LPTTPQHELELVGETILKSTNGIKIRVTLRN

 

>CYP4BN6    Tribolium castaneum (red flour beetle)

           GenEMBL AAJJ01000217.1, DT795816 = EST

           76% to 4BN1, 46% to 4d2, 50% to 4D24,

           51% to 4AW1, 43% to 4H8

       MNIILEFFSALAVIIVLSWWYLFLKNYKVGKFFKNFSGPPGVPLLGNALDFKNKTK (1)

41530  GVLPAFLNYNKNFGGLVKVQIGPFRKLLLVSDYKFLEFVLSSTKIINKSQNYRTMLPWLGTGLLTS  41727

41728  EGIKWKKHRRIITPTFHFKILEQFINSFDAAGDVMINKLRKKVGIESVDIYPFVTLCALD  41907

41908  IIC (1) 41916

41969  ETAMGTTINAQNNEESEYVTSVKEMGRIIIERAIAPQKNNEFLFRFTKDY  42118

42119  QLQKSALKVLHNYTNNVISKRREELLKDQASKVSENVIDMGIKKKMAFLDLLLQATVDGR  42298

42299  PLTNEEIREEVDTFMFE (0)

       GHDTTASGISFALYCLANNPEAQEKAYEEQVALFGKEKKPIVSYSDLQEMKYLELVIKEALRLYP

       SVPFYARETNQEVEFGDI  42696

42697  KIPKGVNITIFAYGIHRDPKYFPEPDKFDPGRFETIDGKLPYAYIPFSAGPRNCI  (1) 42861

42915  GQKFAMLEMKSTISKVLRNFKLCPATPHHTLDLVAETVLKSDNGVRLSLMERQ*  43076

 

>CYP4BN7     Tribolium castaneum (red flour beetle)

            GenEMBL XP_972577

            66% to CYP4BN8

MYLIAIVIVLISLYLIVKPVKKTGNIDDFPEPPSKVFFGHALDAKSTTEILNVTTNYVKKYGKIVKLRLG

PFFKALVVTDYKLVEFFLSSNSLLTKSQNYAFARSWLGNGLILANGTHWKQHRKILTPAFHLEILREYLE

TFDSVGRIFIEKLKSLDNVQSVDLDALVPLCTLDVICETAMGTKINAQKGENSEYVSSVKEMCRIIVARF

LSPLKILKCTYWMTHDFYTERKVVNILHSFTSKVIDGRKTNRNETEKSGKKKAFLDLLLKFSDIEKLSDR

DIREEVDTFMFAGHDTTATGVCFALYLLANNPEVQEKVLSEQKELFGDEKNPCVTYQELQNMKYLEYVIK

ETLRLYPSVPVIGRYLKEDTTFGDRVISAKTNVAIFIYGIHRNPDYFPEPEKFIPERFENMTNLPPYAYI

PFSAGPRNCIGQKFAMLEMKSLISKVIRHFELTPANPHHELVLAAETVLKSANGIKIGLRARSENKM

 

>CYP4BN8     Tribolium castaneum (red flour beetle)

            GenEMBL XP_972624, AAJJ01005264.1

            66% to CYP4BN7, 55% to 4BN4

MFIFAALFFLIIFYLYHQNVKLNRILCTFPEPPKKFLLGHVLDITSTT (1)

DVLNVFSK YINNYGPTIKLRAATLFAGLGTTDYKLCELLLSNNRILSKSLNYQYAR

NWLGNGLLISDGDYWRRHRKILTPAFHFEILKQFVETFESVGKVFVEKLDISQGPSVDLPPLVTLCTLDV

ICETAMGTQINAQKGQNAKYVQSVREMCRILIDRGLSPLKILNNTYWMTKDYYIEKKSLKVLHSFTSSVI

EKRKAERNERNCTKLAFLDLLLKFSNEGELLTDQELREEVDTFMFEGHDTTASSISFVLFCLANHPEVQE

KVLREQNELFGDDKDPSVTYHELQKMKYLEQVIKETLRLYPAVPIIGRCTSEDITFGEHFIPKDTNIAIY

IYGIHRNPEHFPEPETFNPDRFKNSNSLPPYAYIPFSAGPRNCIGQKFAMLEIKSIVSRVVRCFELRPAE

PYHSLVLSAETVLKSANGIKIGIRKRI

 

>CYP4BN9     Tribolium castaneum (red flour beetle)

            GenEMBL XP_971513, AAJJ01000614.1 also has 4BN10

            66% to CYP4BN10

MIVFTGYLIAIVLILFPLYYYYAKCYALEKFYHQFPSPPKTPFFGNALDLKTTK (1)

DLFQSFHRYVKAYGT

17128 MVHLKIGPFDHMLLCSNPKFLEFLLTSNTLLKKSPNLRYLVPWIGTGVATAY (1) 16970

16925 GPKWKLHRKLVTPAFHYS

VLSQFVNTFESSGNILVEKISKLCDGQKVDNFDLYPHITRCTFDIICETAMGTKSNVQTNETSVYFESIK

EMCRIFMSRTMAVFQRYDFIFRFSKDFHLQKKALDIIHNYSNEVIATKRKELDENVKQKESVDDLGRKEK

MVFLDMILNKAIDGHIFSQEAIRGEVDTFMFAGHDTTATAISFILLCIANHNEVQDKIIEEQERLFGCEK

NPKVTFAHLQEMQFLENVIKEGLRLYTPVPLYGRQIDKNVEFEGMLIPKGVNVVIFNHGVHMNPEFYPNP

EKFDPNRFESMEDKHPFAFIPFSAGPRVCIGKKFAILEIKSILSKIVRNFELFPASPSYELDLAAETVLK

SLNGIRIGIKRRETF

 

>CYP4BN10    Tribolium castaneum (red flour beetle)

            GenEMBL XP_971570

            66% to CYP4BN9

MSVLTEFFIALVALILLPFYFYYTKIRRIENFFKHFPSPAGVPILGVAPEFKTTSSVLDNFHKYAKAHGT

MVHLKFGPFKHALLCTDTKFLEFLLSSNKLLKKSVNLRFLEPWIGTGLVTADGGPKWKTHRKLITPAFHF

KILEQFVDIFESGGDILVKKLSEVSGSKSCDIYPYITKCTLDIICETAMGTKVDVQNTENSAYFESIKEM

CRIFTVRTVGAFLSNDFIFRFSKDYKIQTKAVKVLHNHSNEVIVNKRKELKEKNNENTSDIDELGRKKKK

VFLDLILSATTDGQSLSPEEIREEVDTFMFGGHDTTGTATSFILYCIANNKEAQEKILEEQKQLFGDERS

PKVTYSTLQEMKYLENAIKEGLRLYSPVPIYGRLIDQDTEYNGTMIPKGVGVIIFAHGIHMNPKYYPNPE

KFDPSRFENTTGKDPFTFIPFSAGPRNCIGQKYAMLEIKSLVSKVVRNFELFPASPTHEMHLAPETVLKS

LNGVKIGLKMR

 

>CYP4BN11    Tribolium castaneum (red flour beetle)

            GenEMBL AAJJ01000275

            53% to CYP4BN4, 49% to CYP4BN6

73454 MEILFTLFILLLCLLLYFYNKYVYIFDKNLKDYPAPPQVPILGHTLDF (0) 73597

73690 LIFLGFLDVLLSYTHKYGDIVRIRPGPIRQLLLTSNYKLFEAVLSNAKITKKSADYKFFHRWLGTG 73887

73888 LLTSDGAKWKKHRQIITPTFHFQILENFVDVFEKNGKILTKQLEKHLNEDSVNVYGFVNL 74067

74068 CALDIIC (1) 74088

74133 EAAMGTSVKAQENMNSEYVRSVKDLLDTLMGRIFSPYKMIDFIYFFTEDYKKEMKALQ 74306

74307 VIHSYTRNVIKSRQAAINSGEFEQKTKKNFLDLLLAANEQQMTLEEIREE 74456

74457 VDTFMFA (0) 74477

74527 GHDTTASTISFALFCLANHPDEQ (0) 74595

74648 ARVYREQKDIFGDDFKRAVTFQDLKKMKYLEYVIKETLRLYPVGPFFSRELDKDVPFAG 74824

74825 KVLPKGLTITLFIYAMHRNPEYFPDPEKFNPSRFETFDGKMPFAFVPFGAGPRNCL (1) 74996

75039 GQKFAMLEMLSVVSRVVRTYKILPSIPRHEINVAAQVVLISTNGMRMRFEKR 75194

 

>CYP4BN12v1 P4D262110 Leptinotarsa decemlineata (Colorado potato beetle)

71% to 4E2 (short match), 64% to 4D2, 96% to P4PD1553, 2 aa diffs

DQ631641.1

PFTAGPRNCIGQKFAMLEMKSTISKVLRHFEILPATPEHKLKLAPEIILVSKNGVCISLRKRFEL

 

>CYP4BN12v2 P4PD1553 Leptinotarsa decemlineata (Colorado potato beetle)

68% to 4E2 short match, 61% to 4D2, 69% to 4BN1, 67% to P4PD25180

DQ631646.1

AGTRNCIGQKFAMLEMKSIISKVLRHFEILPATPEHKLKLAPEIILVSKNGVCISLRKRFEL

 

>CYP4BN13v1 Leptinotarsa decemlineata (Colorado potato beetle)

P4PD25180 like 57% to 4D2, 71% to 4BN3

DQ631645.1

PFCAGPRNCIGQKFAMWEMKCTLSKILRNFELRPAIPKHTLKLTPEAVLKSSNGVRIQVRPRKL

 

>CYP4BN13v2 P4PD24810 like Leptinotarsa decemlineata (Colorado potato beetle)

54% to 4D2, 95% to P4PD25180 (3 aa diffs), 68% to 4BN3

DQ631650.1

AGRSNCIGQKFAMWEMKCTLSKILRNFELRPAIPNHTLKLTPEAVLKSSNGVRIQVRPRKL

 

>CYP4BN13v3 P4PD29346 Leptinotarsa decemlineata (Colorado potato beetle)

56% to 4D2, 95% to P4PD25180 (3 aa diffs), 71% to 4BN3

DQ631648.1

GPRICIGQKFAMLEMKCTLSKILRNFELRPATPKHTLKLTPEAVLKSSNGVRIQVRPRKL

 

>CYP4BN13v4 P4PD61109 Leptinotarsa decemlineata (Colorado potato beetle)

52% to 4D2, 96% to P4PD25180, 69% to 4BN3 same aa seq as P4PD29346, different nucleotide seq DQ631649.1

QKFAMLEMKCTLSKILRNFELRPATPKHTLKLTPEAVLKSSNGVRIQVRPRKL

 

>CYP4BN14v1 P4D215Ic4 Leptinotarsa decemlineata (Colorado potato beetle)

63% to 4D2, 64% to 4BN1 98% to P4PD273ic4, 1 aa diff

DQ631642.1

PFSAGPRNCIGQKFAMLEMKATVAKLLLKFEIVSCGHVPILAAETVLFSKNGVKVTLKTRM

 

>CYP4BN14v2 P4PD273ic4 Leptinotarsa decemlineata (Colorado potato beetle)

73_IC4C8_M13R_A10 61% to 4D2, 62% to 4BN1

DQ631647.1

PFTAGPRNCIGQKFAMLEMKATVAKLLLKFEIVSCGHVPILAAETVLFSKNGVKVTLKTRM

 

>CYP4BQ1 Dendroctonus ponderosae

EZ115352.1 with frameshift, missing C-term

MFLSVSHTFLAVLVLLLSVCYRRSRNIKEKLWWVPLIPGYPILGNALEFADS

TKILERMNHYVLKYQGYCYFTLLFRPLMLISDAKFCEWLLSSTTILTKSKDYQFLYNWLE

GGMLISSGPEWRKARKIVTPAFHFAILEQFVEVFEKPTAI &

LVDCLRKQLDKDAVNVHPLI

ANYTLDIICQTAMGVDLKVQEESQNDYVAAVDAMCKTVVERAFNPLKSFDIIYRLSPDYY

REMRNVKLLHSVSNTVIQKRRKEMESEKNNVESVNEDGTKRKMAFLDLLLKSRDEHGQPL

SQDFIRREVDTFMFAGHDTTASAISFVLFCLANHPDVQNQVLNEIKEVRGEGQKITYKEL

QEMKYLEMVIKESMRLYPSVPF

 

>CYP4BR1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966411, XP_975718 (missing an exon)

           AAJJ01002884.1 formerly CYP4BP1 (name conflict) and CYP4H10 wrong subfamily

           53% to 4BR3, 45% to 4H11, 43% to 4D23,

6659 MILAIVIALISAPFIWWMLILSKYRSLSNVPGPKPSPVIGNSLHIGYRPQDLFNNIVKWAKEYGTVYKIF

VANDVRVLITNPELTELVLSSNVHITKSNAYDLLKPWLGIGLLIST GKKWKSRRKLITPTFHFKILDQFL

DVFNSCGNVLVQRLSSQVGKDSFDVYPFINLCSLDIIC ETSMGVKIKAQQGNNTEYVEAVRRFLDIFIIR

TFSVWKGIDALFKFSSAYSVYKRLLKILHQFTINIIVQRRGEKAQQKTQNVTSDDGIKRKVALLEMLLES

EDNNMLSNEDIREEIDTFMFEGHDT TTSGIAFAILCLAENPKVQEKLYEEVVAVIDNIENITMQQLQEMK

YLEMVLKEAQRLYPSV PVIERRLEVDCNIGGYDFPKDTFLSLFIYGMHHNEKYFPEPEKFDPNRYLPENQ

AKRHNYAYVPFSAGPRNCIGQKFAMLEMKTTIAKIVKHFKILPVPDYKPDLGIAAILKSYNGVCVRLQHR

HGN 8527

 

>CYP4BR2P   Tribolium castaneum (red flour beetle)

           GenEMBL AAJJ01002884 pseudogene between 4BR1 and 4BR3

 9437 SGKKWKTRRKMITPTFHFKILDQFIEVFNSCGNVLVEKLSSHVGKESVDVYPFINLCS 9610

 9699 TKRNGIKRKVAXXX

 9737 MLLESEHNNVLSNEDIREEIDNFMIRG

 9823 HDTTAFGIAFAILALADN

 9876 PKVQDKVYGEILSVIGDYEDVTMQ*LQDSRYLEMVIKEA 9992

      GGYDFPKDTAFSTFXXXXXXXXXX 10083

10082 FPNPEKFDPNIFLPENQS 10135

 

>CYP4BR3    Tribolium castaneum (red flour beetle)

           GenEMBL XP_967724

           53% to CYP4BR1

MFVVAFFVTLTVILCTPLIWWYLTLAKYSSLKKVPGPPPLPVIGNSNVIGKTTVDLLHSFMNLQDKYGTV

VKVWLGPRLHLLITKPEMVEFFLNSTVHLNKSDGYDLFKPWLGDGLLVSTGSKWKTRRKLITPTFHFKIL

ENFLETSFNKQINILLDVLLKEASQTDKSIEIHSLINLCSLDIICETAFGTELNAQAKCNPKYVEAVTGF

LEIFTLRFFSAWLRHPLIFRLSDKYAKYMEYLKILHDFTNTIIKRRKEEFKLLQDNAKISEEGIKRRAAL

LDMLLEVSDNGKNLTDEDIREEVDTFMFEGHDTTTTSICFVLYAIAQNPDVQKKIYDELVSVLGPDCKKE

ITFSDIQELKYLDVVIKEAHRLYPPVPLIERSLEEDCTIDGLTIPKNTNISIFLYGMNYNKDVYPEPHVF

DPDRFLPEKQGERHTFAYVPFSAGPRNCIGQKFALLELKTTIAKLLRCFEISPDPKNPPQVGMCSVLKSR

NGIHMFLKKKN

 

>CYP4BS1 Pediculus humanus Ph4-2 495aa 8 exons XM_002428194.1

1103172107803 plus (315168-315315,315409-315515,315601-315880,315951-316020,316094-316394,316454-316694,316899-317078,317171-317328) similar to  Ag4C25,  upstream from Ph4-3, 49% to 4C1 cockroach

79% to Ph4-3

MFSVILSIIVIFLIWKLFKLIEKEYILSKIPGPFTYPLLGNVEVFEPIEV(1)TLGNILKRKEKYGPVYKMRAGFLVGVFLTRAQKIE(0)DLIKGMKHLEKSHVYKFVHPWLGTGLLTAHGEKWASHRKLITPSFHFTVLQSFIEIFQENSNILINKLNDVADSDKAVDIFPFITLCLLDVICE(1)TAMGTKINAQTDSENEYVKSVYS(2)LSSLIIHRLNRAWLHPDFIYNLTSHGREHKKHLDIVHNFTDSVIRARKLLFENESSTNFDPSEKRKLSFLDLLLKASINEASTPLTDVELREEVDTFMFE(0)GHDTTAAGVNWAILMLSHHPEIQEQAYEEVKTIFENKKGKDLTLGDLSEMALLERIIKETLRLYPSVPTIGRHIDEDTQIG(1)DYLIPKGSNTVLVIYAVHRDPKVFPNPDVFDPDRFLPENSADRHPFAFIPFSAGPRNCIG(1)QKFAMYEEKVVLSNLIYNYRFESVGKLEDVIKIPELVLRPKNGIPVKVYKRN*

 

>CYP4BS2 Pediculus humanus Ph4-3 496aa 8 exons 1103172107803 plus (318223-318376,318459-318565,318652-318931,318994-319063,319148-319448,319508-319748,319817-319996,320076-320230) similar to  Ag4C25,  downstream from Ph4-2, upstream from Ph4-4, can't find M on N-term

48% to CYP4C1 cockroach, 79% to Ph4-2

LNYASFPLIILLIFILLKLFGEDEKTKIINKLPGPFAYPLIGNIEILEPVEV(1)FMDNILIRKKKYGPIFKMRAGPRYGIFITRAREVE(0)DLITGMKNTEKSFVYKFVQPWLGTGLLTAHGKKWASHRKLITPSFHFTVLQSFIEIFQENSNILINKLNKMADTNEVIDIYPFITLCLLDIICE(1)TAMGTKINAQTDKTNEYVKSVYR(2)LSTLIVKRMGRIWLHPDFIYNLTSHGKENRKHLDIVHNFTDSVIQTRKLLFENESSTNIDPSEKRKLSFLDLLLKASSNEASTPLTDVELREEVDTFMFE(0)GHDTTAAAVNWAILMLSHHPEIQEKAYEEVKTVLENKQEEGLSLGDLSEMKLLERVIKETLRLHPSVPMIGRRIEVDTRLG(1)EYFIPEGVSAVISIYALHRDPEVFPNPDVFDPDRFLPENSADRHPFAYIPFSAGPRNCIG(1)QKFAMYEEKVILSNLIYNYRFESVGKLNDVIKIPDLVLRPKNGIFVKIYNR*

 

>CYP4BS3 Pediculus humanus Ph4-4i 497aa 8 exons 1103172107803 plus (321341-321497,321583-321689,321767-322046,322216-322285,322382-322682,322742-322982,323053-323232,323304-323458) similar to  Ag4C25,  downstream from Ph4-3, can't find N-term exon

48% to CYP4C1 cockroach, 71% to Ph4-2

LDIFSLTITILLFLIFWKFFQNDKKTLHINKLPGPLALPIFGNIIEVLQPKDK(1)FLENSMKRRKKFGPIFKMWFGRNPSVFLSRAKEIE(0)VVIKGTKHMEKSFVYKFVQPWLGTGLLTAHGKKWASHRKLITPSFHFTVLQSFIEIFQENSNILINKLNKMADTNEVIDIYQYITLCLLDIICE(1)TAMGTKVNAQSDSQSEYVKSVYR(2)LSALVVERTGRVWLHPDFIYNLTSHGKENRKHLDIVHSFTDRVIQKRKLSFENESSKNFDSPDRKKLSFLDLLLKASMNEASTPLTDMELREEVDTFMFE(0)GHDTTAAGVNWAILMLSHHPEIQEKVYEEVKTIFENKQEENLTLGDLSEMKLLDRVIKETLRLCPSVTSIGRIAEEDIHLG(1)EYTIPKGANTVINIYALHRDPTVFPDPDVFDPDRFLPENMSGRHPFAYIPFSAGPRNCIG(1)QKFATYEEKVILSNLIYNYKFLPVGNLEDVKKIPELILRPQNGIPVKIKKR*

 

>CYP4BT1 Pediculus humanus Ph4-5 508aa 10 exons 1103172108237 plus (85774-85963,86049-86246,87180-87365,87458-87527,87754-87944,88098-88201,88321-88389,88481-88646,88738-88911,89005-89180) similar to  Ag4C25,  not happy with N-term of exon 6, should more be included here? 42% to 4C3

MDVYQIYSNARLLCYYFAGLFLLFIIFRYIIKRMIFVQGLSPIPGPFGIPLLGNSLSLTGGQDD(1)FFRLLLNYRKIYGSIFKLWIGMRPFVFISDAQYVSPILNSSLHIDKSYEYTFLHPWLGTGLLTATG(1)SKWHSRRKLLTPTFHHSLLEGFIQPIIEKSKILISLLENEVGQPPFDVLKYTKLCALDIICV(1)TAMGKDVNAQLCHGTEYVQAVEG(2)LNKILQRRFITPWLKPDFIFKRCQLGRQQENYINTINNFVSQVIEDKKNELKKTETESEQKSTS(1)KHPAFLDLILKTRKDGQALSDNDIREEVNTFMFA(0)GHDTTSVAISWCLFALGKHQSIQ(0)KNILEEYETVVKNKIPTFDEIQKLEYLENCIKETLRLYPVVPLIARDIKHKIDIDG(1)KTRLLPGVTALIFTPSLHRDCKVFQEPNEFMPDRFKENKTRNPFSYIPFSAGPRNCIG(1)AKFAMIEVKIVLYNILKNYEIISVDSEKDLNLMSEIVLSNKEGIRIILEKRKRKICLE*

 

>CYP4BU1 Pediculus humanus Ph4-6 509aa 8 exons 1103172108222 plus (495610-495778,495870-495976,496053-496338,496420-496619,496695-496874,496954-497191,497289-497468,497555-497721) similar to  Dm4C3,  upstream from Ph4-7, GC donor on intron 4 42% to 4C1 cockroach, 52% to Ph4-7

MFESLIILFILIFIFHLFIYHEYHLPKYVNLINKIPGPVSHSYFGSSLKFYRLKHEE(1)ILYDLIEGFKKWGPTYRLWYSGVAVVFVSDLEDVQ(0)TILSSREANAKGMLYRNILPWLGCGLLTSCGEKWQKMRKIITPAFHFTVLCDYIEIFNKNTKIMLDVLKKKKDDDEGKKCDLSKYLTRCTLDNICE(1)TAMGTSINALRTGSESKYVKAIFRMGQIVVERMFSPLHFTNMSFMFSLKGLEHSRLLKILHGFTYE(0)IINEKMMNLIKEKSGGRVEKKTGNVYKTKSSFLDILLENQKIHCLSFEDIRQEVDTFMFE(0)GHDTTAASLTWTLFELGHHPEVQERCYSELIEIFGDSNELPSYNDLMKMNYLKRVIQETLRLYPSVPVISRKFKVDMQLN(1)DYLVPANTEIILILYAIQRNEKIFKNPDKFDPDRFLQEEIIKRHAFAYVPFSAGQRNCIG(1)QKFAMLEELVVLSSIIRNFKIESLNDRNSIRVVPEMILRPHQNLKFKLIKRSEVI*

 

>CYP4BU2 Pediculus humanus Ph4-7 503aa 8 exons 1103172108222 plus (499765-499939,500016-500122,500217-500493,500571-500770,500844-501017,501125-501362,501448-501627,501722-501879) similar to  Dm4C3,  downstream from Ph4-6 38% to 4C1, 39% to 4AZ1 Am, 52% to Ph4-6

MFIYLLIIILFIFCFIFHLFFYHKYNFPDYVKKIEKIPGPRGVFYFGNILQFYKINTED(1)LLPYLIKEFKIWGPTYKYWFNGFAVVMISDVDDVK(0)MILCNENDQKKGILYDNLKPWLGTGLLTSSGKKWKIMRKIITSAFHFSILRQYLEIFSKNSTVMMYNLSRCDIKKFFHLNNFITYCALDSIYE(1)TSMGTCINSQINKTESDYVKAIFRIGQIIVKRIFSPHLYADYLFNLSSLGRENSKLLKILHETTTN(0)IIQERKKKMALENQRESFEINGGGERKMNFLNLLLEKQKIYKFSDVDIRYEVDTILMA(0)GHDTTSTALNWCFFELGLNKKIQNKVHEELKNIFGDSNREPTYEDIIKMEYLKRVILETLRLYPSVPVISRKFDVDIRLK(1)NYTIPANTEIVLMIFIIHRNSNIFPKPDKFDPDRFKLDVLKKRNPFAFIPFSAGSRNCLG(1)QKYAMLQMLVLSSYILRKYKIKTINSRKTVKPVPDVILRPNVELKWKLIPKT*

 

>CYP4BV1 Pediculus humanus Ph4-8 504aa 9 exons 1103172107373 minus (53344-53188,53085-52979,52896-52806,52731-52543,52459-52390,52311-52103,52029-51923,51851-51783,51703-51191) similar to  Ag4D22, 41% to 4C3 Dm

MINPWVLGIIIIAIYAVNYFKNWDYYKALRKFPGPAALPILGNSLDFATNSHG(1)IFLKLVDFGQKYGRFYRVWNNGKAYVICNDEKDAE(0)IILSSNEHLHKNEAYKFFIPWIGEGLISATD(1)INKWKMRRKIITPTFHFKILNEFFEVFVRNAEILCHQLRLKSGKGSLNICKFIKLMALDNICE(1)TAMGVDIKAQENSENTYVKAVQD(2)ITSVISLRMFKVWLMIDSLFNLSSESKVQAQALKILHGTTDEVIKNAREKFKEKNKNDNNNINNLKETFD(1)EKRKKAFLHLLLASEEGSQLSDKAIREEVDTFMFA(0)GHDTISSGLSFAIYSLAENPDVQ(0)ELAYKEQMDIFDGSTRKPTYNDVQEMKYLERVLKEVQRVYPSIPIIGRNIKKDLQLQGNYIVPKGTQLCINIYSLHHNPNIWPNPEKFNPDNFLPEAIQSRSPYAFIPFSAGPRNCIGQKYAMLVMKVTLSTLLRQFKILPDPHSREKPMLAGEIVLLSTNGLNVCVEPRF*

 

>CYP4BZ2 Nasonia Nv4n10i 439aa 9 exons SCAFFOLD11 plus

4207 MIVTTMVGASIVRYIVNKKRIIELAIKLPGPRAYPIIGNALKFACEPD

(1) 4350

5067 QLLERIVDVIAPYADVTPMRLWMGPMLYVIITEPRDIE(0) 5180

VVLNSQQATSKGSAYKFLYPFIGNGLISGSG(1)KSWKAHRKIISHILNQRTL

DSFIETFDRRSKEFVKKLEPLANGEVFDIFHSLEGCTIDLVCE(1)TVMGYTD

INALDNPNKEFVHYTAE(2)

6503 MYKIIHNRMMKIWLYPDWIFRITSNYSNQKRAQTMIHNFTERVGMRKK(2) 6646

6711 QDMLKEKSKTCILHRLLTVNSVTNELTEEELRDEIYTIYIA(0) 6833

SQDTLAVTSSFAVLMLGIHGDVQKKARSEVDEVIGVGDVNIESLSKLKYLEMV

IKETLRLFPIAPLMVRQLNGELKLG(1)NSILPKDCQVVIAPYATHRSSKFWE

NPENFLPERFAIKETVKRHPYTFIPFSGGPMGCIG(1)QKYALTALKMILANI

LQKYVVESDVTLRDIKLKTDISIRSMNGYKISLQARTNITKYL*

 

>CYP4CA1 Nasonia Nv4n11 493aa 12 exons SCAFFOLD13 plus

MALAISALLAVGLLFTALAFVIGHYLRKIRLYRESAKFPGPPALPFIGNAHFF

MGSTED(1)ILSKCQELLDTYPSPFRVWLADRLFYAVYDPEQLK(0)TIFLSP

KTIEKEELYKFAEPWLGTGLFTAPA(1)SKWRIHRKLIMPTFNPRILESFVEV

FSVQSEVMIKEMEVELNGGEFDIFHYVSLCTLDIICE(1)TAMGVRSRAQTQR

NSPYVESAKR(2)

30652 LFEIVYSRMFKIWLHPDIIFNNTRLGKDQRECIKYVHSLTDD(0) 30780

VIKRKKQAFEGNGTVEGMNGKLRK (?)

VEGKRKAFLDLLMELSHEGTKFTDEELREEVDTMMIA(0) 31180

GNDTTATVNCFVMLMLASHPEIQ(0)DKVYEELCEIYGSEDPSSVLVRHEDLH

RMEYLERVIKETMRIFPVGPVLVRRVTDDLNIG(1)DYTLTKGSSVVLGIIKT

HRSEEYWTDPLTFNPDRFLPEECAKRHPYTYIPFSAGPRNCLG(1)MKYAMMA

MKALLATVIRKYVIKKDNALPVQDIKLKADVMLKPVEPITIRIERRIHGKDRTN*

 

>CYP4CB1    Liposcelis bostrychophila (psocid)

           EU979550

           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           36% to CYP4C3 Droso., 37% to CYP4C37, 38% TO 4C61, 37% TO 4C62

           40% TO EU979551, 41% TO EU979549, 37% TO 4BM1 Tribolium

MLGLLILLVIIFALVIGLDYYNHYKDPRRIIDRIFPGPFRIPIVGNALIAACSREAFYRVYLNLSKSYDYKPFRLWFLKQPYVFISDYENTKKILSSNDLLDKAEDYRYFEPWLGQGLLTSKGDKWRRDRKIITPAFHFQILHRFFQIFYDNGEIFCEKLTAHDGGDVFDVFEYIEMLTLDNLCNAALKLDIQAQLNPFSALVCAIQNMGVVIYNRIFTLWLRYDAMFRLSSTARLQKKCLEIIHGNDVKIIRERKEEMKTKQPKLKTMEFDEKEKVAFLDLLLEMQDDVGYTDEDIREQLDTFMFAGHDTVTATLGFLIYSLAEHPDVQEKVYRELLDIYGESERCPNFSDLQDMKYTEQVIKETLRLYTVVTAVARRVEEDFELSEHQVVPKGVEIVLLLSALHRNPEIFPNPDIFDPDRFSPEVNQERDSFAFVPFSAGSRNCIGQKFAMHEMKITVYKIVKKFKLSISDKPEDKVRTRTGVVLSSTNGIRIKVQSRKKKTPSKLADQ

 

>CYP4CC1    Liposcelis bostrychophila (psocid)

           EU979549

           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           39% to CYP4D22, 43% to CYP4D2, 40% TO 4C62, 39% TO CYP4C61

           44% TO CYP4CD1, 41% TO CYP4CB1, 41% TO CYP4BN1 TRIBOLIUM

MIFYVIVTTILLLLYIKYRLTIRHLVVVDTMFPGPTCLPIIGNALMLRGTSEDFYKRFTETCFYYRRSFRVWIAHRLFIACLYPEDAEVILGNNFEITKADVYEFLLPWIGDGLITSTGKKWRTHRKMLTPAFHFRILEEFTKVFNKNGKIFCEVLSKIPENKIFDVYEYVKMYAMDNICETAMSVSINAQKNPNSAYIRAVKDMCTVAFKRMRTLWLRSDFLFRMSPWAKVHDDALSLIHSQTRDVIKKRKQELERNPDLRLTMENDNFSIKGKLAFLDILLHAAQEYRLTDEDIREEVDTFMFEGHDTITSAISFAMYYISRDQEVQKKILQETESIFRGEDREPTVKDFGAMKYLETVIKETLRLHPSVPFIARKISQDFQIDMKAYAPRGAEVLVVIAALHRNPYQWEKWDQFYPEHFLPEATQKRHPYSFVPFSAGPRNCIGQKFAMIEMKSVLSKVVKEFELIPSPHPEHAIREVPDLILTSGTGMHVGLRKRISGAA

 

>CYP4CD1    Liposcelis bostrychophila (psocid)

           EU979551

           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           47% TO CYP4BN6 TRIBOLIUM,

           42% to 4D17, 43% to 4D2, 41% to CYP4C62, 39% to 4C61

           44% TO CYP4CC1, 40% TO CYP4CB1

MVLHGLFVTFVCATLIYVLERIIHRRVYKAEKQFDGPPGYWFFGNSFDFINKSSKEIFDQVVENLKTYGNGRFYKIRIMHRLGIACSDHRDMEVILGSNTLIDKGVHYHFILPWIGFGPLTSNGSRWRKHRKIITPTFHFKILEQFIDVFNKNGAIMCEKMEKEVNGEPFNVYNYVNLAALDNIFESAMGINMNVQKNSETTYVRAIKEMCNVVNKRVFWWILRIYPIFRLSKYYKMQTDALNVLHSTTVNIIEQRKKELAVRKKLEKDDEKDEEIEFYQKKRMAFLDLLLESAEASNISDEDIRQEVDTFMFEGHDTISSGLSFALWALANNPDVQQKVYEEQMEIFGDSNRPPTFNDLQNMKYLERTLKESQRLFPSVPMITRKLNEDVDLPGGYHLPKGTNVGMIIYSLHRDPKVWPNPEKFDPDNFTPDAIQGRNPYSYVPFSAGPRNCIGQKFAMLEMKSTVSKVVRQYKLLPSPYEKHKLQLTSELVLMSLSGVHVKIQRRSNSFS

 

>CYP4CE1    Nilaparvata lugens (Homoptera: Delphacidae) FN356974.2

MFVFVTEPQTIVLPASIVSEPASAAEDDKCFVRFVTKMLLELLGVCLLLLIVLIVHFHEWPSLRTMRVMKRLPGPPEAFFFGHSPTLAKIKFEDLLVFFGQLIREYPPVFKIWTLGIPIVVLTEPEDVEVLLSSVQYIKKGIDYDAFLDWLNEGLLVSTGSKWQYRRKLLTPAFHFKILEHCIPIFNTNGALLCNELLETKNEEIEIEPFISKCTLDIICEAAMGCSLRNLPDKGEQYVRATKKMNNLIIERILTPWLAKDWLFHLSPTGREQKKIVDILHSFTQMIIEERKTQWRKSSKEDLEDDEYGRHRPKTFLDCLIELSEKDSESLTLTDIREEVDTFMFEGHDTTSAAITATIFMIGHHPEVQERIHEELDDVFGGSEREITMDDLHYLTYLERVIKESLRLFPSVPMMTRRLQTDLQLNSSQHMVPSTANVIVFSYWLHRNPKHFPEPDLFNPDRFLPDEVPRRHPFAYIPFSGGPRNCIGQKFAMMEMKIVLATVMRKVRMESITKMEAIKLIPAVILRPQKPFKIKVSPRTK

 

>CYP4CG1 Contig_1538_FL Manduca sexta (tobacco hornworm)

sent to genbank

1 aa diff to partial seq CYP4CG1 (L38672), renamed CYP4CF1, 48% TO CYP4M7

MFSFVLIVLFISVIIFGLYIRYSHAGRLMAKIPGPKGFFIIGNTLAIVRERXDLFNYGRE

LYAKYGKLSKITGFHIRGVNVYSPEDAETILSSPRYNEKQIPYIFLEPWLGDGLLISKGE

KWHDRRKMLTPAFHFNILKKFTKVFCEETEEFLNLVKEETKKDKTEIMPLIMKSTIRIMC

ETSMGTSMDEDIHTVLKKYLKAIHVLGECVVYRFSRSWFYTNFTFFLSKVAGIQRRAVKD

LHIFTKQIIQERRRYRKQGKIVDINDDDEVYGKKSRMAMLDLLLEQEKLGNIDEDGIREE

VDTFMFEGHDTTSMLLTFMIMRIANEQHVQDLIYEEMQRIFGDSRRSPTMEDFSEMKYLE

CCIKEALRLYPSVPFMSRILNEEVTLSGYKVPEGTQCNIHVFDIHRLEEYYPEPEKFVPE

RFLAENKSTRHPFAYIPFSAGPRNCIGQRFAMLEIKTMMXGLIRRFHLQPVTKHEDVAFL

SDLVLRPKYPIYVRFRERKM

 

>CYP4CG1 formerly CYP4M3 Manduca sexta (tobacco hornworm) L38672

TSMLLTFMIMRIANEQHVQDLIYEEMQRIFGDSRRSPTMEDFSE

MKYLECCIKEALRLYPSVPFMSRILNEEVTLSGYKVPEGTQCNIHVFDIHRLEEYYPE

PEKFVPERFLAVNKSTRHPFAYIPFSAGPR

 

>CYP4CH1 Acyrthosiphon pisum LOC100167623p SCAFFOLD15279:22883..50385

MWYLTVITPIAILVVIIMILRLEGRRKRVLANKIPGPDGSIFIGMLPLFLQGPEQLILKGLKVYQKYEKSLFKVWVLNNL

YIVLTRPEDIEMVLTNPKLQKKSKEYLVLQESIMGQGIFSIDDIKKWKSNRKMVSGGFNFTIIKSFIPIFYEESNVLNDI

LKQKCDLKSNECDISVPVSMATMEMIGKTALGVKFNAQNGGRHRFVENLQTAMHAWEYRISHP

WYLSKTLFQLSSVKKKHDQSQKIINEFTDEIINKKLDELNQNANN

KNKVETDDEDVCRKTKTVIEILLGNYHEMSHEQIRDELVTIMI

GGQETTAMANACAIFMLAHHPDVQNKVFEELQSIFSTGDHNRPPTYEDLQQMEYLERVIKETLRIFPPLPVFGRSLEEEM

KIGEHLCPAGSTLMVSPLFVHSSGQYYTDPEKFNPDNFLPDTCRGRHPYSFIPFSAGYRNCIGIKYG

ILQMKTVISTLVRK

NTFSPSERCPTPKHLRVMFLSTLKFVDGCYVKIVPRTS*

 

>CYP4CH2 Acyrthosiphon pisum LOC100167777p SCAFFOLD9588:3006..11080

YEKSMFKAWLFNKLYIVLTRPEDIEFVLASPKFLRKAKEYMVLQQSIMGQGIFTIEDINKWKINR

XXXXXXXXXXXXXXXXXXXXXXXXVLAEILGD

NSDSTSKECDISVPVSMATMEMIGKTALGVTFNAQKGGCNRFVENLLTAMHAWEYRITHPWYLSSTLFQFSSIKQKHDHS

QKIINEFTDEIIKSKIVEINNSGSENGVNADDDDIGRNTKTLTKIFLENPHENMTLEQIRDELVTVMIGGQETTAMANAC

VVFMLAHHQDVQDKVFKEQESIFSIGDRNRPITYNDLLQMEYLERVIKETLRLFPPLPVFGRDLNEDTTIGDHLCPAGST

LIICPLFLHSSPQHYGSTAHGPDAFDPDNFLPEACHERHAYAYIPFSTGPRNCIGIKYAMLQMKTVASTLVRHHRFLPSD

RCPTPDQLRLVFLTTLKLADGCYVKVEPRRPQ

 

>CYP4CH3 Acyrthosiphon pisum LOC100163721 SCAFFOLD9588:25696..30352 (+ strand)

MXXXXXXXXXXXXXXXXXILVITIVILILKGRKNRILANRIPGPNGWFLVGMLPLFLQGPEKLIKNILREYRIYEKHIVK

FWLFNNLYIVLTRHQDIELVLGNPKFLRKSKDYMVLQESIMGQGIFSIDDIEKWKNNR

KMVMKGFNFTPTKSFIPIFYQEAN

VLAEILQEKCVLKSNECNISGPVSMATMEMIGKTALGVTFNAQTGGCNQFVEHLQTAMHAWEYRVTHP

PWYLNNTLFRFSSVKREHDRSQKIINKLTDEIIKQKIIELSQNINNS

EKKIESDNEECCQKSKTVLEILLGSSHKMDHEQIRDEIVTVMI

GGQETTAMAITCTIFMLAHHQDVQNKVFEELQSIFVNGDRNVPPTYKDFQQMKYVEMVIKETLRLFPPLPFLGRRLDEDM

KIGEYMCPAGAALIICPIFVQSSPLYYTDSEKFNPDNFLPDACGSRHSYAYIPFGAGLRNCIGIKYAMLQIKTVISTLVR

K IKFSPSERCPTPEDLRLMFLMTLKLVDGCYIKMEPRT

 

>CYP4CJ1 Acyrthosiphon pisum LOC100166760.pro SCAFFOLD7010:99236..111631

MIFSNVIGALTSDSNTQWMALLSLVVLGVYFLFSDRFSENRGRQISLLPSITRSQWTSLILSLKLASFGPRDILPYFDNV

IKKYGSLIHLKIIARHYIIINDPDDIKVLLSSVQHITKGPDYEMLEPWLNKGLLTSTDQKWHSRRKLLTNTFHFKILETY

VPSLNKHSRSLVKNLINASDNGKSIADIDSHVTLCALDIVCETIMGVNLRTQEGKSMNYVKAIKNVSQILIKRIFTFWYW

NEIVFNLSSIGREFRKSLKLLHDFTENVIRERRKILENVEQKKVDENGKKRIYSFLDLLVGVSKENPGAMTDKDIREEVD

TFLFEGHDTSSIAITMAIIHLGLDQNIQNLVRDELYEIFGDSDRDATMEDLKAMTNLERVIKETMRLYPSVTGITRTLKQ

PLHLDKYTIPSKSVMVVVPHLLHRDKNIYPNPEKFDPDRFLPEQCNGRHPYAYIPFSAGPRNCIGQKFAMYQMKTVLSTI

LRYTNVETLGTQKSIVISTQLILRADYLPSGVRDFPVKSFSLV

 

>CYP4CJ2 Acyrthosiphon pisum LOC100164743.pro SCAFFOLD7010:120446..129462

MLETNVYNFVLIPLAILISYAIWSRLRKPLEYRQISSHVPSVTKNLWSELLFSCSIAMKHPRDLLPFFMEIFLNNGPVVH

CNITGRSYVLLNDPDDIKILLSSTQYINKGPEYKMLKPWLNDGLLLSSGLKWQNRRKLLTNTFHFKTLDMYNPAVNKHAK

VFTKKLLEACEDDKEISVMEYVTLCSLDIICETIMGTEMNAQKGKSIQYVYSIKSACRSVIDRVFKFWLWNDLIYRISES

GRSFFKSIRVLHDFTDSVIKRKQSLLKTSGNTIVQPESKPAEKRKTKSFLDLLLDVLKDNPDQMTIKDIREEVDTFLFEG

HDTSSISMTMTLLLLGMHQDIQDRAREELHSIFGDSDRDATMEDLNAMRYLDAVIKESLRLYPSVPSFTRELETTLQLEN

YKIPPMTTMVIFPYILHRNENIFPKPEDFIPERFLDEDNKSKFLFGYIPFSAGARNCIGQKYAMNQMKTVVSTVLRNAKI

VSSGCKEDIKISMQLLIRIESLPKVIFRPL

 

>CYP4CJ3 Acyrthosiphon pisum LOC100162661.pro SCAFFOLD7010:131616..139794

MIEVNFYSVVLVPLAGLISYAIWSRLRMPVEYRQISSHVPSVTKSFWSEMVLSWKLAMLQPK

DILPFVTDLFKENGPVVHFNLSGRSYVLLNDPDDLKVLLSNTQYIKKGPEYEMLKPWLNEGLLLSSGQKWHNRRKLLTNT

FHFKTLDMYNPSINKHSRILVDKLFEASANDDKEISIAEYVTLCSLDIICETIMGTEMNAQKGKSAEYVHSIKSACKSVI

ERIFKFWLWNDLVFRMSGSGQSFFKSIKILHEYTDNVIKSKRASLNNSGIEKIRSDSKFEKTKKKSFLDLLLNVLNDTPD

QMSDRDIREEVDTFLFEGHDTSSIAMTMILVLLGMHPEIQDRARDELRSIFGYSTRDATMEDLNAMKYLEAVIKESLRMY

PSVPAFTRELDKPLQLNKYIIPPMTTITVYPFILHRNEDIYPDAEEFIPERFLDEENKAKFIFGYLPFSAGARNCIGQKY

AMNQMKIVVSTILRNAKFESLGRKEDIQISTQLIIRIESLPKMKFYKL

 

>CYP4CJ4 Acyrthosiphon pisum LOC100160629 SCAFFOLD7010:141476..155172

MIEVNFYSVVLMPLAGLISYAIWSRLRMPVEYRQISSHVPSATKTFWSEMVLSWKLAMMQPK

DILPFLTDLIRNNGPVVHFNLSGRSYVLLNDPDDLKILLSNTQNIKKGPEYEMLKPWLNEGLLLSSGQKWHNRRKLLTNT

FHFKTLDMYNHSINKHSRILVDKLLDASANSNKEISIADYVTLCSLDIICETIMGTEMNAQEGKSVQYVHSIKCACKSVI

ERIFKFWLWNDLIYKISGSGQSFFKSIKALHEFTDNVIKSKRALLNNSGIEEMQSDKKTKKKSFLDLLLNVLNDTPDQMN

DRDIREEVDTFLFEGHDTSSISMTMTLVLLGMYPDIQDRARDELHSIFGDSDRNATMEDLNAMKYVEAVIKESLRLYPSV

PGITRELQTPLQLKNYIIPPMTTIAVYPFILHRSENIYPNAEEFIPERFLDEENKAKFQFGYLPFSAGARNCIGQKYAMN

QMKIVVSTILRNAKFESLGSKEDIQISTQLVLRIESLPKMKFFNL.

 

>CYP4CJ5 Acyrthosiphon pisum AUG5s3079g1t1 ?SCAFFOLD3079:13926..21110

DVLPFLSSILKQHGSLVHIHLLGHSYVLLNDPNDIKVLLSSPQHINKGPEYGLLKPWLNKGLLTSGSQKWQMRRKLLTYT

FHFKILETYISSFNKHAQCLTKKLENMASNNQRVSIYTHMTLCALDLVCDTIMGTELRSQEGKSLEYVEAINTVTDITIK

RIFKFWLWNGSIFNLSQIGRDFNKSLKILHTFTENVIKEKRAKLESVNCLETEELSFGKKRVESFLDLLIGISKQNPEKM

TDMDIREEVDTFLFEGHDTSSTAMTMAFIQLGLNQDIQNSVREELYSIFGDSDREATMADLKSMTYLDRVIKETIRLYPS

VPSVTRMLRQHLHIKEYDIPPQTVVVVVPYLLHREEKHFPNPLTFDPDRFLPEHSINRHPYAFIPFSAGPRNCIGQKFAM

YQMKTIISTVIRKMKIETLGSQDDIKISAQLILRPESLPDIKLTKIK

 

>CYP4CK1 Acyrthosiphon pisum LOC100161405.pro SCAFFOLD15733:160611..183325

MNYHDHLTTRSRHCTTTVEEINDVERDDYNRSPLPLSTSGILIRTVEPILATVSLVFDKSFILFACFSKFSLQYFNELYL

FLCQLLVDLHFFRLLLEWHSKFGDTYQLWIGLRPFIAMANADHIQQILKSTVHIDKNLEYNLLLPFIGTGLVTSSGSKWH

TRRKLLSPTFHQNILEGFLPLIEKQMKTLVKVLRKEVNNVNGFDIKPYAKLAALDTIGNTAMGCEINSQENSQLDYVKAL

DELTAIMQKRFITPWLKPNLLFNLTSLSKRQKACIDVIHTFTRKVIKERKDNFKLFNNQTSDANKNEIHYEKKPNRALLD

LLIEVSEDGKVLSDEDIQEEVDTFMFAGVDTTSVTLSWVMYVLGKHPHVQDKIVEELNQKIPNFGDGNLTLNILSSLDYL

GRTIKEVLRLYPSVPFIGRQIYQPLTIGDHTILPGTSIFINVFALHRNEKHFENPEKFDPDRFLKEKKNDRHRFAFVPFS

AGSRNCIGQKFAMIVLKIAVATVIKTYRVKSIDPEEKLGLVGEIVLNALNGIHVTLEERT

 

>CYP6A1      Musca domestica (house fly) L27241

MDFGSFLLYALGVLASLALYFVRWNFGYWKRRGIPHEEPHLVMG

NVKGLRSKYHIGEIIADYYRKFKGSGPFAGIFLGHKPAAVVLDKELRKRVLIKDFSNF

ANRGLYYNEKDDPLTGHLVMVEGEKWRSLRTKLSPTFTAGKMKYMYNTVLEVGQRLLE

VMYEKLEVSSELDMRDILARFNTDVIGSVAFGIECNSLRNPHDRFLAMGRKSIEVPRH

NALIMAFIDSFPELSRKLGMRVLPEDVHQFFMSSIKETVDYREKNNIRRNDFLDLVLD

LKNNPESISKLGGLTFNELAAQVFVFFLGGFETSSSTMGFALYELAQNQQLQDRLREE

VNEVFDQFKEDNISYDALMNIPYLDQVLNETLRKYPVGSALTRQTLNDYVVPHNPKYV

LPKGTLVFIPVLGIHYDPELYPNPEEFDPERFSPEMVKQRDSVDWLGFGDGPRNCIGM

RFGKMQSRLGLALVIRHFRFTVCSRTDIPMQINPESLAWTPKNNLYLNVQAIRKKIK

 

>Cyp6a2 D. melanogaster AC007549 comp(100072-101661)

MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYY

NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFN

LDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMA

RFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMR

MMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGEL

AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVIS

ETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNP

ETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTT

EIPLKYSPMSIVLGTVGGIYLRVERI

 

>Cyp6a2 D. pseudoobscura orth

MLILIYLVIAVGSLVAYLLHRNFQYWKRKGVPHDPPHPFYGNLVGFRKNRVIHDIFYDYY

NKFRTSGSPFVGFFFLQKPAAFIVDTKLAKNILIKDFSNFADRGQFHNERDDPLTQHLFN

LDGKRWKELRQRLSPTFTSGKMKLMFPTVIKVSEEFASVMEEQVPPTQGGAIIEIKEMMA

RFTTDVIGTCAFGIECNTLRTPVTDFRTMGQKAFTELRHGQLLTFFIFSFPKLARRLRMR

IMPEDVHQFFMRLVNDTVAVREKENFKRHDFMDMLIEIKQKGSVTLENGEVMKAMDIGEL

AAQVFVFYLAGFETSSSTMSYCFYELAQHQDIQDKLRS EVLTVLAEHDGKLTYECVKEMRYLDQVFS

ETLRLYTLVPHLERRALSDYVVPGHPDLVIEKDTQIIIPACAYHRDENLYPDP

LRFDPDRFSAEQVAARDSVEWLPFGDGPRNCIGMRFGQMQARIGMAQLLSRFKLSLCDKT

EIPLKYEPKSFVLGSIGGIYLRLERI

 

>CYP6A3 housefly U09231

MMCCPLVVLLLGSLTLFVVYLYRLYTYWQRRGILQETPLPLLGN

FKGLGTSHHLRDIYQRLYGEFKGKAQMVGSYMFMQRSALLLDLDLIKNVLIKDFAYFQ

NRGGFHNVEDDPLTGHLSNLEGEQWRALRAKLTPVFTSARMKYMFPTVVRVGEILSDT

IRGEISRESPKDQVLEIKDFCSRYTTDVIANCAFGIECSSLTDPRAEFRQRGIDIFTK

PRHHPLLLLLIITNPKVAQRLRLKLFPDELTEFFMSVIRQTVEYRERNQVKCNDFMDL

LMEIRAKEGEEGLSFEQMAALTFDFFLAGFETSSTTMAFTLYELARNPEIQEKLRTEI

LDILKDSNDELSYEALQKMSFLEQSISETLRLYPVLATLVRVANRDYPVPDSQHIIEK

DIQVVIPVHAIHHDPEYYENPEEFNPNRFAAEECERRHSSTYLPFGDGPRSCIGMRFG

KMQTKIGLVSLLRHYRFECCPLTEIPLELDKKSFFVGSKNGIFVRVVDLKCEK

 

>CYP6A4 housefly U09232

MFALLLLFCICLLVGYLLNLYTYWERQGVPHETPIPLLGNFKGI

GSKYHVRDINQRLYRRFKGKAPFAGVYMFVRRAALVIDLNLIKNIMVKDFANFHDRGG

LSNVEDDPLTGHLVSLEGEQWRAMRTKLTPVFTSARMKYMFPTVVKVGENFARTVGEM

LEEGSGTQILEIRDLCARFTTDVIGNCAFGIECNSLKDPNSEFRLKGKEIFSRPRNGP

LLHLFAITNDKLASKFHMKILPDDITEFFMSLVRQTVEYRVKNEVKCNDFMDLLIEMR

AKDEELARASKGIDLSHGLTLEQMGAQAFVFFFAGFETSSITMTFALYELARHQEVQD

RLRKEILESLRENKGELTYEAINNMEYLDRVVAETLRFYPPLATVVRVTKNDYQIPNT

RYVIKKDIMTIIPIHAIHHDPQYYAEPERFNPDRFTPEECLKRHPSAYLPFGDGPRNC

IGLRFGKMQVKVGLVSLLSHYRFEFCPLTEQPLQFNNHHMMVAPKNGVYLKVTPV

 

>CYP6A5 housefly U09343

MLSLVQTILLAFVAVLIGYLYNIYTYWKRRGVVYERPWPLFGNF

WGIGTKYHIREINQRLYRKFKGQAPFVGTYMFVRRASLIIDLDLIKNILIKDFANFHD

RGVFNNVEDDPLTGHLVALEGEQWRAMRTKLSPVFTSARMKYMFSTVVRVGENLHRVM

GEMLSERSDQILEIKDVCARFTTDVIGTCAFGIECNSLRDPDAEFRQKGKDIFGKPRH

SPLVQIFTITNSNLAKKLHMKLFPDDVADFFMSVIRQTVEYRQKNNVKCNDFMDLLIE

MKAKNEEEAKAGKGIDLSLGLTLEQMAAQTFVFFLAGFETSSTTMSFALYELAKHPEV

QEQLRKEIRESLEKTKGELTYESLHEMQYLEQVIAETLRIYPVLPNLIRLTKSDYQVP

NTNHVLEKGIMTVIPVHAIHHDPEYYDNPEEFRPSRFTPEECLKRHPSAYLPFGDGPR

NCIGMRFGKMQTKIGLVSLLRHYRFECSPLTEIPLEMDKRNFLAATKNGIFLKVIPL

 

>CYP6A6 housefly U09344

MFISETLRLYPVIPTLLRTTTSNYRIPNSDCIVEEGTQIAIPVY

SIHRDPAYYDQPNEFNPDNFEPKRCEERHSCAYLPFGDGPHNCIGLRFGKMQTKLGLV

ALLRKFRFEICPQTELVMDKKNFLLTTESGVDLKVTIL

 

>CYP6A7 housefly AF240400

MAIFMILLYILLALIAYVVISFRKRSSYWKSQGITNEEPHPLLG

NMVGLGKSKSFGDVWQEYYEKFKGSGPFLGFYFFHRPSAFLLDPALIKNVLIKDFNKF

TDRGFFHNPKDDPLSGQLFLIDGNKWRRMRNKLSPTFTSGKMRFMFPIVTQICEEFVE

VLAKAAEENPVVEMREMLARFTTDVIGSCAFGIECNSLKNPNAIFRVYGRKGLEEQRH

GRLVMAFMNSFPELSKALKMKLFPEDVIQFFLRIVRETVEYREKNNVRRNDFMDMLID

LKNKKLIKSEHGDDLTNLTMEEITAQAHVFFNAGFETSSTTMGFALYELAQNQEMQD

 

>Cyp6a8 D. melanogaster AC020447 comp(122688-124264)

MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ

DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH

LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA

RFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMV

RTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEV

LAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLD

ETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEP

FEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKT

PNPLVYDPKSFVLGVKDGIYLKVETV

 

>Cyp6a8 D. pseudoobscura ortholog

MGVTYVLLQVAVALLAIVTYYVYRRLSYFKSRGIPHDTPHLILGNMQGVFTKRNVHEILK

KYYEKYRESKVPFVGFYFFQKPSAFILDLDLAKHILIKDFSNFSDKGLFYNEKDDPISAH

LFNLDGPQWKVLRNKLTSTFTAGKMKFMYPTVVSVAEEFIDVMHEKMKQNSVLEIRELMA

RFTVDVIGTCAFGIKCNSLRDENAEFLRFGKRTFVDKRHGSFLTGFMTSYPKLARRLRLV

RTPTHIRNFYERIVHETVAMREKENIKRNDFMDLLIDMKNQKVKLENGDLVDGLTIDEIL

AQAFVFLIAGFETSSSTMGYALYELAKQPHIQDKVRAEVEEVLEQHEQKFTYESTKDLKYLEQVIF

ETLRLHTIVPHLDRMAHKRYVVPGHPNFVIEAGQSVIIPASAIHVDPNIYPDPY

KFRPERFSPEESAKRNSLAWLPFGDGPRNCIGLRFGKMQTTIGLALLIKNFKFSTCPKTP

DTLSYSPKSFVLAVDGIHLKVEAV*

 

>Cyp6a9 D. melanogaster AC020447 comp(115043-116610)

MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWM

DYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQL

FLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILAR

FTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKI

TLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAA

QAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVIS

ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT

FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTI

PIVYSKKTFLISSETGIFLKVERV

 

>CYP6A10 Ceratitis capitata (Mediterranean fruit fly) U78795

MSVLQFLPGRVLRLFGYGFYLLRKRFMYWEVRGIAYEKPNYLLG

NLNGVRSTRSCLEIWMSTYKKFKGTGPFCGFFWFQRPAAFILDPKLAKSILIKDFNNF

VDRGFYNNPEDDPLTGQLFLLDPHRWRVMRNKLSPTFTSGKMKYMSPAVCRVSEEFVR

VVSEAIKEEPILEMRDYLARFTTDVIAPCAFGIDVNSLKNPNEEFRQMGKRVFSDLRN

GRIGLAMINSFPELCRRLHVKQTPDHITEFYMRVVRENIEYRERNKIRRNDFFDMLLD

LKNNKLMKSEDGHDMSITVEELAAQAFVFLVAGFETSSTTMGFALYELAQDEEIQQRV

RTEVNEALEKHNGEFTYDCMKDMVYLDQVISETLRLYTVLPILNRECMEEYPVPGHPG

FVIGKGMQVIIPAAPFHRDADIYPNPNTFDPDNFSPDRVAQRDGVYWLPFGEGPRNCI

GMRFGQMQARVGLALLLKNFKFSVCGKTPIPMKYNKVNFLLQSEHGISLYIEKV

 

>CYP6A11 Ceratitis capitata (Mediterranean fruit fly) AF028002

LRFGLMQTRVGLAHLLKNFKFSVSKKTQIPIQYSKTTFVSMAEGDIYLRVEKVLV*

 

>CYP6A12 Ceratitis capitata (Mediterranean fruit fly) AF028003

KRFGEMQARIGLAMLIENFKFSVCDKTTIPIKYDKKSFLIASESGIFLKVERV*

 

>Cyp6a13 D. melanogaster AC020451 3757-5238 AC007085 126189-124714 no introns

MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIY

RKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFL

DGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDVI

GSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPEVS

EFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTS

STTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPI

LPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKAR

HPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRNFLISTQ

EGVHLRMEGLERP

 

>CYP6A13 D. pseudoobscura ortholog 77% to 6A13 no introns

MWTLLALVLVAGALIYSRLLEHYDYWRRKGVAGEKPVLFLGNMSGLGKGL

HWTDINRRIYEKFSKTERFCGYFTFFSKAFFVMDLELIKKITISDFSSFA

DRGLFHNVKDDPLTGNLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPTMLS

VGEKLTQACELQVGEIEAKDLCARFSTDVIGSCAFGLECNSLNDPNSEFR

RMGRSVTTNPLHTGMVQGFMFAQPKLARMLHMRLFRPEVSEFFLETVRQT

LAYRKRENVQRSDLIQLLMDLGEEGTKDGLSFEQIAAQAMVFFLAGFDTS

STTMSFCLYELALNPDVQDRLRSEILEVLAKNNHQLTYESIQEMPYLDQV

VAETLRKYPILPHIVRQTTKKYDVPDSRLTLEPGMRVMIPVHSIQHDPEL

YPEPENFDPSRFEPDQVKARHPMAYLPFGEGPRNCIGERFGKMQVKIGIA

YILRDFQFRQSERTQIPLKFSSRTFLIGTQEGIHLIMEKLAAP*

 

>Cyp6a14 D. melanogaster AC007085 33266-34850 frameshift at amino acid 73

MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIY

KKFKGQGPIAGMY

TFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFAL

EGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCA

RFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIK

VLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTL

EQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVL

AQMTYLDQVLS

ETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIY

PEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS

NRTDVPLIFSKKSFLLTTNDGIYLKVERV

 

>CYP6A14 D. pseudoobscura ortholog no frameshift as in D. melanogaster

MALALAYNFYRNTYSYWERKGVPNERPLPLIGNVKGIGTKYHFRDINQRI

YDKFKGVAPFAGMFTFFKRSALIIDLDLIKQVLIKDFQYFQDRGVFNNVR

DDPLTGHLLTLEGDEWRSMRQKLTPVFTSGKIKHMSGVVVEVGHRLAAAM

DKAVSAAKVDDGDVEIKDICARFTTDVIGTCAFGLECHSLSDPKAEFRSK

GRMIFEKPRHSPIVQFFVFTNAKLAKKLRMKLLPDDVSEFFMNAVKNTVD

YRMKNGIKRNDFLDELIELRAENQEAAKHGKVIDLSHGLTIEQMAAQAFV

FFLAGFETSSSTMAYCLYELAQHPDIQRRVREEIDAVLKNVEGGEITYDA

LAEMNYLEKVLA

ETLRKHPIVPQLIREANQNYKVPNTDITIDKGTTVLIP

VHSIHHDPEIYPQPESFAPSRFEADQVKSRHPMAYLPFGDGPRNCIGLRF

GKIQAKIGLVSLLRRFKFGISKRTEIPLILDTRSFPLTTKNGIHLRVERI*

 

>Cyp6a15p D. melanogaster pseudogene on AC020451 2595-3373

AFTVTNSKLAKKLKMKILRDDLTDFFLSVVKPALSGMTLWTSPPSGGRSSRQGGSKFDLS

HNWTLEQMAAQAIVFFLAGFETSSSTMSSCKYELALQPEI*NQIRDEIERVLEGNAITYD

ALAKINYPEQVLS

ETLRKH

QLIKFLLETQESFRVRNTELIVEKGTSLLIPVHSVHYDPHLYPHPKLFDSSR

LKAYKSNSRHPFAYLPFGTFGPRSCIGLRFGKMQAKIGIVSLCQRFKFGDSDLTDIPL

 

>Cyp6a16 D. melanogaster AC004721 comp(2956-5070) note 1 extra intron

MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETYD

AFRGSAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTANLFNLQGEE

WRNLRTKLSPTFTSGKMKYMFGTVSTVAQQLGGTFDELVGSQ

GAVLELHDLMARYTTDVI

GSCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLGLPVRILHPD

ITKFFNRIVRETVELRERENIRRNDFMDLLLDLRR

KGLTMEQMAAQAFVFFVAGFETSSS

NMSYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMPYLDQTIT

ETLRKYPALSS

LTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHEFRPERFAPDACRE

RHPTAFLGFGDGPRNCIGLRFGRMQVKVGLITLLRRFRFSLPPGSPTQLKVTKRNLILLP

SDGVRLQVDPVESRLM

 

>CYP6A16 D. pseudoobscura ortholog Contig4092_Contig573.216 61% to 6A1

MGFVLILLTSLLSGVLGYLRCKYNYWQINGVKQLRAHFLFGHFFKMKSVR

LTELLQETYDAFKGSALVAGTYVYLRPIAVILDLDLAKTILDKDFDKFVD

RRNFHKEPLMDNLFNAQGEEWCTLRKKLTPMFSSGNVKCIFGTITEVARN

LEESFQELVGTQGGVLDVHDLLDRFSMDASATCAFGIQCSSLKDPQVEFR

VHGRKIFHHSGDGIRWRIFKFLYWSVLAKLKLSVRFYDKIIADFFTRIVR

EKLELRQDLRHNIKRNDFLELLMASKDDNELTLEQLTAHAFDFFVSGYET

SSSTMSCALFELAKHPSVQQKLRNEITGILHKHAPNLTYEAVQEMRYLDQTIT

ETLRKYPALASLTRIAAEDYTVPTASGDIPLVLDKGTIVHIPVRAIH

YDSEIYPEPTIFRPERFETSTCLQRHSMAFLGFGDGPRHCIGQQFGRMQI

KIGLIALLTKYQFSSVPGFPDELPISKGNVILRPRQGVLLKVHRVPE

 

>Cyp6a17 D. melanogaster AC020447 109264-110826

MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYF

KYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSI

EGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARY

TADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLN

IQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFI

FFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVM

ETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPER

FTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIV

VKNILISAENGIHLKVEKLAK

 

>Cyp6A17 D. pseudoobscura Ortholog of D. pseudoobscura

MSLVLALIAIVVSLVLFAARRRHGYWQRRGIPHDVPHPLFGNIGDWPKKRQIAVIFRDYY

RKYKNANYPFAGFYFFFTRSAVVTDLDLVKRVLIKDFNHFENRGIFYNEIDDPLSATVFS

IEGQKWRHLRHKLTPTFTSGKMKHMFPIVVKVGEEMDKVFSNKVGDGKVLEIVDLVARYT

ADVIGNCAFGLNCNSQQNPNADFVTFGKRALRERRYKGLLDFFIFGFPKLSRSLRLKLNV

QEVEDFYTKIVRDTIDYRLKTKEKRNDFMDSLIEMYQKEQEGNSDEGLTFNEILAQAFIF

FVAGFETSSTTMGFALYELAQNQDTQDKLRNEINDVLAKHNNQFTYEGIKEMKYLEQVVM

ETLRKYPALGHLTRKTRLDFSPEDPKNFIAKGTTVVIPALGIHYDPDIYPEPEKFKPERF

TEEAIASRPACAWLPFGEGPRNCIGLRFGLMQTCVGLAYLIKGYRFSVAPETQIPIKFVL

KSFLLSAENGIYLKVETVSK*

 

>Cyp6a18 D. melanogaster AC008285 85740-87319

MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQ

EYYNKYRNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH

LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVA

RFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLC

RNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEI

VAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYECIKDLKYLDQVIN

ETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEP

NEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSAT

PDPLTFDPHSAILLGIKGGIQLKVEAI

 

>Cyp6A18 D. pseudoobscura ortholog D. pseudoobscura ortholog

MGVTYVLLQVAVALLAIVTYYVYRRLSYFKSRGIPHDTPHLILGNMQGVFTKRNVHEILK

KYYEKYRESKVPFVGFYFFQKPSAFILDLDLAKHILIKDFSNFSDKGLFYNEKDDPISAH

LFNLDGPQWKVLRNKLTSTFTAGKMKFMYPTVVSVAEEFIDVMHEKMKQNSVLEIRELMA

RFTVDVIGTCAFGIKCNSLRDENAEFLRFGKRTFVDKRHGSFLTGFMTSYPKLARRLRLV

RTPTHIRNFYERIVHETVAMREKENIKRNDFMDLLIDMKNQKVKLENGDLVDGLTIDEIL

AQAFVFLIAGFETSSSTMGYALYELAKQPHIQDKVRAEVEEVLEQHEQKFTYESTKDLKY

LEQVIF

ETLRLHTIVPHLDRMAHKRYVVPGHPNFVIEAGQSVIIPASAIHVDPNIYPDPY

KFRPERFSPEESAKRNSLAWLPFGDGPRNCIGLRFGKMQTTIGLALLIKNFKFSTCPKTP

DTLSYSPKSFVLAVDGIHLKVEAV*

 

>Cyp6a19 D. melanogaster AC020447 113084-114646

MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGELWRTMPLAGILKRTY

LKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTNNLA

TIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSR

FTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQF

LLPSVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAF

VFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQDLFYMEKVIN

ESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPE

RFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNFRFELHPKTPVPMKY

TINNLLLGSEGGIHLNITKVVRD*

 

>Cyp6a20 D. pseudoobscura Probable ortholog 71% to 6A20 65% to 6A19.?

MAIIIVLLVGVISLAVWWVHQNFSYWKRRGIPHDPPNIPKGNTSELMKTR

QIADLFRETYFKYKGKTDGPFVGFYLYLKKIAIVTDIDFVKTVLIREFDK

FHDRGLFHNEKDDPLTNHLVAIEGQKWRQLRQKMTPTFTSGKMKIMFPTV

LEIGNEMIRVFAEKIGPQPLNVADLVSRFSADVIGSCAFGLECNSLRNPN

AEFVTMGKAAITERRYGKTADLFFFGAPKLAAKLRMKETVQKVEDFYMKI

VRETVDYRLKNNVKRNDFMDMLIDMKINYDKGNKQDGISFNELAAQAFIF

FLAGFDTSSTSLGFALHELAVNQDIQDKLRTEIDTVMAKHNGQLNYDSMR

ELTYLDKVID

ETFRKNPVVGHLIRICTQRYEHPNGKYFIEPGTGVVIPTL

GIHHDPEFYPEPEKFKPERFDEDQVLQRPPCTFLPFGDGPRTCIGLRFGR

MQIVVGLALLIHNFKFEVHPTKTTVPLKFKVTDVLLCSEGGVHLNVSKVPR*

 

>Cyp6a20 D. melanogaster AC020447 117416-119045

MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFADIFKRTY

NKLR

NKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDRGVFHNERDDPLSANLV

NIDGQKWKTLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVAR

FTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELAAKLRMKA

TVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAF

IFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVID

ETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPE

RFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVVPLE

YRTDDFLLSSKGGIHLKVTRV

 

>Cyp6a21 D. melanogaster AC020447 comp(120585-122149)

MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWT

SYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQL

FLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLAR

FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKM

TAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAA

QAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYL

DQVVS

ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT

FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTI

PMTYNKEMFLIASNSGIYLKAERV

 

>Cyp6a21 D. pseudoobscura Contig3531_Contig5436.185 78% TO 6A21

MAVGVGALLLWTLVALVVYLLLKWLLGRQYWQNLGIPCEEPHWLLGSMWG

LRTTRTFNDVWTDYYKKYRLSGPFAGFYWFQRPAVFVLEPSLAKLILIKE

FNKFTDRGFFHNPEDDPLSGQLFLLDGHKWKSMRHKLSSTFTSGKMKYMF

PTVVKVSHEFTEVFGQMADKSPIVEVRELLARFTTDVIGTCAFGIDCSSL

KDPDAEFRKMGRRALTENRHGSLGIAFLNSFPKLSRKLHLKMTAEPIEQF

FMRIVKETVKFREQNQIRRNDFMDQLIDLKNNQIIKTESGDNINLTIEEI

AAQAFVFFAAGFETSSTTMGFALYELAQHPDIQQRVREECQEVIQKYGGE

LTYESMKELVYLDQVIS

ETLRLYTVLPVLNRECLEDFVVPDNPKYVIKKG

MPILIPAGAMHRDERFYPNPDAFNPDNFSPERVKNRDSVEWLPFGDGPRN

CIGMRFGQMQARIGMAMLLKDFKFSVCDETAFPMKYDLESFLIASKTGIS

LRVERV

 

>Cyp6a22 D. melanogaster AC020447 106987-108653

MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIY

EKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR

IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMAR

YTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQ

IHQDITDFYVGIVRETVKQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGF

DTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIA

ETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQ

LAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNIL

LCPANGIYLKVQQLSQMSS

 

>CYP6A22 D. pseudoobscura ortholog Contig3531_Contig5436.181 82% to 6A22

MLDVIALLLITLAIGFWYVRTRLSYWARRGIGHVRPTFPMGNMDGLRRTK

HFKDIVTPLYERFKDSGAPFAGIYMMLRPVVLVLDLDLAKEVLIRDFANF

EDRGMYHNERDDPLTGHLFRIDGPKWRPLRHKMSPTFTSGKMKFMFPTIC

EVGVDLAEVCGELAANAICGILEISDIMGRYTSDVIGRCVFGLECNGLRN

PEAQFAVMGRRAFTERRHNQLIDGFIESFPDLARRLRMCQIHQDITDFYL

GIVKETVKLREEQGIVRNDFMNLLIEMKHRGELTLEEMAAQAFIFFAAGF

DTSASTLGFALFELARQPQLQDKLRQEIDAALQLHQGQFTYDSMQELRYMELVIA

ETLRKYPPLPHLTRISKNLYTAKGNRHFYIEPGQMLLIPVYGIHH

DPAIYPEPHKFIPERFMGDQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTS

IALVNLLRRFHFSVCPRTESKIEFVKSNLLLCPANGIYLKVQEISKLK

 

>Cyp6a23 D. melanogaster AC020447 111145-112718

MSLLLTLIALLVSLLLFMARRRH GYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYY

TKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS ATLFS

IEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTT GEGQVLEIVDLVAR

YTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKL

NVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF

IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVM

ETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPE

RFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKF

VVKSILLSAENGIHLKVEKLSK

 

>CYP6A23 D. pseudoobscura ortholog Contig3531_Contig5436.183 76% to 6A23

MSLVLALIAIVVSLVLFAARRRHE

YWQNLGIPCEEPHWLLGSMWGLRTTRTFNDVWTDYYKKYRLSGPFAGFYWFQRPAVFVLE

PSLAKLILIKEFNKFTDRGFFHNPEDDPLS

ATVFSMKGQKWRHLRHKLTPTFTSGKMKHMFPIVVKVGEEMDKVFSNKV

GDGKVLEIVDLVARYTADVIGNCAFGL

NCNSQQNPNADFVTFGKRAIGERRYWGLLDFFIFGFPKLSRSLRLKLNVQ

EVEDFYTKIVRDTIDYRLKTKEKRNDFMDSLIEMYQKEQEGNSDEGLTFN

EILAQAFIFFVAGFETSSTTMGFALYELAQNQDTQDKLRNEINDVLAKHN

NQFTYEGIKEMKYLEQVVM

ETLRKYPVLAHLTRKTQADFSPEDPKTFIAK

GTVVVIPALGIHYDPDIYPEPEKFKPERFTEEAIASRPACTWLPFGEGPR

NCIGLRFGIMQTCVGLAYLIKGYRFSVAPETQIPMKLILKSILLSAENGI

YLKVKKVSK*

 

>CYP6A24 housefly AB050019

METSGVLIYLILAIASAVVYLLRRNLSYWKRLGIPHEEPTALMG

NMHGLRTQRCMGDILADYYRKFKGCGPFAGIFNGQRPGVVLLDKQLIKQVLIKDFTQF

TDRGLYYNEKSDPLTGHLFFVDGDKWRSLRNKLSPTFTSGKMKYMYPTVLEVAERFME

VLAQKVRENPIVDVRDMLGRFTVDVIASVAFGIECNSLRNAEDKFLQLGRKSIEVQRH

NALIMTLIDGFPRLSRMLGMRTLPQDVHEFFMQTIRETVEYRERNKIQRSDFLNILIE

LKNTVDDKLGLGGMELEELAAQVFVFFLAGFETSSSTMAYALYELAQNQQIQERLREE

INEAFEGDTKPSYETIMNLSYLDQVISETLRKYPILPFLNRQALNDYVVPGHPKFRIP

KGTPIFIPVMGIQHDPEFYPQPDEFDPERFSPDMVKQRDSIEWMPFGDGPRNCIGARF

AKMQTRLGLACVLKYFRVVVCPKTPLHLTFQAKPLVLTPRHDVYLKLEAI

 

>CYP6A25 housefly AF240401

RFTTDVIGYCAFGIECCSLKDPQQLFYIMSNRALLENNLGSLGV

AFRGSFPKLARRLHMKDTVADVENFFLGTVRETVRYREENSIQRSDFMNLLLELKNNR

VIKNETGDEFVNLTFNEIAAQAFLLLVAGSETSSNTMVFALYELALHQEVQDRARAEV

QRVFEACNGEMVYETMSQMKYLKQVIDETLRLHTPLPVLNRHALEDFPVPGHPKYVMR

KDMPVIIPAICLHRDEQYYPNPDVFNPDNFTPEQVALRDPVLYLPFGDGPRNCIGLRF

AKMQMMVGLSLLLSKSKFTICERTPVPMTYLP

 

>CYP6A26 Drosophila simulans AY489265

MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMV

GFRKYRVMHDFFYDYYNKYRKSGYPFVGFYFLHKPAALIVDTQLAKNILIKDFSNFAD

RGQFHNGRDDPLTQHLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVI

TEQVPATQNGAVLEIKELMARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTEMR

HGKLLTMFMFSFPKLARRLRMRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLI

ELKQKGRVTLDNGEVIEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQD

RLRNEIQTVLEEHEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGH

EKLVIEKGTQILIPACAYHRDEDLYPNPETFDPDRFSPEKVAARESVEWLPFGDGPRN

CIGMRFGQMQARVGLAQIISRFRVSVCDKTEIPLKYSPLSIILGTVGGIYLRVERI

 

>CYP6A27 Lucilia cuprina (Australian blowfly) DQ917666.1

Lc_CYP6A8 revised June 27, 2005 61% to 6A9 64% to 6A32

MIFEILILTLLAIWAYFYKVLRQRYSYWQTLGIACDEPTFLLGNITGIGSKRAFVEIWQQFYDKYKNTGPFAGFYWFFKPAVFVFDPALLKLILIKDFSKFVDRGFYVNEEDDPLSGMLFNLEGNKWRHMRNKLSPTFTSGKMKTMFPIIINISKEFVQVFGKAAKENDIIEVGDLMARFTTDVIGSCAFGLEMSSLRDPNNKFRMMGRKSIVEQRYGRIGIAFRNSFPQLAKKLHMKDTLQEVEDFFMGIVKETVRYREENNVRRNDFMDMLIDLKNNKLMKSETGEELTNLTLEEIAAQAFVFLVAGFETSSTTMGFALYELAQHEDIQQKAREEVKQVLEKHNQEFTYEAMKEMVYLEQIIAETLRLYTVLPLITRYASENYPVPGHSKFVIKKDMLVLIPAGAIHRDERYYPNPNVFNPDNFTADKVAQRDSVLHMPFGDGPRNCIGMRFGKMQALVGLAVLLKNFKFSVCDKTQIPMKYDKNNFLCSSEGGIHLRVNRL

 

>CYP6A28 Lucilia cuprina (Australian blowfly) DQ917667.1

Lc_CYP6A2 revised June 27, 2005 52% to 6A9 63% to 6A1 and 6A24

MEVTAALLYLIIAIVSVALYFVKRNLNYWKDHGIPHEEPHLLMGNFRGVRTKYQIGEIIGNYYKKFKGTGPFAGIHIVQRPGVVLLDKGLIKNVLIKDFNNFVNRGMYYNEKNDPLTGNLFFMDGQLWRVLRNKLSPTFTSGKMKYMYPTVLNVAEKFMQVLKEKVNEDPIVDVRDMLGRFTTDVISSVAFGIEVNSLRNPSSDFPRLGRKLTEQPRHNALIMAFIDGFPNLSRKLGMRIVPEDVHQFFMKTIKDTIAYREKNQIERNDFMKLLLDIKNNKELSGLTIEEMCAQVFVFFLGGFETSSSTMSFALFELALNTHLQDRLREEVNEAYDKQQGFNYECLKNMTYLDQVLSETLRKYPIVPQLNRQAAQDYAVPGHPEYVIKKGMPVLIPVLGIHHDPEFYPNPQEFDPERFDPEVAKQRDPMEYLPFGDGPRNCIGERFGKMQSHLGLANLIRNFRFSTCSKTEVPIKLDPKAVTYSPKNTIYLKVEAI

 

>CYP6A36 Musca domestica (house fly) DQ642009.1

MIALTILLSVLLILIAYIGRLLSEHFNYWRHQGVACEPPNWLLGNLRGLSTSRSFNQIIR

EYYEKYRNSAGPFAGFYWLHKKAVFVLDPELIKQILIKDFNKFTDRGFFSNEEDDPLSGQ

LINLSGNKWRNMRNKLSPAFTSGRMKAMFPLVIKLGYDLVEVVGERLKKHDDVVEVRDLA

AFFTSDVIGTCAFGLNMNCMKNSDAEFLKMGRKALNEQRYGTLGFVLRFSFPDLCRRLHM

KETLDDVEKYFMQIVQETVDYRERENVKRNDFMDMLIDLKNNKLIKDESGEEFINLTFGQ

IAAQAFVFLLAGFETSSTTMSFALYELAQHLEVQQRSREEVENVLKAHNGTFDYECLKEM

VYLEQVIQETLRFYTTIPTINRLASEDYVVGDNPKYVIKKGMAVVIPAAALHRDERYYPQ

PDVFNPEHFAASQVAERDSVLNLSFGDGPRNCIGMRFGKMQAMIGLALLLKNFRFTVCEK

TQIPLKLDKKSIIVAPESGIYLRVERI*

 

>CYP6A37 Musca domestica (house fly) DQ642010.1

MSLSFVLFTIVCGLLAYLVSVLNKKRSYWQSLGIPCEEPHFLFGSLWGIQTSRGFWEIWE

QYYNRFKGMGPFAGFYWFLRPAVFVLDPELVKNILIKDFTKFTDRGFYHNEKDDPLTGQL

FLLDGSKWKNMRNKLSPTFTSGKMKFMFPTVTKVGEEFIEVLNHMVAEEGSVVEVKDLLA

RFTTDVIGTCAFGIECSSLKDPNAEFRVMGKKFLVEQRHNRLVIAFMASFVDLARKMGLK

QTPDDIEAFFMRIVRETVEYREKNNIRRNDFMDMLIDLKNKKLMKSDHGDELTNLSLEEI

AAQAFVFFNAGFETSSTTLGFTLYELAQNQEIQDKARKEVLEKLEKYQGELSYECMKEMH

YLEQILSETLRMYTVLPILNRMALEDYVVPGNPKYVIKKNMQILIPAGAIHRDERYYPNP

NTFNPDNFSHDKVTERDSVLFLPFGEGPRNCIGLRFGKMQALVGLALLLKNFRFSVCQET

QIPLTYSKESFLISTDKGIYLRVEKN

 

>CYP6A38v1 Musca domestica Nannan Liu 7/20/06 EF615003.1

METSGVLIYLILVIASAVVYLLRRNLSYWKRLGIPHEEPTALMGNMNGLRTQRCMGDILA EYYRKFKGCGPFAGIFNGQRPGVVLLDKQLIKQVLIKDFTQFTDRGLYYNEKSDPLTGHL FFVDGDKWRSLRNKLSPTFTSGKMKYMYPTVLEVAERFMEVLAQKVRENSIVDVRDMLGR FTVDVIASVAFGIECNSLRNAEDKFLQLGRKSIEVQRHNALIMTLIDGFPRLSRMLGMRT LPQDVHEFFMQTIRETVEYRERNNIQRSDFLNILIELKNTVDDKSGLGGMELEELAAQVF VFFLAGFETSSSTMAYALYELAQNQQIQERLREEINEAFEGDTKPSYETIMNLSYLDQVI SETLRKYPILPFLNRQALNDYVVPGHPKFRIPKGTPIFIPVMGIQHDPEFYPQPDEFDPE RFSPDMVKQRDSIEWMPFGDGPRNCIGARFAKMQTRLGLACVLKYFRVVVCPKTPLHLTF

QAKPLVLTPRHNVYLKLEAI

 

>CYP6A40 Musca Domestica insecticide-susceptible strain TJS

FJ911555.1

top 19 BLAST hits are all CYP6A sequences

52% to Cyp6a9 D. melanogaster

47% to CYP6A1 Musca domestica

47% to Cyp6a2 D. melanogaster

43% to CYP6A3 Musca domestica

44% to CYP6A4 Musca domestica

44% to CYP6A5 Musca domestica

46% to CYP6A6 Musca domestica (partial seq)

49% to CYP6A7 Musca domestica (partial seq)

45% to CYP6A24 Musca domestica

50% to CYP6A25 Musca domestica (partial seq)

49% to CYP6A36 Musca domestica

51% to CYP6A37 Musca domestica

45% to CYP6A38v1 Musca domestica

45% to CYP6A39 Musca domestica

MWLSGILVGLVVTLISYLVLLMKRRLNYWHSRNVPCERPSLLLGNFKGMRTKYSFPE

IWMNYYKKFKGSGPFAGFFWFSHPAVFVLDLELIKNILTRDFNKFMDRGFFHNEQDDPLT

GHLFFLDGLKWKSLRQKLTPTFSSGKIAKMFPMVKNLTGRLMETMEEKLEDSEKQEDENA

KHVLEMKDLLARFGTDVIGCCAFGIDCNSLSDPEAKFHIMGQRLFSEPRNGQLGNALAFN

FPELVQKLHMKVIPDEISEFFMDLVKKTIQSREENPTERDDFLALLMELRESKQIKTEDG

EETKSLTLEEIAAQIVLFFLAGYETSSTTVGFALYELARHQEIQNRLRQEVNEIWVKYGK

DFTYESVKDMTYLQQVIQETLRLYIPVPVLNRKCLEDYPVPGHDEKYLIKKGMNVIIPVL

AIQRDEEFFPQPEEFNPDNFEASRCKDRESVVYMPFGEGPRNCIGKRFGEMQTGLVLATL

IKKFKFSTCPQTQIPVIFNKETYFLGAGHGIHLRVEKI*

 

>CYP6B1 S48952

MLYLLALVTVLAGLLHYYFTRTFNYWKKRNVAGPKPVPFFGNLK

DSVLRRKPQVMVYKSIYDEFPNEKVVGIYRMTTPSVLLRDLDIIKHVLIKDFESFADR

GVEFSLDGLGANIFHADGDRWRSLRNRFTPLFTSGKLKSMLPLMSQVGDRFINSIDEV

SQTQPEQSIHNLVQKFTMTNIAACVFGLNLDEGMLKTLEDLDKHIFTVNYSAELDMMY

PGILKKLNGSLFPKVVSKFFDNLTKNVLEMRKGTPSYQKDMIDLIQELREKKTLELSR

KHENEDVKALELTDGVISAQMFIFYMAGYETSATTMTYLFYELAKNPDIQDKLIAEID

EVLSRHDGNITYECLSEMTYLSKVFDETLRKYPVADFTQRNAKTDYVFPGTDITIKKG

QTIIVSTWGIQNDPKYYPNPEKFDPERFNPENVKDRHPCAYLPFSAGPRNCLGMRFAK

WQSEVCIMKVLSKYRVEPSMKSSGPFKFDPMRLFALPKGGIYVNLVRR

 

>CYP6B1v3 Papilio polyxenes (black swallowtail butterfly) U05037

MLYLLALVTVLAGLLHYYFTRTFDYWKKRNVAGPKPVPFFGNLK

DSVLRRKPQVMVYKSIYDEFPNEKVVGIYRMTTPSVLLRDLDIIKHVLIKDFESFADR

GVEFSLDGLGANIFHADGDRWRSLRNRFTPLFTSGKLKSMLPLMSQVGDRFIKCIDEV

SQTQPEQSIHNLVQKFTMTNIAACVFGLNLDEGMLKTLEDLDKHIFTVNYSAELDMMY

PGILKKLNGSLFPKVVSKFFDNLTKNVLEMRKGTPSYQKDMIDLIQELREKKTLELSR

KHENEDVKALELTDGVISAQMFIFYMAGYETSATTMTYLFYELAKNPDIQDKLIAEID

EVLSRHDGNITYECLSEMTYLSKVFDETLRKYPVADFTQRNAKTDYVFPGTDITIKKG

QTIIVSTWGIQNDPKYYPNPEKFDPERFNPENVKDRHPCAYLPFSAGPRNCLGMRFAK

WQSEVCIMKVLSKYRVEPSMKSSGPFKFDPMRLFALPKGGIYVNLVRR

 

>CYP6B2 Helicoverpa armigera cytochrome P-450 (CYP6B2) mRNA, complete cds.

ACCESSION   U18085, note 20 aa diffs to CYP6B2v1 (18 in the N-term)

Note CYP6B27 N-term matches this seq (possible hybrid seq)

MWIFYFPAVISVLIVTLYFYFTRTFNYWKKRNVRGPEPVVFFGN

LKDSALRKKNMGVVMEELYNMFPEEKVIGIYRMTSPCLLVRDLEVIKHIMIKDFEVFS

DRGLEFSKEGLGQNLFHADGDTWRTLRNRFTPIFTSGKLKNMFYLMNEGADNFIDHVS

KECEKHQEFEIHTLLQTYTMSTISSCAFGVSYDTISDKLDTLAIVDKIISEPSYAIEL

DMMYPGLLPKLNLSIFPSVVHKFFKNLVNTIVTQRNGKPSGRNDFMDLILELRQMGEI

TSNKYGNNMSTLEITESVMCAQAFVFYIAGYETSATTMAYLTYQLALNPDIQNKLIAE

IDEAIKANGGKVTYDTVKDMKYLNKVFDETLRMYSIVEPLQRKAIRDYKLPGTDVVIE

KDTVVLISPRGIHYDPKYYDNPKQFNPERFFAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKLLSKFRLEPSKNTDRNLQVEPYRFIIGPKGGIRLNIVPRKDVS

 

>CYP6B2 Helicoverpa armigera DQ780605

4 aa diffs to U18085, 5 aa diffs to CYP6B2v1

FYMAGFETSATTMAYLTYQLALNPDIQNKLIAEIDEAIKANGGK

VTYDTVKDMKYLNKVFDETHRMYSIVEPLQRKAIRDYKLPGTDVVIEKDTVVLISPRG

IHYDPKYYDNPKQFNPERFNAEEVGKRHPCAYLPFG

 

>CYP6B3 Papilio polyxenes (black swallowtail butterfly) U25819

MLYVITLVTVLAGLLHYYFTRNFDYWKKRNVAGPKPIPFFGNLK

DSALRRKPQVMVYKSIYDEFPNEKVVGIYRMTTPSVLLRDLDIIKHVPTKDFEPFADR

GVEFSLDGLGANIFHADGDRWRSLRNRFTPLFTSGKLKTMLPLMSQVGDKFINTSDEV

SQTKSEQSIHDLVQIFTITNIAACAFGLNLDENMLKTLQDLDKYIFTVNYSGEFDMLY

PGILKKFNGSIFPKVVKQFFDKLTKDIFEMRKGTSSCQKDMIDSIQELRQQKTVDLWR

KHDNEDVKPLELTDGVISAQMFIFYAAGYETSATTMTYLFYELAKNPDIQDKLIAEID

EVLSRHDGNITYECLGEMTFLGRVFDETLRKYPVGDFTQRNAKTDYVFPGTDITIKKG

QTIIVSTWGIQNDPKYYPNPEKFDPERFNPENIKNRHPCAYLPFSAGPRNCLGLRFAK

WQIEVCVVKVLSKYRVEPSNKSSGEFKFDPMRLFVLPKGGIFVNIVRR

 

>CYP6B3v2 Papilio polyxenes (black swallowtail butterfly) U65488

MLYVITLVTVLAGLLHYYFTRNFDYWKKRNVAGPKPIPFFGNLK

DSVLRRKHQVMVYKSIYDEFPNEKVVGIYRMTTPSVLIRDLDIIKHVLIKDFESFADR

GVEFSIDGLGANIFHADGDRWRSLRNRFTPLFTSGKLKTMLPLMSQVGDKFINTSDEV

SQTKSEQSIHDLVQIFTITNIAACAFGLNLDENMLKTLQDLDKYIFTVNYSGEFDMLY

PGILKKFNGSIFPKVVKQFFDKLTKDIFEMRKGTSSCQKDMIDSIQELRQQKTVDLWR

KHDNEDVKPLELIDGVISAQMFIFYAAGYETSATTMTYLFYELAKNPDIQDKLIAEID

EVLSRHDGNITYECLSEMTYLSKVFDETLRKYPVGDFTQRNAKTDYVFPGTDITIKKG

QTVIISTWSIQNDPKYYPNPEKFDPERFNPENIKNRHPCAYLPFSAGPRNCLGLRFAK

WQIEVCVVKVLSKYRVEPSNKSSGEFKFDPMRLFVLPKGGIFVNIVRR

 

>CYP6B4 Papilio glaucus (butterfly) U47059 (1619bp)

MLYVITLVTVLAGLLHYYFTRNFDYWKKRNVAGPKPIPFFGNLK

DSVLRRKHQVMVYKSIYDEFPNEKVVGIYRMTTPSVLIRDLDIIKHVLIKDFESFADR

GVEFSIDGLGANIFHADGDRWRSLRNRFTPLFTSGKLKTMLPLMSQVGDKFINTSDEV

SQTKSEQSIHDLVQIFTITNIAACAFGLNLDENMLKTLQDLDKYIFTVNYSGEFDMLY

PGILKKFNGSIFPKVVKQFFDKLTKDIFEMRKGTSSCQKDMIDSIQELRQQKTVDLWR

KHDNEDVKPLELIDGVISAQMFIFYAAGYETSATTMTYLFYELAKNPDIQDKLIAEID

EVLSRHDGNITYECLSEMTYLSKVFDETLRKYPVGDFTQRNAKTDYVFPGTDITIKKG

QTVIISTWSIQNDPKYYPNPEKFDPERFNPENIKNRHPCAYLPFSAGPRNCLGLRFAK

WQIEVCVVKVLSKYRVEPSNKSSGEFKFDPMRLFVLPKGGIFVNIVRR

 

>CYP6B4v2 Papilio glaucus (butterfly) U65489

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSLFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTFELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFSYDPTRLLVYPKSGIFLNILPRNY

 

>CYP6B5v1 Papilio glaucus (butterfly) U65490

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSLFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEF

 

>CYP6B6v1 Helicoverpa armigera  U64800

3 aa diffs to Ha-12E11-D

MWIFYFPAVISVLIVSLYFYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSALPRKNMGVVMEELYNMFPEEKVIGIYRMTSPCLLVRDLEVIKHIMIKDFEVFS

DRGVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKPKNMFYLMHEGADNFIDHVS

AECEKNQEFEVHSLLQTYTMSTIAACAFGISYDSIGDKVKALDIVDKIISEPSYAIEL

DMMYPGLLSKLNLSIFPTAVKNFFKSLVDNIVAQRNGKPSGRNDFMDLILELRQLGEV

TSNKYGSSASSLEITDEVICAQAFVFYIAGYETSATTMAYMIYQLALSPDIQNKLIAE

VDEVLKANDGKVTYDTVKEMKYMNKAFDETLRMYSIVEPLQRKATRDYKIPGTDVVIE

KDTIVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPHRGLIGPKGGIRVNVVPRKLVS

 

>CYP6B6v2 Contig_187 99% to 6B6 U64800 4 aa diffs

NYWKKRNVRGPEPTVFFGNLKDSALRRKNMGVVMEELYNMFPEEKVIGIYRMTSPCLLVRDLEVIKHIMIKDFEVFSDR

GVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVSAECEKNQEFEVHSLLQTYTMSTI

AACAFGISYDSIGDKVKALDIVGKIISEPSYAIELDMMYPGLLSKLNLSIFPTAVKNFFKSLVDNIVAQRNGKPSGRND

FMDLILELRQLGEVTSNKYGSSASSLEITDEVICAQAFVFYIAGYETSATTMAYMIYQLALNPDIQNKLIAEVDEVLKA

NDGKVTYDTVKEMKYMNKAFDETLRMYSIVEPLQRKATRDYKIPGTDVVIEKDTIVLISPRGIHYDPKYYDNPKQFNPD

RFDAEEVGKRHPCAYLPFGLGQRNCIGMRFGRLQSLLCITKILSKFRIEPSKNTDRNLQVEPHRGLIGPKGGIRVNVVP

RKLVS

 

>CYP6B7 Helicoverpa armigera AF031468

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPYEKVVGMYRMTTPCLLVRDFHVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLLAKLNLSIIPTPVQHFFKSLVDNIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSATTMSYLIYQLSLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKATRDYQIPGTDVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVTIGPKGGIRVNIVPRKIVS

 

>CYP6B8v1 Helicoverpa zea AF102263

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTTPCLLVRDLDVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLLAKLNLSIIPTPVQHFFKSLVDSIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSATTMSYLIYQLSLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKATRDYQIPGTDVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B8v2 Helicoverpa zea AF285828

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTTPCLLVRDLDVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLSAKLNLSIIPTPVQHFFKSLVDSIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSATTMSYLIYQLTLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLRRRATRDYQIPGTDVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B8v3 Helicoverpa zea AF285829

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTTPCLLVRDLDVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLLAKLNLSIIPTPVQHFFKSLVDSIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLGGVTSLEITDEVICAQAFVFYVAGYETSATTMSYLIYQLSLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRVYSIVEPLQRKATRDYQIPGTGVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B8v4 Helicoverpa zea AF285830

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTTPCLLVRDLDVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLLAKLNLSIIPTPVQHFFKSLVDSIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSATTMSYLIYQLSLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKASRDYQIPGTDVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B8v5 = old CYP6B28 AF285186 Helicoverpa zea

MWVLYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGN

LKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTTPCLLVRDLDVIKHIMIKDFEAFR

DRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

KECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIEL

DYMYPKLLAKLNLSIIPTPVQHFFKSLVDSIISQRNGKPAGRNDFMDLILELRQMGEV

TSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSAITMSYLIYQLSLNQDVQNKLIAE

VDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKATRDYQIPGTDVVIE

KDTMVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B8v6 Helicoverpa armigera Contig_208 99% to 6B8v1 (2 aa diffs)

100% identical to Ha-12E11-A

MWALYLPAVLSVLIVTLYLYFTRTFNYWKKRNVRGPEPTVFFGNLKDSTLRKKNIGIVMEEIYNQFPDEKVVGMYRMTT

PCLLVRDLDVIKHIMIKDFEAFRDRGVEFSKEGLGQNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDH

VSKECEKKQEFEVHSLLQTYTMSTISSCAFGVSYNSISDKVQTLEIVDKIISEPSYAIELDYMYPKLLAKLNLSIIPTP

VQHFFKSLVDNIISQRNGKPAGRNDFMDLILELRQMGEVTSNKYLDGVTSLEITDEVICAQAFVFYVAGYETSATTMSY

LIYQLSLNQDVQNKLIAEVDEAIKASDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKATRDYQIPGTDVVIEKDT

MVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRFGRLQSLLCITKILSKFRIEPSKNT

DRNLQVEPRRVIIGPKGGIRVNIVPRKIVS

 

>CYP6B9 Helicoverpa zea AF140278

MWIFYFPAVISVLIVTLYFYFTRTFNYWKKGNVRGPEPVVFFGN

LKDSALRKKNMGVVMEEMYNMFPEEKVIGIYRMTSPCLLVRDLDVIKHIMIKDFEVFS

DRGVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

AECEKNQEFEVHSLLQTYTMSTIAACAFGISYDSIGDKVKALDIVDKIISEPSYAIEL

DMMYPGLLSKLNLSIFPTAVKNFFKSLVDNIVAQRNGKPSGRNDFMDLILELRQLGEV

TSNKYGSSASSLEITDEVICAQAFVFYIAGYETSATTMAYLTYQLALNPDIQNKLIAE

IDEAIKANGGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKAIRDYKLPGTDVVIE

KDTIVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKLLS

 

>CYP6B10 AF140279 Heliothis virescens

MWILYLPIVIPVLLVTLYFYFTRTYWKKGNVRGPEPTVFFGNLK

DSALRKKNAGIVMEELYNMFPDEKVIGIYRMTSPCLLVRDLDVIKHIMIKDFEVFSDR

GVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVSAE

CEKNQEFEVHSLLQTYTMSTIAACAFGISYDSIGDKMKALEIVDKIISAPSYAIELDM

MYPGLLSKLNLSIFPNEVKNFFKSLVDNIITQRNGKPSGRNDFMDLILELRQLGQVTS

NKYGSSVSSLEITDEVICAQAFVFYIAGYETSATTMAYLIYELALNPDIQNRLIAEID

EAVKANDGKVTYDTVKEMKYLNKVFDETLRMYSIVEPLQRKAIRDYKIPGTDVVIEKD

TIVLISPRGIHYDPKYYDNPKQFNPDIFDAEEVGKRHPCAYLPFGVGQRNCIGKGLDI

S

 

>CYP6B11 AF280614 Papilio canadensis cytochrome

MLTIFIVTATLFAILYLYLTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIILLVRKFTMASIAACAFGMELDEEMFESLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSLFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHYGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVASGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTRSEFSYEPTRLLVYPKSGICLNILPRNY

 

>CYP6B12 AF280615 Papilio glaucus

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEKRGGKPTNRKDLMDLILELRQKKAIEPMK

KTQDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENIRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTKSEFNYDPTRLLVYPKSGICLNILPRNY

 

>CYP6B13 AF280616 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKAKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMFESLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSLFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYVVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIFKLLSKFRFDPSTKTMSEFNYDPTRLLVYPKSGIFLNILPRNY

 

>CYP6B14 AF280612 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKSIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFSYDPTRLLVYPKSGICLNILPRNY

 

>CYP6B15 AF280613 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFSYDPTRLLVYPKSGIFLNILPRNY

 

>CYP6B16 AF280617 Papilio glaucus

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKT

CDKEPEQQIIPLVRKFTMASITTCAFGMDLDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTQDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFSYDPTRLLVYPKSGIFLNILPRNY

 

>CYP6B17 AF280618 Papilio glaucus

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPKPTVFSGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFSDR

GIEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIILLVRKFTMASIAACAFGMELGEDMIETLDKLDSLIFTNSYVNEVDMMY

PGILKKLNSSIFSKMIGPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEPVTKFELTDSVIAAQTFVFYAAGYETSATTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRKANADYAVPGTNVTLKKG

QTVLVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRLEPSTKTKSQFIYDPMRLFVYPKSGIFLNILPRNY

 

>CYP6B18 AF280619 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMFESLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEPVTTFELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRLEPSTKT

 

>CYP6B19 AF280620 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWEDRNVVGPEPTVFFGNIM

                     ESVIRR

 

>CYP6B20 AF280621 Papilio glaucus

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNGSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTQDGQVTTLELTDSVIAAQTFIFYAAGYETSAPTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFSYDPTRLLVYPKSGIFLNILPRNY

 

>CYP6B21 AF280622 Papilio glaucus

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTQDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRLEPSTKTKSQFIYDPMRLFVYPKSGIFLNILPRNY

 

>CYP6B22 AF280623 Papilio canadensis

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGVYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRMLRQCFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDP

 

>CYP6B23 AF278602 Papilio glaucus SF-X9

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIGPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEPVTTFELTDSVIAAQTFVFYAAGYETSATTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHQTLRKYPVADILLRKANADYAVPGTNVTLKKG

QTVLVSGFGIHYDPKYYPDPEKFDPERFGPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRLEPSTKTKSQFNYDPMRLFVYPKSGIFLNILPRNY

 

>CYP6B24 AF278601 Papilio glaucus SF-X43

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVAGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDAIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMIETLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSIFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTQDEQVTTLELTDSVIAAQTFIFYAAGYGTSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTHLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTMSEFNYDPTRLLVYPKSGIFLNIIPRNY

 

>CYP6B25 AF278603 Papilio canadensis CAN-X21

MLTIFIVTATLLAILYLYFTRNFNYWKDRNVVGPEPTVFFGNIM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFNDR

GVEFSEEGLGLNIFHADGDRWRVLRQFFTPLFTSGKLKNMLNLMSDRGDKFIKMVAKI

CDKEPEQQIIPLVRKFTMASITTCAFGMELDEEMFESLDKLDSLIFTTSYGNEIDMMY

PGILKKLNSSLFSKMIAPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEQVTTLELTDSVIAAQTFIFYAAGYETSASTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKG

QTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRFEPSTKTRSEFSYEPTRLLVYPKSGICLNILPRNY

 

>CYP6B26 AF278604 Papilio canadensis CAN-X22

MLTIFIVTATLFAILYLYFTRNFNYWKDRNVVGPKPTVFFGNVM

ESVIRRKHLIMIYKDIYEAFPKEKVVGIYRMTTPCLLLRDLDVIKHVMIKDFDLFSDR

GIEFSEQGLGLNIFHADGDRWRVLRQAFTPLFTSGKLKNMLNLMSDRGDKFIKMVEKI

CDKEPEQQIILLVRKFTMASITACAFGMELGEDMIETLDKLDSLIFTNSYVNEVDMMY

PGILKKLNSSIFSKMIGPFFDNLTKTIIEQRGGKPTNRKDLMDLILELRQKKAIEPMK

KTHDEPVTTFELTDSVIAAQTFVFYAAGYETSATTMSFLLFELAENPDIQEKVIAEVD

ETLKRHNGEITYDTLSEMTYLTQVFHETLRKYPVADILLRKANADYAVPGTNVTLKKG

QTVLVSGFGIHYDPKYYPDPEKFDPERFSPENVKNRHPCAYIPFGAGQRKCLGMRFGQ

WQVQVCIIKLLSKFRLEPSTKTKSQFNYDPMRLFVYPKSGVF

 

>CYP6B27 AF285831 Helicoverpa zea 6B27 (CYP6B27)

5 diffs to Ha-12E11-B

MWIFYFPAVISVLIVTLYFYFTRTFNYWKKRNVRGPEPVVFFGN

LKDSALRKKNMGVVMEEMYNMFPEEKVIGIYRMTSPCLLVRDLDVIKHIMIKDFEVFS

DRGVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDHVS

AECEKNQEFEVHSLLQTYTMSTIAACAFGISYDSIGDKVKALDIVDKIISEPSYAIEL

DMMYPGLLSKLNLSIFPTAVKNFFKSLVDNIVAQRNGKPSGRNDFMDLILELRQLGEV

TSNKYGSSASSLEITDEVICAQAFVFYIAGYETSATTMAYMIYQLALNPDIQNKLIAE

VDEVLKANDGKVTYDTVKEMKYLNKAFDETLRMYSIVEPLQRKATRDYKIPVTDVVIE

KDTIVLISPRGIHYDPKYYDNPKQFNPDRFDAEEVGKRHPCAYLPFGLGQRNCIGMRF

GRLQSLLCITKILSKFRIEPSKNTDRNLQVEPHRGLIGPKGGIRVNVVPRKLVS

 

>CYP6B27 Helicoverpa armigera Ha-12E11-B

5 aa diffs to AF285831 Helicoverpa zea (ortholog)

2 aa diffs to DQ458470.1 (22332-24108) called CYP6B6 in Genbank entry

MWIFYFPAVISVLIVTLYFYFTRTFNYWKKRNVRGPEPVVFFGNLKDSALRKKNMGVVMEELYNMFPEEKVIGIYRMTS

PCLLVRDLEVIKHIMIKDFEVFSDRGVEFSKEGLGSNLFHADGETWRALRNRFTPIFTSGKLKNMFYLMHEGADNFIDH

VSAECEKNQEFEVHSLLQTYTMSTIAACAFGISYDSIGDKVKALDIVDKIISEPSYAIELDMMYPGLLSKLNLSIFPTA

VKNFFKSLVDNIVAQRNGKPSGRNDFMDLILELRQLGEVTSNKYGSSASSLEITDEVICAQAFVFYIAGYETSATTMAY

MIYQLALNPDIQNKLIAEVDEVLKANDGKVTYDTVKEMKYLNKAFDETLRMYSIVEPLQRKATRDYKIPGTDVVIEKDT

IVLISPRGIHYDPKYYDNPKQFNPERFNAEEVGKRHPCAYLPFGLGQRNCIGMRFGRLQSLLCITKILSKFRIEPSKNT

DRNLQVEPHRGLIGPKGGIRVNVVPRKLVS

 

>CYP6B29 Bombyx mori (silkworm)

2461 MAIIYILSASVVLPLLLYLYFTRHFNYWKKRNVPGPKPVPLFGNLMELALRKKNIGIVFKELYENFPNEK 2670

2671 VVGIYRMTTPCLLIRDLDVIKNIMIKDFDVFVDRGVELS*SGLGANLFHADGDTWRV 2841

2842 LRNRFTPLFTSGKLKN

MLHLMIERANKYIEHVEMLCDHQPEQDIHTLVQKYTMATIAACAFGLDIDTTDPNKDQLK

TLEEIDRLSLTANFAFELDMMYPGVLKKLNSTLFPGFVSRFFKDVVKTIIEQRNGKPTDR

NDFMDLILALRQLGDIQATKRNSEDKEYSIELTDELIEAQAFVFYIAGYETSATTMTFML

YQLALNPDIQDKVIAEIDQGLKESKGEVTYEMLQNLTYFEKAFNETLRMYSIVEPLQRNA

KIDYKIPDTDIVIEKGTTVLFSPLGIHHDEKYYPNPSKFDPERFSPANISARHPCAHIPF

GTGPRNCIGMRFAKIQSRVCMVKMFSKFRFELAKNTPRNLDIDPTRLLLGPKGGIPLKIVRR*

 

>CYP6B29 Bombyx mandarina (wild silkworm) DQ252325

MAIIYILLASVVLPLLLYLYFTRHFNYWKKRNVPGPKPVPLFGN

LMESALRKKNIGIVFKELYENFPNEKVVGIYRMTTPCLLIRDLDVIKNIMIKDFDVFV

DRGVELSKSGLGANLFHADGDTWRVLRNRFTPLFTSGKLKNMLHLMIERANKYIEHVE

MLCDHQPEQDIHTLVQKYTMATIAACAFGLDIDTTDPNKDQLKTLEEIDRLSLTANFA

FELDMMYPGVLKKLNSTLFPGFVSRFFKDVVKTIIEQRNGKPTDRNDFMDLILALRQL

GDIQATKRNSEDKEYSIELTDELIEAQAFVFYIAGYETSATTMTFMLYQLALNPDLQD

KVIAEIDQGLKESKGEVTYEMLQNLTYFEKAFNETLRMYSIVEPLQRNAKIDYKIPDT

DIVIEKGTTVLFSPLGIHHDEKYYPNPSKFDPERFSPANISARHPCAHIPFGTGPRNC

IGMRFAKIQSRVCMVKMFSKFRFELAKNTPRNLDIDPTRLLLGPKGGIPLKIVRR

 

>CYP6B31v2 Spodoptera exigua (beet armyworm) FJ524855 (5 aa diffs to CYP6B31v1)

MSFLYITLGLSALVYAFYYYFTRTFNYWKSRNVPGPEPIPFFGN

IKESVLRQKNIGVVIHDIYKAFPNEKVVGLYRMTSPCLLVRDLEIIKHIMIKDFEVFT

DRGVDFSKQGLGQNLFHADGETWTALRNRFSPIFTTGKLKNMFYLMNEGADSFVDYVS

TECQSRQEFEVHLLLQSYTVSTISACAFGVSYDSLQDKMEALKLVDQVISSPSYIVEL

DMMYPGLLRSLNLSLFPKVVMKFFENLVDNIITQRNGKPSGRNDFIDLILELREKKEV

NSTKFGHSGKTLEITSDVIAAQAFVFYVAGYETSATTMGYMLYQLAMNPDVQKKLTAE

IDEVIQANNGQVTYETIKEMKYLNKVFDETLRMYSIVEPLQRKAVREYKVPGTDLTIE

KDTIVLVSPRGIHYDEKYYEDPEVFNPERFDPEVAGNRHPCAYLPFGIGQRNCIGMRF

GRLQSQLCITKLLSKFQVEPSKNTARNLEVEPHRGIIGPKGGIRLNVIPRKIKS

 

>CYP6B45 Manduca sexta Contig_359_FL (sent to genbank)

72% to Contig_1239_FL, 64% to CYP6B29

MVLLYLAVGVVLTTALALYAYFTRTFNYWKSKNVVGPEPVAFFGNLKESTLRRKNIGVVF

QEFYKQFPNEKVVGVYQMTTPCLLLRDLDIIKHIMIKDFDVFIERGIEFSKEGLGANLFH

ADADTWRSLRNRFTPLFTSGKLKNMLHLITERADKFRDYVYHLCNDNPEQEIHSLFQMYT

MGTISACAFGVDIDTLHDKLETFHEMDKLVLTPSYASELDMMFPGILKWFNSSIFSVKIK

DFFYDLVKSVISQRGGLPTKRNDFMDLILELRQQGRIETTKRHDETQKLILELSDDIIAA

QAFIFYVGGYETTATTVSFLLYQLAMNPDIQDKLLAEIDQSLEDNNGVVNYDTIQSMRYL

DKVLNETLRMYPIVEPLKRIAKVDYKIPGTDVTIEKGTTVIVSPIGIHHDEKYYPNPHIF

DPERFSPENSGQRHPCAYIPFGTGPRNCIGMRFAKLQGSVGLVKLLSKVRVEPSKNTPKI

LDIEPNRIIIGPKGGVRLNIIQRKPVNA

 

>CYP6B46 Manduca sexta Contig_1239_FL (sent to genbank)

72% to CYP6B45 Contig_359_FL,

60% to CYP6B2v1 HaCypZ017a-v1Pep Helicoverpa armigera

MLXLYLALGIVTAAVALYAYFTRTFNYWKSRNVAGPEPVALFGNLKESTLRSKNIGIVFQ

ELYNQFPNEKVVGIYRMTTPCLLLRDLDVIKHIMIKDFDVFSDRGVEFSKEGLGVNLFHA

DGDTWRTLRNRFTPIFTSGKLKNMLYLITERADKFSNYVEKLCYDQPEQEVHSLIQKYTM

GTIAACAFGVDIDTLYDKLDTLLLIDKLILQGTYATELDMMFPGILKLNQSLFPQTVKDF

FYDLVKSVMTQRGGVPSNRKDFMDLLLELRQQGHIETTKRNDXKRKTILSNFXRCNSSSK

RLFSTWQAMKPPPQLSHFXLYELAMNPDIQNKLLAEIDDTLAANNGVVDYDTIKSMSYLD

RVFDETLRKYPIVEPLQRNAKADYKIPGTDVVVKKGMTVLISPMGIQNDEKYFPKPHIFD

PERFTPENAGKRHPCAYIPFGTGPRNCIGMRFARLQGATGLVKLLSKVRVEPSKNTPPIM

EIEPKRVIVGPKNGIQLKLIPRKPVKS

 

>CYP6B47 Spodoptera Litura (first 6B seq) 72% to CYP6B2v1 Helicoverpa armigera.

84% to CYP6B39, GQ465039

GPEPTAFFGNIKESVVRTKNIGIVMHDIYKAFPNEKVVGMFRMTSPCLLIRDLDIVKHVM

IKDFEVFSDRGVEFSKEGLGQNLFHADGETWTALRNRFTPIFTIGKLKNMFYLLNEGGDS

FIEYVSTECQKKQEFDIQPLLQTYTVSTISACAFGISYDSLDDKLETLKLVDKVFSSPSY

AFELDMMYPGLLKALNLSLFPSSIQKFFDNLVKTVIAQRNGKPSGRHDFMDLILALREIG

EVTNAKHDSAKPVEITPEVMAAQAFVFYAGGYETSATTVTFMLYQLAMNPDIQNKLRAEI

DEVIQADNGQVTYESIKEMKYLNKVFDETLRMYSIVEPLQRKVARDYQVPGTNLTLEKDT

IVLISPRGIHYDEKYYDNPEKFNPDRL

 

>CYP6B48 Spodoptera Litura (second 6B seq) 72% to CYP6B2v1 Helicoverpa

94% to CYP6B47 Spodoptera Litura (first 6B seq), 85% to CYP6B39

GQ465038

GPEPTAFFGNIKESVVRTKNIGIVMHDIYKAFPNEKVVGMFRMTSPCLLIRDLDIVKHVM

IKDFEAFSDRGVEFSKEGLGQNLFHADGETWTALRNRFTPIFTTGKLKNMFYLINEGGDT

FIEYINTECQKKQEFDIQPLLQTYTMSTISACAFGISYDSLDDKLETLKLVDKIFSAPSY

ANELDMMYPGLLKALNLSLFPSSIQKFFENLVKTVIAQRNGKPSGRHDFMDLILALREIG

EVSNAKHDSAKPVEITPEVMAAQAFVFYAAGYETSATTMTFMLYQLAMNPDIQNKLRAEI

DEVIQANNGQVTYESIKEMKYLNKVFDETLRMYSIVEPLQRKVVREYQVPGTNLTLEKNT

IVLISPRGIHYDEKYYDNPEKFNPE

 

>CYP6C1 U09233

MIPIPLAIFTLIIFLAIIWLHYQLTYWRRRKAPTVPTTGLYKLR

NREHIAYSYQRAYHQMKRENKGYAGIYTLITPTLLIADLEILKLILVTEFEVFPDRGF

FVNYKSDPLSRNMARLHGEMWRKIRTKITPTFTAAPMRQMFGNVEAIGRHFMQVMEKQ

AEPKRNVVEVRDLCARFTTDVIGNVAFGLDCNSLEDPNTEFRLKGDRTFSDVNPFWDM

LASHFPKLFTWLDYKVATPELISFYSNIVCRTVEYREKNGVRRNDFLDLLIELKNRPQ

QEGEYQLEMDDLIAQSFAFFSAGFETSSNTMAFALYELAKNPRVQERARENIAEALRK

HQGVFSYDSLNEMTYIRQVVQETLRKYPPVPSTKRVCRRSYKFPDRQGLTVEPYVHII

IPIYAIHHDPEYYPQPEVFRPERFSAEERQRRHPMAYLPFGAGPRICIAERFGMMETM

MGVALLLMHFKFSPCKETAENLIFDPKNVFVFSIRGGIHLRVEKVQ

 

>CYP6C2 Musca domestica (housefly) U09345

EREHVAFVYERIYKQLREEQRPYAGFLTMLTPTLLVADLDLLKL

VYISEFDSFPDRGFYANFKDDPLSKNLVRLHGDLWRKVRTKLTPTFTSGRMRQMFGTV

QAIGENFIQVMAGQVEELNNELEVRDLCARFTTDVIGNVAFGLECNSLQEPQAEFRVK

GDKAFYTIHPFMEMIASTYPKLFHRFGYKVFTQELITFYSRIVRETVEYREKNGVKRN

DFLDLLIELKNSPLEGEAEYQLDMEDIIAQAFVFFIGGFETSSSTMTFALYEMAKNPQ

VQERARKDVQDTLEKHKGAFGYDSLNDMGYVRQVVQETLRKHPVAPTGRRVCRRPFTL

PGKPGLTVEPSVHIIIPVYAIHHDPEYYPQPEVFRPERFAPNEKGQRHPMTYLPFGAG

PRTCIAERFGMMQTMMGLALLLKNFKFSLCDRTVKQLTFDPFNVRVFNTKEGIYLRVE

KI

 

>CYP6D1v1 Musca domestica (housefly) strain LPR U15168 pyrethroid-resistant

MLLLLLLIVVTTLYIFAKLHYTKWERLGFESDKATIPLGSMAKV

FHKERPFGLVMSDIYDKCHEKVVGIYLFFKPALLVRDAELARQILTTDFNSFHDRGLY

VDEKNDPMSANLFVMEGQSWRTLRMKLAPSFSSGKLKGMFETVDDVADKLINHLNERL

KDGQTHVLEIKSILTTYAVDIIGSVIFGLEIDSFTHPDNEFRVLSDRLFNPKKSTMLE

RIRNLSTFMCPPLAKLLSRLGAKDPITYRLRDIVKRTIEFREEKGVVRKDLLQLFIQL

RNTGKISDDNDKLWHDVESTAENLKAMSIDMIASNSFLFYIAGSETTAATTSFTIYEL

AMYPEILKKAQSEVDECLQRHGLKPQGRLTYEAIQDMKYLDLCVMETTRKYPGLPFLN

RKCTQDFQVPDTKLTIPKETGIIISLLGIHRDPQYFPQPEDYRPERFADESKDYDPAA

YMPFGEGPRHCIAQRMGVINSKVALAKILANFNIQPMPRQEVEFKFHSAPVLVPVNGL

NVGLSKRW

 

>CYP6D1v2 Musca domestica (housefly) strain CS pyrethroid-susceptible SwissProt Q27698

  1 MLLLLLLIVV TTLYIFAKLH YTKWERLGFE SDKATIPLGS MAKVFHKERP FGLVMSDIYD

 61 KCHEKVVGIY LFFKPALLVR DAELARQILT TDFNSFHDRG LYVDEKNDPM SANLFVMEGQ

121 SWRTLRMKLA PSFSSGKLKG MFETVDDVAA KLLNHLNERL KDGQSHVLEI KSILTTYAVD

181 IIGSVIFGLE IDSFTHPDNE FRVLSDRLFN PKKSTMLQRF RNLSNFICPP LAKLLSRLGA

241 KDPITYRLRD IVKRTIEFRE EKGVVRKDLL QLFIQLRNTG KISDDNDKLW HDVESTAENL

301 KAMSIDMIAS NSFLFYIAGS ETTAATTSFT IYELAMYPEI LKKAQSEVDE CLQRHGLKPQ

361 GRLTYEAIQD MKYLDLCVME TTRKYPGLPF LNRKCTQDFQ VPDTKLTIPK ETGIIISLLG

421 IHRDPQYFPQ PEDYRPERFA DESKDYDPAA YMPFGEGPRH CIAQRMGVMN SKVALAKILA

481 NFNIQPMPRQ EVEFKFHSAP VLVPVNGLNV GLSKRW

 

>CYP6D1v3 Musca domestica strain aabys pyrethroid-susceptible (housefly) AF064795

MLLLLLIVVTTLYIFAKLHYTKWERLGFESDKATIPLGSMAKVF

HKERPFGLVLSDIYDKCHEKVVGIYLFFKPALLVRDAELARQILTTDFNSFHDRGLYV

DEKNDPMSANLFVMEGQSWRTLRMKLAPSFSSGKLKGMFETVDDVAAKLLNHLNERLK

DGQSHVLEIKSILTTYAVDIIGSVIFGLEIDSFTHPDNEFRVLSDRLFNPKKSTMLQR

FRNLSNFICPPLAKLLSRLGAKDPITYRLRDIVKRTIEFREEKGVVPKDLLQLFIQLR

NTGKISDDNDKLWHDVESTAENLKAMSIDMIASNSFLFYIAGSETTAATTSFTIYELA

MYPEILKKAQSEVDECLQRHGLKPQGRLTYEAIQDMKYLDLCVMETTRKYPGLPFLNR

KCTQDFQVPDTKLTIPKETGIIISLLGIHRDPQYFPQPEDYRPERFADESKDYDPAAY

MPFGEGPRHCIAQRMGVMNSKVALAKILANFNIQPMPRQEVEFKFHSAPVLVPVNGLN

VGLSKRW

 

>CYP6D1v4 Musca domestica (housefly) strain ISK pyrethroid-susceptible

U22367

  1 MLLLLLLIVV TTLYIFAKLH YTKWERLGFE SDKATIPLGS MAKVFHKERP FGLVMSDIYD

 61 KCHEKVVGIY LFFKPALLVR DAELARQILT TDFNSFHDRG LYVDEKNDPM SANLFVMEGQ

121 SWRTLRMKLA PSFSSGKLKG MFETVDDVAA KLLNHLNERL KDGQSHVLEI KSILTTYAVD

181 IIGSVIFGLE IDSFTHPDNE FRVLSDRLFN PKKSTMLQRF RNLSNFICPP LAKLLSRLGA

241 KDPITYRLRD IVKRTIEFRE EKGVVRKDLL QLFIQLRNTG KISDDNDKLW HDVESTAENL

301 KAMSIDMIAS NSFLFYIAGS ETTAATTSFT IYELAMYPEI LKKAQSEVDE CLQRHGLKPQ

361 GRLTYEAIQD MKYLDLCVME TTRKYPGLPF LNRKCTQDFQ VPDTKLTIPK ETGIIISLLG

421 IHRDPQYFPQ PEDYRPERFA DESKDYDPAA YMPFGEGPRH CIAQRMGVIN SKVALAKILA

481 NFNIQPMPRQ EVEFKFHSAP VLVPVNGLNV GLSKRW

 

>CYP6D1v5 Musca domestica (housefly) strain OCR pyrethroid-susceptible

AF081288

  1 MLLLLLLIVV TTLYIFAKLH YTKWERLGFE SDKATIPLGS MAKVFHKERP FGLVLSDIYD

 61 KCHEKVVGIY LFFKPALLVR DAELARQILT TDFNSFHDRG LYVDEKNDPM SANLFVMEGQ

121 SWRTLRMKLA PSFSSGKLKG MFETVDDVAA KLLNHLNERL KDGQSHVLEI KSILTTYAVD

181 INGSVIFGLE IDSFTHPDNE FRVLSDRLFN PKKSTMLERF RNLSTFMCPP LAKLLSRLGA

241 KDPITYRLRD IVKRTIEFRE ETGVVRKDLL QLFIQLRNTG KISDDNDKLW HDVESTAENL

301 KAMSIDMIAS NSFLFYIAGS ETTAATTSFT IYELAMYPEI LKKAQSEVDE CLQRHGLKPQ

361 GRLTYEAIQD MKYLDLCVME TTRKYPGLPF LNRKCTQDFQ VPDTKLTIPK ETGIIISLLG

421 IHRDPQYFPQ PEDYRPERFA DESKDYNPAA YMPFGEGPRH CIAQRMGVIN SKVALAKILA

481 NFNIQPMPRQ EVEFKFHSAP VLVPVNGLNV GLSKRW

 

>CYP6d2 Drosophila melanogaster AC020206 comp(66328-68065) also AC008350

MWTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIY

ARHEGKIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRG

ASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDI

IGSVIFGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESR

ILTSLRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMS

IEKIAAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFT

YEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRD

PVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCI ALRMGKVNSKVAVAKILANFDL

VQSPRKEVEFRFDAAPVLVTKEPLKLRLTKRK

 

>Cyp6d2 D. pseudoobscura ortholog 80%

MWAILTLLTLALGLLYQFVRRHYSSWQRLGVDEETPKIPMGILDTVMKQEMSLGMVLSDI

YKRHKGKIVGIYMMNKRSILVRDAQLARQIMTSDFASFHDRGVYVDEKNDPLSANLFNLR

GASWRNLRKKMTPSFSSGKIKGMFGTIDDVGDKMVQHLKGVLERAGADNEIDIKEMMTTY

AVDIIGSVIFGLEIDSFANPNNEFRAISNEEARSKSLLLKIHNMAMFICPP

IAKLMNRLGFESAILTALRDMMKRTIEFRESNNVVRKDLLQLLIRLRNTGRIGEDDDEVWDMETVQEEL

KAMSIEKIAAQAFLFYVAGSESTAAAAAFTLYELAMYPELLKEARDELDTVLQRHNLEGT

GKLTYEAVHDLKFLDLCLK

ETLRKYPGLPFLNRECTEDYLVPGTRHTITKGTPILISLFG

IHRDPVYFPNPEGYDPHRFDADKMNYDQAAYMPFGEGPRHCI

ALRMGEVNTKVAVAKILANFDLVQAPHKEVGSASMLLPSWCPKRV

 

>CYP6D3v1 Musca domestica AF200191

MLLFLLITLLSAFFIFAKRHYTQWQRLGLVSDEAVIPFGSLAKV

FRKERPFGLVMYDLYEKFQEQVVGIYLFFKPALLIRDAELARQILTSDFNSFHDRGIY

VDEKNDPMSANLFALEGQSWRTLRMKLTPSFSSGKLKGMFETVDDVGNKLLEYLNNQL

KDGQTHVLDIKSILTTYAIDIIGSVIFGLDIDSFTNPDNEFRVLSDRSFDNESRSFLS

KLRNLTNFVCPPIAKLLTRLGTKEPVVYRLRDIVKRTIEFREENNVVRKDLLHLLIQL

RNTGKISDDNDNLWNKVESTATNLKAMSIDMIASNSFLFYIAGSETTASSTSFTIYEL

AMNPDALKKVQNEVDECLKKHGIKPDGRLTYEAIQDMKYLDLCVKETTRKYPGLPFLN

RQCTQDFKVPNSKFTIKKDTNVIISLLGLHRDAKYFPEPLAYKPERFADETKDYDAAA

YMPFGEGPRHCIAQRMGVMNTKVALAKILANFNIEPMPHKEAEFQFNTAPVLVPVNGL

RVGLSKRSFN

 

>CYP6D3v2 Musca domestica AF283257

MLLFLLITLLSAIFIFAKRHYTQWQRLGLVSDEAVIPFGSLAKV

FRKERPFGLVMYDLYEKFQEQVVGIYLFFKPALLIRDAELARQILTSDFNSFHDRGIY

VDEKNDPMSANLFALEGQSWRTLRMKLTPSFSSGKLKGMFETVDDVGNKLLEYLNNQL

KDGQTHVLDIKSILTTYAIDIIGSVIFGLEIDSFTNPDNEFRVLSDRSFDNESRSFLS

KLQNLTNFVCPPIAKLLTRLGTKEPVVYRLRDIVKRTIEFREENNVVRKDLLHLLIQL

RNTGKISDDNDNLWNKVESTATNLKAMSIDMIASNSFLFYIAGSETTASSTSFTIYEL

AMNPEALKKAQNEVDECLKKHGIKPDGRITYEAIQDMKYLDLCVKETTRKYPGLPFLN

RQCTQDFKVPNSKFTIKKDTNVIISLLGLHRDAKYFPEPLAYKPERFADETKDYDAAA

YMPFGEGPRHCIAQRMGVMNTKVALAKILANFNIEPMPHKEAEFQFNTAPVLVPVNGL

RVGLSKRSFNRR

 

>CYP6d4 D. melanogaster AC017250 37993-39657 also AC008197 AC009846

MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD

VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL

RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY

AIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIGF

KNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHI

KTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKIT

YDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHD

AEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNV

EVMSRSEIEFENSGIALIPKHGVRVRLSKRVPKLS

 

>Cyp6d4 D. pseudoobscura ortholog

MFSLIVLAGTLLALGWFYLKHHYQYWERRGFPFDRQSTIPFGCLDSVWRREKGMGMAIYD

AYQKSKERFLGIYLLFRPAVLVRDAALARRVLAQDFASFHDRGVYVDEVNDPLSGSIFAL

RGQSWRSMRHKLSPCFTSGKLKGMFSTSEEIANNMVNHLQKTLPEQGSQEVDLKTVMQTY

AIDIIASTIFGLEMNSYLTPDNKFRNLVTIARRNTRFTTMFGMMIFLVPS

VAKFLFSLGFKNQVALAMLEIVKETIEYREKHGIVRKDLLQLLMELRNTGAVDESDENIWKIQKSAT

DQIKCISLESITAQAFIFYIAGQETTGSTAAFVLFELAQYPELLERLQTEVDETLAKNDGHIT

YDALQKMEFLDLCVQESLRKYPGLPMLNRECTQDYTVPDTDHVIPKGTPVVISLYGIHHD

AEYFPEPETYDPDRYSEENRNFSPTAFMPFGEGPRICIAQRMGLLNAKLAIINVLKNFNV

EVMSKRQLEFENSGIALLPKNGVKVRLSKRLPK*

 

>Cyp6d5 D. melanogaster AC018176 comp(132649-134791)

MIGIYLLIAAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGALESVTKGKRSFGMAIYDMY

KSTKEPVIGLYLTLRPALLVRDAQLAHDVLVKDFASFHDRGVYVDEKNDPMSASLFQMEG

ASWRALRNKLTPSFTSGKLKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMAT

YAIDIIATTIFGLDVDSFADPNNEFQIISKKVNRNNIEDIIRGTSSFLYPG 

LEKFFVKIGWKQEATERMRELSNRTVDLREQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMS

KDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAISDMKYLEACIL

ETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYF

PDPLAYKPERYLENGKDYTQAAYLPFGEGPRMCI

GARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPLMPKSGVPVRLSLKK

 

>CYP6D5 D. pseudoobscura ortholog Contig7891_Contig7492A.fa.196 75% to 6D5

MIGILLLVAAVSLLYVYLKWTFSYWDRQGFPSAGVTIPFGALDSVRRGKR

SFGMAIYDMYNATKEPVMGMYLTLRPALLVRDPQLAHDILVKDFASFHDR

GIYVDEKNDPMSATIFAMEGSNWRNLRAKLTPSFTSGKLKAMFSTSEAIG

DKMVAHLNGKLPKEGSQEIEMKELLLT

YAVDIIASTIFGLDVDSFADPNN

EFLSITKTINQNTFTDILRGTTSFLFPG

LEKIFVRLGWSQEGPERIRELS

NRTVDLREEKNIERRDLLQLLLQLRNTGKISNDDNMWSAQNDNKGLKSVS

KDLIAGQLFLFFVAGYETTASTAAYTIYELTQNPEVMARALEDVRSTLEK

HDGKLSYDAIQDMKYLEACVL

ETARKYPALPLLNRVCTKEYQIPNSKLIV

KKGTPIIISLIGMHRDAENFPDPLAYKPERYLDENKNFNPTAYMPFGEGPHNCI

GLRMGKVNVKIAVAKILSNFSLEMSKE

KREIEFSVHGIPLMPKGGVPVRISRKK

 

>CYP6D8 Musca Domestica insecticide-susceptible strain TJS FJ911557

56% to Cyp6d5 D. melanogaster

MFLYIIIAVCSAILFYFKWCYSYWQRHGYPYIPAQVPFGVLDPVVRTW

KKSVGMAIYDIYEQTREHKVVGMYLINRPALLVRDAQLARDMLTKDFASFHDRGIYVDEI

HDPMSGGIFFLKGQQWKTLRTKLAPSFTSGKLRGMFDTIHDVSLRMVDHLNGQLPEREFK

QIEVKHLFVTYAIDIIASSIFGLDVDSFSDPQNEFFKLSRNVNENSYRGVFRGTCQFMYP

GLEKIFQRLGWTEPAPDYMKKIVRQTIEKREKHNIVRKDMLQLLLQLRNTGKINGDEDEG

WSAVKTTDALASMSIELIAAQLFLFYVAGFETSAATAAFTIYELARNAELLEKAQEDVEQ

ALAKHGSLSYDSLKDMKFLDLCVMETTRKYPGLPILNRECTKDYPLPDSELVVKKGTPII

ISLFGIHRDEEYFPDALRYDPYRFEKENYNAAAYMPFGEGPRHCIAQRMGKLNVKVGVAQ

ILQHFEVKVDPSAPEIEFDNFGLPIMPKGGVPVTLAKKQKTNVIKS*

 

>CYP6E1 Culex pipiens CPIJ017462

97% to CYP6E1 Culex pipiens quinquefasciatus AB001323

MLLYLVTIVTVMIYVWIKRRYSYWKDRGVPSLEVSFPAGNLQGIGHRHLGLIMQDLYGKL

KGSGAKFGGIYSFLKPMVMVLDLDFAKDVLVREFQYFHDRGMYYNEKDDPLSAHLVSLEG

DKWKSLRTKLTPTFTSGKMKMMFGTIEEVVDRLEGCIRVRVESGECIEIRDIISRFAMDV

IGSCAFGLDCNSLVLSDPPFWKMSLKASTSTKLQSLISLFATTYRKFSNQIGICVLPNDV

SDFYLGAVRDTIKFRMDNQVSRKDFMDLLIKLEDNFTFNEIAAQAFVFFQAGYETSSITM

TFCLYELALNQELQERARKSVEDVLKRHGSFSYDAIQDMEFLNCCVKETLRKYPPVANLF

REITKNYKVPETDITLEKGYRVVIPVYGIHHDPDIYPNPEVFNPERFIPEQSTNRHPMAY

LPFGEGPRTCIGERFALMETKICLSRLLQKFRFKLAPQTSTRIELNKTGVFLSIQGDLWM

KSKKTCHNLTVVTEPAAEN

 

>CYP6E1 AB001323 Culex pipiens quinquefasciatus

MLLYLVTIVTWLVYVWIKRRYSYWKDRGVPSLRVSFPAGNLQGI

GHRHLGLIMQDLYGKLKGSGAKFGGIYSFLKPMVMVLDLDFAKDVLVREFQYFHDRGM

YYNERDDPLSAHLVSLEGDKWKSLRTKLTPTFTSGKMKMMFGTIEEVVDRLEGCIRVR

VESGECIEIRDIISRFAMDVIGSCAFGLDCNSLVLSDPPFWKMSLKASTSTKLQFLIS

LFATTYRKFSNQIGICVLPNDVSDFYLGAVRDTIKFRMDNQASRKDFMDLLIKLEDNF

TFNEIAAQAFVFFQAGYETSSITMTFCLYELALNQELQERARKSVEDVLKRHGSFSYE

TIQDMEFLNCCVKETLRKYPPVANLFREITKNYKVPETDITLEKGYRVVIPVYGIHHD

PDIYPNPEVFNPERFIPELSTNRHPMAYLPFGEGPRTCIGERFALMETKIGLSRLLQK

FRFKLAPQTSTRIELNKTGVFLSIQGNLWMKVKKTCHNLTVVTEPAAEN

 

>CYP6F1 AB001324 Culex pipiens quinquefasciatus Say (mosquito) Culex-2

MFAWIICAAAAVPLVYFLIVYQFSYWKRRGITQLTPSFPFGDLG

PFFRQRSSLGVVYADVYRLCKRLPFVGIYLSLRPMLVVNDPELIKNVLVRDFDHFHDR

GLYVNEEKDPLSGHLFALGGEQWRHHRSKLTPTFTSGRLKEMFTNLVQIGRVLQDHVA

KRAGEDIEIRDVMARYTTDIIASVGFGIENDSINEKGNIFREMGTKVFSPDLKTILRL

TSTFFTPKLNALFGFKFIAQEIEDFIMNVVRETLEYRESNKVVRKDMMQLLMQLRNSG

TVSIDDRWDIEVSTNKKKLSLEQVT AHAFVFFIAAYETSSTTISFCLFELARNPEIQK

KVQQEIDQVLASHNGEITYDNINEMKYLENCIDETLRKYPAVPFLNRECSKDYKIPGT

DTTIEKGTSLVIPVLGLHRDPDHYPEPDRFIPERFSNFEDISTKPYLPFGAGPRNCIG

LRLGKLQTKAGLVMMLSKFNVRLADETYASKELALDARSVVLMPVGGIKVSISERRAS

 

>CPIJ010858 CYP6F1 Culex pipiens

100% to CYP6F1 Culex pipiens quinquefasciatus AB001324

MFAWIICAAAAVPLVYFLIVYQFSYWKRRGITQLTPSFPFGDLGPFFRQRSSLGVVYADV

YRLCKRLPFVGIYLSLRPMLVVNDPELIKNVLVRDFDHFHDRGLYVNEEKDPLSGHLFAL

GGEQWRHHRSKLTPTFTSGRLKEMFTNLVQIGRVLQDHVAKRAGEDIEIRDVMARYTTDI

IASVGFGIENDSINEKGNIFREMGTKVFSPDLKTILRLTSTFFTPKLNALFGFKFIAQEI

EDFIMNVVRETLEYRESNKVVRKDMMQLLMQLRNSGTVSIDDRWDIEVSTNKKKLSLEQV

TAHAFVFFIAAYETSSTTISFCLFELARNPEIQKKVQQEIDQVLASHNGEITYDNINEMK

YLENCIDETLRKYPAVPFLNRECSKDYKIPGTDTTIEKGTSLVIPVLGLHRDPDHYPEPD

RFIPERFSNFEDISTKPYLPFGAGPRNCIGLRLGKLQTKAGLVMMLSKFNVRLADETYAS

KELALDARSVVLMPVGGIKVSISERRAS

 

>CYP6F2 1.1219_1 Aedes aegypti (yellow fever mosquito) CYP6AL2 AAGE01012031 CYP6AL2v1 6T1.2

MTLLSIGVALLCVAAFAFLNYVFGYWKRRGIRQLTPHFPFGNFTDLFFGKASFPKVCENLYERSKQWRLLGGY

VLLRPILLVNDPQLAKDIMVKDFQHFHDRGPHVDEENDPLSGHLFSLAGEKWKHLRAKLT

PTFTSGRLKGMFQTLVDTGEVLQEYIQKYAEGEDVVEIREILARYNTDNIASVAFGIKID

SINNPNEPFRHIGRKVFEPNFRNNMRGLITFMVPKLNKYLKIKSVDDDVEKFILKVVQETLEYREKNGIVRRDMM

QLLLQLRNTGTVSVDERWDVETSDKFKKLTLKEVAAQAHVFFLAGFETSSTTMSFCLYEL

AKHPEIQRRVQAEIDSVTALHDGKLTYDSINDMRYLECCIDETLRKYPPVPVLNRECTQD

YKVPGMDFTIEKGTAIVLQIAGMQHDPQYYPDPMQFKPERFQDPEVKSKPYAPFGDGPRV

CIGMRMGKIQTKVGLCLLLSKFDFELFGHDEPELVMDPNNFVLTPVDGINLKVSCRE*

 

>CYP6F3 1.1219_2 Aedes aegypti (yellow fever mosquito) AAGE01073711

MTPLSIGVALLCVAAFAFLNYVFSYWNRRGVQQLTPYFPFGNFSDLFLGKASFPRVCETLYERTKKWRLLGVYILLRPVL

LVNDPQLAKDIMVKDFQHFHDRGTHVDEENDPLSGHLFSLAGEKWKHLRAKLTPTFTSGRLKGMFQTLVDTGEVLQDYIH

TCAKNEEVVEIREILARYNTDNIASVAFGIKIDSINNPNEPFRQIGRKFFESNFRNNMRLMITFMVPKLNKYFKIKSVDA

EVEQFILGMAKETLEYREKNGVVRKDMMQLLIQLRNTGTVSVDERWDVETSTNSKKLTIGEVAAQAHVFFLAGFETSSST

MSFCLYELAKNPEVQRKVQSEIDSVTALHDGKLTYDSINEMRYLECCIDETLRKYPPVPVLNRECTKDYKVPDSDITIEK

GTAVILQISAMHHDPQYYPDPLRFVPERFLDPDMKGKPYAPFGDGPRICIGLRMGKIQTKVGLCLLLSKFNFELYGHKES

ELVMSPNNFLNTPVNGINLKVSCRE.

 

>CPIJ015223 CYP6F4 Culex pipiens 75% to CYP6F1

MSSWLNAALAVPLLYLLVARQFSYWKRRGVAQLVPVFPFGNLGPFFRQRSCLGVTYAELY

HRWKALPFVGIYFSLRPLLLINDPELIKNVLTRDFEYFHDRGLHVNEGKDPLSGHLFALG

GDKWRHHRSKLTPTFTSGRLKEMFQNLVEIGLVLQEYVGKRAAAGEEVDVRELMARYTTD

VIASVGFGIENDSINDSDNMFRKMGTKVFAQDLKTIVRLASTFFLPKLNALFNFKFIAQD

IEDFMMNVVRETLEYRESNNVVRKDIMQLLMQLRNTGTVSMDKIWKVEAATPSAKQLSLE

QVTAHAFVFFAAGYETSSSTISFCLFELARNVNIQRKLQADIDQVLAKHNGAITYDSINE

MKYLENCIDETLRKYPAVPFLNRECTKDYVIPGTSSTVEKGTTVIIPVLGLQHDPEFYSE

PQKFIPERFSEEATTDKPYLPFGTDPRVCIGLRLGKLQTKMGLVMMLSKFNIRLVDEAYH

SKELELDSKGLFLMPIGGIKVAVSTRSD

 

>CPIJ008972 CYP6F5P Culex pipiens pseudogene

52% to CYP6F1, & = frameshift

MFVEVTIAGAVLLYGLLYYHFRYWKRRGIPQLSPSIPFGDIGPVFRQKQYLAETYATLYH

KSKQFLVAGIYLSLRPVLLVNDPHLIKDILVRDFDHFYSRGVYADEKRDPMSAHLFSIAG

EQWRNLRQKLNPAFSPVRLRGMLPILTDVGRTLQEYIGKCAEAGEVVEVREVMGRYTTDV

IASVAFGLEVDSINDGSNTFRQMGLKVFGNDLKNSLRLACTFFVPEFKELLGFNCAAPEV

EQFIRNVVRETIEYRESNNVSRQDLMQLLLQLRNSGMVSSDGKWDLKVTDGAKSLSLEQI

MANTFAFFFAGYETSSAAISFTLYELAKNP &

SIQRKVQQE &

IDSVLANNSADLTMETWQKCHYLECGLQRSVTGECPRVAFFVK &

RDTQRMTCFPGNETPSSARGGPLPIYISLLGLGRDPQYY

PEPERFIPERFENETEMQTLPFYPFGGGPRTCIAGKLGQLQTKLALALLLSKFDMKLANE

DEGEIRFDPKALTLIPIGGLKLVFTKRT

 

>CPIJ020082 CYP6F6 Culex pipiens

has full length cDNA been determined for this gene?

95% to CPIJ015223 CYP6F4 N-term is in a seq gap

MKLARNVDIQRKLQAEIDQVLAKHNGAITYDSINEMKYLENCIDETLRKYPAVPFLNREC

TKDYVIPGTSSTVEKGTTVIIPVLGLQHDPEFYSEPQKFIPERFSEETTADKPYLPFGTG

PRVCIGLRLGKLQTKMGLVMMLSKFNIRLVDETYNSKELELDSKGLFLMPIGGIKVAVST

RSG*

 

>CYP6g1 AC015208 comp(21239-22935) also AC007440

MVLTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLS

EIYNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYN

NLFFVRDAHWKGIRTKLTPVFTSGKVKQMYTLMQEIGKDLELALQRRGEKNSGSFITEIK

EICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSL

MRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAEPSKPHYAKNQD

FLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEKIQS

LEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPFYDYTLENGTPVFIPIYALHHD

PKYWTNPSQFDPERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLGLVSLLKNHS

VRNCEATMKDMKFDPKGFVLQADGGIHLEIVNDRLYDQSAPSLQ

 

>Cyp6g2 D. melanogaster AC015208 19014-20624

MELVLLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQ

LYNHPDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQN

IFFLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEA

KELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVP

FVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFV

FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTLK

MIESLEFMQMILLEVLRMYPPLPFLDRECTSGRDYSLAPFHKKFVVPKGMPVYIPCYALH

MDPQ

YFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGLVNLLRN

HMITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDALGV

 

>CYP6g2 D. pseudoobscura sequence

MVLGLFLLVVIFLATICFLLQQHYAYWRRRGVRELRPHWILGNLAGLLSMRDSPADFMGQ

LYNHPDALNQPFVGIHVFHRPALLLRDPDLIKRILIKDFGKFSNRYSNSDYKGDPLGSQN

IFFLKNPAWKEVRFKLSPFFTSNKLKSMFPLIVEVGSNLDAYLREQPLHNERTRCFDLEA

KELCALFTTDVIASVAYGVQANSFTQPNGEFRRHGRAVFEFSLKRAAEFTLVFFLPHLVP

LFGFKVVPSEATRFLRNTINYVMAERERSQQTRNDLIDILIEFRRSTQQARAAGDHGQFV

FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDADIQLRVRHEIKEALIASGGQVTLQ

LIDSLEYMQMVLLEVLRMYPPLPFLDRECTAEDEDYSLTPYHGFRVPKGMPIYIPCYALHMDPQ

YFPQPRKFQPERFSPTNRKLQTPYTYMPFGLGPHGCIGERFGLLQAKVGLVNLMRN

HQVTTSERTPRRMKLDPKAIILQAQGGIHLRLVRDPLGI*

 

>CYP6G3 Lucilia cuprina (Australian blowfly) DQ917668.1

Lc_CYP6G revised June 27, 2005 60% to 6G1

MIASSILIFITCILGLVYYWSKHTYSYWQRKGIPYIKPTPIIGNTKEAFQLKTSFGLHLSDIYNDPKVADEAVVGIYTFNQPGLIVREPELLKSILIKDFHYFNNRFSKCDPHGDALGNSNLFFARDSYWKDLRTKISPVFTSGKIKQMYPLMMEVSSQLEHHLAQKGERFQAEVKEICALFTTDLIATIAFGINANSLKNPDGEFRTHCRKIFLFNIPRAIEFSIAFFLPKLVSLFRVKLFTPDFSNFLRSTIKYVMQERENSGKLRNDLIDILVAIKKEVATGNINEAIAKNPDVLVAQAAVFLTAGFETSSSTMTFTLFELAKRPDLQERLREEINEALLKENGNLSYETITTLEYLNMVVEEVLRLYPILPFLDRQHNRPAGEKQGFSLKPYYDYTLPDDMPVYIPIFGIQRDPKHWPNPNTFDPERFSPENKKQHNSMTYMPFGTGPHNCIGMRIGLLQTKIGLVHILKNHKVELCAETPTKSIFDPKAFLLQYENGVPLNVIRDNLYDKNILVK*

 

>CYP6G4 Musca Domestica insecticide-susceptible strain TJS FJ911556.1

60% to Cyp6g1 D. melanogaster

sequence # 2

MIASSVLLAITFLLSALYFWCRQTYRYWQRNGIPYSKPTMFIGNTKEAFSLKTSF

GLHLSNIYNEPKVRDEPVVGIYIFNQPGLVVRDPELIKSVLIKDFHLFTNRYGQCDPHGD

VLGNNNMFFARNAYWKELRTKISPVFTSGKVKQMYPLMLEVASQLENYLSQKGDHFTTEV

KEICALFTTDLISTIAFGINANSIKNPDGEFRSQCRKFFLFTLPRAIDFSVAFFLPKFVS

LLRVKIFPKDFSKFLRSTITHVMTERERTGIPRNDLIDILVALKKEAAKNNHSFMQNHDY

LVAQAAVFLTAGFETSSSTMAFALFEMSKKPDLQDRLRREICNALLSEKNGTLTYEQINS

LEYLNMVVEETLRLYPVLPFLDRQHQKPAGVSKGFTLKPYYDYTLPDGMPIYIPIYALQR

DPKYWPNPNEFDPERFTSENKKSQVSMTYMPFGTGPHNCIGSRIGLLQSKLGLVHFLKNH

RVETCNKTPTCEQFDPKALLLQFEQGITLNVVRDQLYENARKQN*

 

>CYP6H1      Locusta migratoria migratorioides AF115777

MAEVTLALAGCALLALWVLVGWRQSYWRKRGVACPPGWPLLGHV

LNLLLLRRSPGQFFRDLYNQAPGEPLVGFYIFGKPAVLVRSPELLRSVLVKDFAAFAD

RYNISDERSDPLGTRNLFVIKGPEWKYLRAKLSPTFTSGKMRAMFPLVVRCDQQMLDF

MQSRLNARGSAELDIKEVTACCTTDVINTCAFGISSNSLANPGGEFRGLGKKTFEYDI

PRSLEVLVFFFTPYLSRLLGCVYMQKDTNDFLRRVFWETLTAREQSAAAGAPQRHDLI

DHLIQLKNQGAIQADAADADDADDEDAAPALPVNDVDEDVLKRKFDFSGDDLLAQAAI

FFVAGFETSSSTMTFCLYELALQPALQTRLRHEIRDGLQRAGGRFTYSMLHDMRYLDM

VISETLRKYPTLPFLDRTCLRDYPVPGKPGCVIERGTPVYVSLLGLHTDPNYFPHPDV

FDPERFSDKSAIAPFTYMPFGTGPHNCIGMRFGLMSAKAGVAHVLSQYEVSVAADTPV

PLPMATRGIVATTVGGVPLRFQHDPLVELVRPA

 

>CYP6J1   AF281325   Blattella germanica (German cockroach) Jeff Scott 1/20/99

MFEFGSIIVTVIAVFITIPICLYLFLTRHFNFWKKRGVIYVRPL

PFFGNLKDVLLQKKYIGYYLKDIYEENINKPYVGIFAFDQPALLVNDLEIVKNILVKD

SRNFIDRMVKVDESLSPLNANAIFALRGQKWKHVRTSLTPTFTTGKMKNMFYLVDKCG

QQLVLFIEKFAKAENPVAVKDAVERFTMDVTAMCAFGIECNSLQDPKAEFSNLLHRIF

QLSFTSAVANLATFFAPWVQNFFRLKLMDSEIEDRIRDIVWRAVHLREKTGEKRNDLL

DYLMELRTSETSKLDGDDF VAQAFGFLVAGFHTSSMTLTFALYELSVHQDIQTTARTE

IKDVLEHHKKKVTYYSIKDMKYLDMVVNETLRKYPAIPFLDRRCQEDYPLTQDLMLPA

GTGVYIPVYALHHDSKYFPSPAKFDPERFSEKNKQNIPHFAYMPFGEGPRNCIGMRFG

SMQVKAALIHILSNFEVSPCKETRIPLIIDPKPFNLMALGGVYLNITKFNN

 

>CYP6K1 AF281328 Blatella germanica (German cockroach) Jeff Scott 3/9/99

originally called CYP6M1

MVTITGCALCDALVILATLIVAAYLYYAVRFTYWKRKGVVNPKP

LPVFGNFLPSVLQKRSPGQILWDIYKAAEAPFVGFYIFARPAILIKDPNIIKHVLVKD

FNAFSDRHASAAESDTLGSQNLFTLNGAPWKYLRVKLSPTFTSGRMKKMYPLVESCAK

QLQDYLKENCNTKAIEVKETTAKYATDVISTCAFGIESNSLKDPNAEFREFGRKIFEF

TRYRTFEVMALFFSPGLVKFLNGNFFTKETTEFLRKVFWDTINFRESNKISRDDFMDL

LIQLKNKGTIDNEDGEVTEKVDKIDKDSHLFEFTGDNL VSQPALFFTAGFETNATTLS

FTLYELSLQPDLQNRLRSEIAGVMKTSNGKPTYEDVFGMPYLHMVVSETLRKYPPLPL

LDRVCLQDYKVPGTDLIIERDTPVFIALLGLHRDPQYYPNPERYDPERFSEENKRQRK

AYTYLPFGEGPHNCIGLRFGYMAVKTALVHMLAEFEVKPCKDTPIPLELSTRSSVLAT

TSGIPLTFVKSTAQVS

 

>CYP6L1 Blatella germanica (German cockroach) AF227531

MTLVDWFLDTIALLLGLLHIWIARHFQHWEEKGVHHVAPQPLVG

SMLRLLTFSVSPAVFIQGVHEAAGSHPYIGFYIFGRPALLVRDPSLLQHILVKDFSNF

TDRLTSSNKHKDPVGAANLFCIKGNRWRQIRACITHTFSTARLKIMFSRVLNSASVTR

DYILERGNQPINVKDLFVRTSLDSMCSTLFGIESSTLYNSEAQFLHYGHKMMRWTPYR

ALEALAHFFSPELLNVFDTRLFECESTEFLINAFSEAITEREKTGLYCSDLVDSLIQL

KKQLIDVSEHEV LGQAMLFFAAGFETTSSAMAFAMYELALHPEIQDRLRTEIQEVTAC

HGGQVTYEGVKKMSYLDMVVSEVLRKYPPMSFIDRVCLHDYHIPGTDVVIEKGTPIFV

SLLGLHRDSIFYPDPEDFNPERFNKEKKSGVHPFSYIPFGDGPRNCIGLRLGLMSVKL

VIIMLLQSLRVETHESTPVPLQLSPYVLFLKNLGRLPLMFVPIGEDNVETSLA

 

>CYP6M1 Anopheles gambiae CYPm3r7 =, 503aa AAAB01008964.1

MWFPTIEVLVALLALLGGAVYFIVRKQSYWKERGVPHPKPTFFFGSFKDAGTKIHFTEEVERYYAIYKGKHPFMGVYMLTTPVVLPLDLELIKAIFVKDFQYFHDRGTYYNEKHDPLTAHLFNLEGQKWRNLRNKMTPTFTSGKMKMMFPTVVAAGQQLRDFMEENVQKHGEMELKDVMARFTTDVIGTCAFGIECNSMRDPDAEFRAMGKLFMERQPSQFVNMMVQFSPKLSRLLGIRFIDKEVSAFFLKVVRDTIDYRVKNGIQRNDFMDLMIRMLRDTENPEEALTFNEVAAQAFVFFFAGFETSSTLLTWTLYELALNPEVQEKGRQCVQEVLAKHNGEMTYDAIHDMKYLDQILKESLRKYPPVPMHFRMTAQDYRVPDTDSVIEAGTMLFIPIFSIQRDASLFPEPEKFDPERFSAEEEAKRHPFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGFSFAPYEKTSIPMKFITNSFILGPREGLWLKVNKLESKQG*

 

>CYP6M1v2 Anopheles gambiae CYPm3r7 503aa AAAB01008119.1 8 aa diffs with CYP6M1v1

MWFPTIEVLVALLALLGGAVYFIVRKQSYWKERGVPHPKPTFFFGSFKDAGTKIHFTEEV

ERYYAIYKGKHPFMGVYMLTTPVVLPLDLELIKAIFVKDFQYFHDRGTYYNEKHDPLTAH

LFNLEGQKWRNLRNKMTPTFTSGKMKMMFPTVVAAGQQLRDFMEENVQKHGEMELKDVMA

RFTTDVIGTCAFGIECNSMRDPDAEFRAMGKLFMERQPSQFVNMMVQFSPKLSRLLGIRF

IDKEVSAFFLKVVRDTIDYRVKNGIQRNDFMDLMIRMLRDTENPEEALTFNEVAAQAFVF

FFAGFETSSTLLTWTLYELALNPEVQEKGRQCVQEVLAKHNGEMTYDAIHDMKYLDQILK

ESLRKYPPVPMHFRMTAQDYRVPDTDSVIEAGTMLFIPIFSIQRDASLFPEPEKFDPERF

SAEEEAKRHPFAWTPFGEGPRVCIGLRFGMMQARIGLAYLLQGFSFAPYEKTSIPMKFIT

NSFILGPREGLWLKVNKLESKQG*

 

>CYP6M1 Anopheles funestus AAY85600

 1 LNPEIQEKGR KCVKEILEKR NGEMTYEAIL DMKYLDQILN ETLRKYPSVP MHFRMTTQDY

61 RVPNTDSVIE AGTRVLIPIF AIQRDSDIFP EPEKFDPERF SPEEEAKRHP FAWI

 

>CYP6M2 Anopheles gambiae CYPm3r9 499aa AAAB01008964.1

MFSLLDFTFLVAALAAGLYYYLDRKRSYWQDRGVPGPKGELLFGNFGSIGTKEHITVPFK RIYDDNKGKHPFAGMYQFVKPVALITDLELLKCVFVKDFQYFHDRGTFYNERDDPLSAHL FNLEGQKWRSLRNKLSPTFTSGKMKMMFPTIVTAGKQFKDFMEETVLRENEFELKDLLAR FTTDVIGMCAFGIECNSMRNPDAEFRAMGRKIFEISPGTFKTMMMNGMPELAKMLRMTQT DKDVSDFFMNAVRDTINYRVKNNVQRNDFVDLLIKMMSKDGEKSDDDSLTFNEIAAQAFV FFLAGFETSSTLLTWTLYELALNPEVQEKGRECVREILQKHNGEMSYDAVVEMKYLDQILN ESLRKYPPVPVHFRVASKDYHVPGTKSVLEAGTAVMIPVHAIHHDPEVFPNPEQFDPERF SPEQEAKRHPYAWTPFGEGPRICVGLRFGMMQARIGLAYLLDGFRFAPSSKTVIPMELSK

ESFIMAPKGGLWLKVDKI*

 

>CYP6M3 Anopheles gambiae CYPm3r10 500aa AAAB01008964.1

MEPLDILISVVMLCLAVYFLLDRRFQYWTDRGVPQSKPELVFGNVREVSRTIHLADKFRE IYNELKGKHPLVGVYLFFKPVALITDLELLKCVFVKDFQYFHDRGTYYNEKHDPLTAHLF NIEGQKWKNLRNKLSPTFTSGKMKMMFSTIVAAGKQFKDFMEETVHEQVDFELKDVLARF TTDVIGMCAFGIECNSMRNPDAEFRVMGRKIFSKPRGKVKSLVINSMPRLAKLIGLRTLD PEVSDFFMNAVRDTIKYRVENNVQRNDFMDILIRMRSDKETKSDDGTLTFNEIAAQAFVF FLAGFETSSTLLTFTLYELALNQEVQDKGRRCVKEVLAKHNGELTYDAVMEMNYLDQILK ESLRKYPPVPVHFRETSKEYQVPGTKTVLEAGTSVMVPVHAIHRDPEHFPDPERFDPDRF TAEQEAKRHPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTGFRFTPSAKTIVPMEFDI

KSFILSPAGGLWLKVEKLNS*

 

>CYP6M4 Anopheles gambiae CYPm3r11 501aa AAAB01008964.1

MEFYDVAVTVGMLCIIIYLLLVRQFRYWTERNVPQLNPHLLFGDVRDVNKTHHIGEKFRQ LYNELKGKHPFGGIYMFTKPVALVTDLELVKNVFVKDFQYFHDRGTYYDEKHDPLSAHLF NLEGYKWKSLRNKITPTFTSGKMKMMFPTVAAAGKQFKDYLEDAIGEQEEFELKELLARY TTDVIGTCAFGIECNSMRNPNAEFRVMGKKIFGRSRSNLQLLLMNAFPSVAKLVGIKLIL PEVSDFFMNAVRDTIKYRVENNVQRNDFMDILIRMRSDKETKSDDGTLTFHEIAAQAFVF FVAGFETSSSLMAFTLYELALDQDMQDKARKCVTDVLERHNGELTYEAAMEMDYLDCVLK ECLRKHPPVSVHFRITAKDYIVPGTNSVLEAGTSVMIPVLGIHHDPEHFPEPERFDPERF TAEQESKRHPYAWTPFGEGPRICVGPRFGLLQARIGLIYLLTSFRFVRCSKTPVPLRYAL

KNQILSPEAGMWLKLEKLNEV*

 

>CYP6M5 Aedes aegypti (mosquito) 1.371_12 CYP6M5 CYP6M5v2 6I1.1

MEVITITLLTILILLLIYVLHLLRRQIHFFKDRNVPYKPASFERLDKTIHPAMHFLRWYKQFKGQYPLSGVFMFIKPIVI

PLDLELIKRILVKDFQYFQNRGIYYNERDDPLSAHLFSLEGAKWRNLRAKISPTFTSGKMKMMYPTMVAAGKQFSEYLEE

KVGDGNELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFEAPRNVLKDAFKMTAPGLARFLRVTEILPDV

SEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDKTEGSESLTISEIAAQAYVFFIAGFETSSTTMTWALHELSRNPDI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDQIINETLRLYPPVPMHFRVVSKDYHVPETDTILPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVNKRHAFAWTPFGEGPRVCIGLRFGMMQARIGLALMLKNLRFSPGPKTCTEMEFQPQNFIL

SPKEGLWLNVEKI*

 

>CYP6M5v1 Aedes aegypti (mosquito) 6I1.4 67% to CYP6M2,

66% to CYP6M1, 97% to 6I1.1

QAFVFFFAGF ETSSTTMTWA LHELSRNPDI QEEGRKCVQE VLEKYNGVMS

YEAIMEMTYI DQIINETLRL YPPVPMHFRV VSKDYHVPET DTILPAGTFT

MIPVYAIHHD EDIFPEPEKF DPTRFTPEEV NKRHAFAWTP FGEGPRVCIG

MRLG

 

>CYP6M5v2 Aedes aegypti (mosquito) 6I1.1 66% to CYP6M2, 97% to 6I1.4

QVFLFFVAGF ETSSTTMTWA LHELSRNPDI QEEGRKCVQE VLEKYNGVMS

YEAIMEMTYI DQIINETLRL YPPVPMHFRV VSKDYHVPET DTILPAGTFT

MIPVYAIHHD EDIFPEPEKF DPTRFTPEEV NKRHAFAWTP FGEGPRVCIG

LRLG

 

>CYP6M6 Aedes aegypti (mosquito) 1.371_11 CYP6M6 AAGE01004894 CYP6M6 6T1-1

MDVFLLIAAFVLLVAYGLHLLRKQVNFWADRNVPHNPVNFRQTVDQTVHMARRFQGYYHQFK

GQYPFAGMYLFTKPVALAIDLELLKCIFVKDFQYFHDRGTYYNEKDDPLSAHLFNLEGN

KWRNLRSKISPTFTSGKMKMMYPTMIAAGKQFSEYMDEKVGVEQELELKDLLARFTTDVI

GMCAFGIECNSMKDPNAEFREKGRMHFETPRNRKKDMMCSIAPKLARMMGLKQIIPDLSD

FFLGVVRETIDYRVKNGVRRNDFMDLLIGMLTGENVELGP

LTFNEVAAQAFVFFVAGFETSSTTMTWALYELSVNQDIQEKGRKCVRDVLEKYNGEL

SYETIMEMSYIDHILHETLRKYPPVPVHFRIVTKDYKVPNTETVLPAGTSVMIPVYAVHHDPEIFPDPK RFDPDRFTTEEINKRHPYAWTPFGEGPRICIGMRFGMMQARIGLALLLNNFRFSSG

KKSTVPLDFTAKSFILSPDEGLWLKVEKL*

 

>CYP6M6 Aedes aegypti (mosquito) 6T1-1 72% to CYP6M3,

70% to CYP6M2, 77% to 6I1.4, 75% to 6I1.1

QAFMFFLAGF ETSSTTMTWA LYELSVNQDI QEKGRKCVRD VLEKYNGELS

YEAIMEMSYI DHILHETLRK YPPVPVHFRI VTKDYKVPNT ETVLPAGTSV

MIPVYAVHHD PEIFPDPERF DPDRFTTEEI NKRHPYAWTP FGEGPRICIG

MRLG

 

>CYP6M7 Anopheles funestus GenPept AAV68095

  1 LYELALNQDA QDKGRRCVKE VLERHNGELT YDAVMEMHYL DQIPKESLRK YPPVPVHFRT

 61 TSKEYQVPGT KTVLEAGTSV MVPVYAIHRD PEHFPNPDLF DPDRFTPEEE AKRHPYAWTP

121 FGEGP

 

>CYP6M8 Anopheles funestus GenPept AAV68096

  1 LYELALNPEV QEQGRKCVRE VLKKHNGEMS YDAVVDMKYL DQILNESLRK YPPVPVHFRV

 61 ASKDYQVPGT KSVLEAGTAV MVPVHAIHHD PAVFPDPERY DPERFSPEQE AKRHPYAWTP

121 FGEGP

 

>CYP6M9 Aedes aegypti (mosquito) 1.371_13 AAGE01032555 CYP6M5v2 6I1.1

MEVITITLLTILVLLIAYASHLLRRQIRFFKDRNVPHIPASFELLDKTIHPAKHFLRWYKQFKGQYPLTGVIMFIKPIAI

PLDLDLIKRILVKDFQYFQNRGIYYNERDDPLSAHLFSLEGAKWRSLRAKISPTFTSGKMKMMYPTMVAAGKQFSEYLEE

KVEDGNELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFEAPRNALKDAFKMTAPGLARFLRVTEILPDV

SEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDKTEGSESLTINEIAAQAYVFFIAGFETSSTTMTWALHELSRNPDI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDQIINETLRLYPPVPMHFRVVSKDYHVPETDTILPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVNKRHAFAWTPFGEGPRVCIGLRFGMMQARIGLALMLKNLRFSPGPKTCTEMEFQPQNFIL

SPKEGLWLNVEKI.

 

>CYP6M10 Aedes aegypti (mosquito) 1.371_14 AY433475 AAGE01031181

MEPITIILVTILVLLLTYGFHLIRRQLRFFKDHNVPHIAGNFVLIDKTQHPANHFLRWYKQSKGQYPLTGVFMFIKPIAI

PLDLELIKRILVKDFQYFQNRGMYYNERDDPLSAHLFSLEGAKWRSLRAKISPTFTSGKMKMMYPTMMAAGKQFSEHLEE

KMSEENELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFESPRSGLKDLLKITAPGLARFFGVTEILPDV

AEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDETEGSESLTISEIAAQAYVFFIAGFETSSTTMTWALHELSRNPEI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDYIINETLRLYPPVPLHFRVVTKDYPVPGTDTVLPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVSKRHAYAWTPFGEGPRICIGLRFGMMQARIGLALLLNNLRFSPGPKSCTKMEFQPENLIL

TPKQGLWLKVEKV.

 

>CYP6M11 Aedes aegypti (mosquito) 1.371_15 AAGE01105997

MEPLDVAITVVMVALAVYMYLDKKHSYWADRKVPFVKPKFFYGNAKEISQTMQVGQVFQQFYHELKGRSPFGGIYMFTAPVAVVTDLELLKCIFVKDFQYFHDRGTFYSEKGDPLSAHMFNLEGNKWKMLRNKLSPTFTSGKMKMMFPTIVAAGKQFHDFMDEKVKQESEFELKDLLARFTTDVIGMCAFGIECNSIKDPDAQFRVMGRKLFTTGRSKPKSFLMNTMPKVAKLLRLRIFPADVSDFFMKVVRETIDYRMANNVHRNDFMDLLIQMRNPDENKSSEGLLSFNEIAAQAFVFYLAGFETSSTLLTWTLYELAVNQDIQEKGRQHVKEVLKKHDGEMTYESITSMKYLDQILNEALRKYPPVPVHFRETSKDYTVPDSNIVIEGGTRLFVPVYAIHHDPEIFPNPEQFNPDRFTPEEEQKRHPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLNSFKFSIGEKCKVPLEFDVKSFILAPKGGLWLKVEKI.

 

>CYP6M12 Culex_quinquefasciatus_06 83% to CYP6M6 Aedes

MHMARRFQGYYQQFKEQYPFCGIYFFTKPVALAIDLELLKCIFVKDFQYFHDRGTYYNERDDPLSAHLFNLEGTKWKNLRTKISPTFTSGKMKMMYPTMIAAGKQFSEYMDEKVSQENEFELKDLLARFTTDVIGMCAFGIECNSMKDPDAQFRVMGRKHFDTPRVRWRDSLCAVAPKLARFLGMRQIVPELSDFFIGIVRETIDYRVKNNVRRNDFMDLLIAMMQGENSELGPLTFNEIAAQAFVFFIAGFETSSTTMTWALYELSVNQEVQERARKCVQDVLQKYNGEMSYDAVMEMAYIDQILQETLRKYPPVPVHFRVVSKDYQVPDTNTILPAGTSLMIPVYAVHHDPEIFPEPERFDPDRFTPEEIAKRHPYAWTPFGEGPRICIGMRFGMMQARIGLALLLKSFRFSTGQKSTVPLDFTAKSFILSPEEGLWLKVDKV

 

>CPIJ016849 CYP6M12 Culex pipiens 99% to CYP6M12 Culex_quinquefasciatus

& = frameshift

MVLPALLFIVAGLLLYVYYRYRKQRSFWADRGVPHVPANFRRNLDPAPMHMARRFQGYYQQFKGQYPFCGIYFFTKPVAL

AIDLELLKCIFVKDFQYFHDRGTYYNERDDPLSAHLFNLEGTKWKNLRTKISPTFTSGKMKMMYPTMIAAGKQFSEYMDE

KVSQENEFELKDLLARFTTDVIGMCAFGIECNSMKDPDAQFRVMGRKHFDTPRVRWRDSLCAVAPKLARFLGMRQIVPEL

SDFFIGIVRETIDYRVKNNVRRNDFMDLLIAMMQGENSELGPLTFNEIAAQAFVFFIAGFETSSTTMTWALYELSVNQEV

QERARKCVQDVLQKHNGEMSYDAVMDMAYIDQILQ (1)

ETLRKY &

PPVPVHFRVVSKDYQVPDTNTILPAGTSLMIPVYAVHHD

PEIFPEPERFDPDRFTPEKIAKRHPYAWTPFGEGPRICIGMRFGMMQARIGLALLLKSFRFSTGQKSTVPLDFTAKSFIL

SPEEGLWLKVDKV.

 

>CPIJ016846 CYP6M13 Culex pipiens 72% to CYP6M11

MLEPLDAIITVAMICLGLYFYMDKKYSYWKDRDVPYLKPEFFYGNSRTMTRTEQTGQMFA

RFYEELKGEDHPFGGAFVFTRPIAIVTDLELAKCVFAKDFQYFHDRGTYYNEKYDPLSAH

MFNLSGPKWKNLRHKLSPTFTSGKMKMMFSTIIAAGKQFRDFLDEKVSHESEFELKSLLA

RYTTDVIGICAFGLECNSMRDPDAQFRVIGRKIFGNPRGMVKGFLIATMPRFAQFIGVKE

ILPEVSEFFFKVVRETVDYRVKNNVKRNDFMDLLIQMRNPDESKSDDGLLSFNEIAAQAF

VFYLAGFETSSTLLTWTLYELALNQDIQEKGRQHVREVLSKYNREITYESVTAMKYLDQI

LQESLRKYPPVPIHFREVAKDYQVPETKTVLTAGTRVFIPVLGIHHDPDIFPDPERFDPD

RFSPEQEAKRNPYAWTPFGEGPRICIGMRFGMMQARIALGYLLHSFKFSIGKKCQVPLQM

DEKSFVLSPKGGLWLKVEKI

 

>CPIJ016848 CYP6M14 Culex pipiens 74% to CYP6M11

MLDFWDVFTAVLVICLGVLYYIKKQHSYWADRNVPFSKPVFLYGNAKPMGRTEQAGTLFK

RLYNELKGKHPFGGIYMFTKPVALITDLELLKCVFAKDFQYFHDRGTYYNEKDDPLSAHM

FNLPGSKWKNLRHKLSPTFTSGKMKMMFPTIVAAGKQFNDFLHEKVSHECEFELKDLLAR

YTTDVIGMCAFGIECNSLKDPDAQFRVMGRKIFETPRGRIKSMLTNATPNFARFIGVKLS

VPEVEQFFLRVVRETIDYRVKNNVKRNDFMDLLIQMRSPDDTKSDDGLLSFNEIAAQAFV

FYLAGFETSSTLLTWTLYELALNQDIQEKGRQHVKEVLPKYNGEMSYESITAMKYLDQIL

NESLRKYPPVPIHFREVAKDYQVPNTKSVLEAGTQVFIPVYGIHHDPEVFPDPEKFDPER

FSPEQEANRNPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTNFRFSIGEKCKVPLELN

KKSFILAPEGGLWLKVEKL

 

>CPIJ019700 CYP6M15 Culex pipiens 73% to CYP6M11

MLEPLDAIITVAMICLGLYFYMDKKYSYWKDRDVPYLKPEFFYGNSRTMTRTEQTGQLFA

RFYEELKGEDHPFGGAYVFTRPVAIVTDLELAKCVFAKDFQYFHDRGTYYNERYDPLSAH

MFNLSGPKWKNLRHKLSPTFTSGKMKMMFSTIIAAGKQFRDFLDEKVSHESEFELKDLLA

RYTTDVIGTCAFGLECNSMRDPDAQFRVIGRKIFGNPRGMVKGFLIATMPRFAQFIGVKE

ILPEVSEFFFKVVRETVDYRVKNNVKRNDFMDLLIQMRNPDENKSDDGLLSFNEIAAQAF

VFYLAGFETSSTLLTWTLYELALNQDIQEKGRQHVREVLSKYNREITYESVTAMKYLDQI

LQESLRKYPPVPIHFREVAKDYQVPETKTVLTAGTRVFIPVLGIHHDPDIFPDPERFDPD

RFLPEQEAKRNPYAWTPFGEGPRICIGMRFGMMQARIALGYLLHSFKFSIGEKCQVPLQM

DEKSFVLSPKGGLWLKVEKI

 

>CPIJ019702 CYP6M16 Culex pipiens

MLDFWDVFTAVLVICLGVVYYIKKQHSYWADRNVPFSKPVFLYGNAKPMGRTEQAGTLFK

RLYNELKGKHPFGGIYMFTKPVALITDLELLKCVFAKDFQYFHDRGTYYNEKDDPLSAHM

FNLPGSKWKNLRHKLSPTFTSGKMKMMFPTIVAAGKQFNDFLHEKVSHESEFELKDLLAR

YTTDVIGMCAFGIECNSMKDPDAQFRVMGRKIFETPRGRIKSMLTNATPNFARFIGVKLS

IPEVEQFFLRVVRETIDYRVKNNVKRNDFMDLLIQMRSPDDTKSDDGLLSFNEIAAQAFV

FYLAGFETSSTLLTWTLYELALNQDIQEKGRQHVKEVLPKYNGEMSYESVTAMKYLDQIL

NESLRKYPPVPIHFREVAKDYQVPNTKSVLEAGTQVFIPVYGIHHDPEVFPDPEKFDPDR

FSPEQEANRNPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLTNFRFSIGEKCKVPLELN

KKSFILAPEGGLWLKVEKL

 

>CYP6N1 Anopheles gambiae 52% to 6Q1 Hilary Ranson 8/9/99  CLONE NAME 12D2

MWISLLVLTLLAAVYWIRQRLAYWEKRGVPYVPPSFPHGNLGGFGKKLHMSAILQNCYKQLKSSGQPFGGIHFFINPVAL

LIDPDLIKTVLVKDFSYFHDRNLYYNERDDPLSHHLVAMEGTRWKNLRAKLTPTFTSGKMKLMFSTVTAVAEEFDRCMMN

EIKTSPVVEMKDLLARFTTDIIGSVAFGLECNSLKDPEAKFRAMGRKVFQLSPYRALKIFLSAQFPKIARTLRVKLTQPD

VAEFFMGAVKDTVEFRQINNVQRNDFMMLLMKMLKEQMEQDGTAGDLKDRITIED

VAAQAFVFFLAGFETSSTAMSFCLY

ELALNQELQDKARQNITDVMKQHSSITYEAVHEMKYIEMCINESMRKYPPITTLTRRVEKDYRVPDTDKVLQEGIMAAIP

VYALHHDPEHFPNPEQFDPDRFTAEQEAKRHPFVYLPFGEGPRICIGLRFGMMQARIGLVYLLKHFRFTLAKDRMSVPLK

ITPSSTILTIDGGLWLDVNVEQLM

 

>CYP6N1v1 Anopheles gambiae CYPm3r8 501 aa AAAB01008964.1 allele of CYP6N1v2

MWIHLLVITLLAAVYWVRQRFAYWEKRGVPYVPPTFPQGNLAGVGKKRHMSEILQSCYKQ LKSSGRPYGGIHFFINPVALLIDPDLIKTVLVKDFPYFHDRNLYHNDRDDPLSRHLVAME

GSKWKNLRAKLTPTVHSGKMK

ILTIDGGLWLNVEQL*

 

>CYP6N1v2 Anopheles gambiae CYPm3r8 501 aa AAAB01008119.1 allele of CYP6N1v1

MWIHLLVITLLVAVYWVRQRFAYWEKRGVPYVPPTFPQGNLAGVGKKRHMSEILQSCYKQ LKSSGRPYGGIHFFINPVALLIDPDLIKTVLVKDFPYFHDRNLYHNDRDDPLSRHLVAME GSKWKNLRAKLTPTFTSGKMKLMFSTVTAVAEEFDRCMSDEVKINPVVEMKDLLARFTTD VIGSVAFGLECNSLKDPDAKFRVMGRKVFQASPYRALKIFLAAQFPEIARALHVKLTQPD VSDFFMGVVKDTIDFRRNNNVQRNDFMTLLMKVMKEQIENGEAGGDPKDQLTMDDIAAQA FVFFLAGFETSSTAMSFCLYELALNQELQDKARQNIAEVLKNYDTISYEAVHEMKYIEMCIN  ESLRKYPPATTLTRRVEKDYRVAGTDQVLEKGIMVAVPVYALHHDPEHFPNPEQFDPERF  TAKQSEKRHPFAFLPFGEGPRICIGLRFGMMQARIGLVYLLKHFRFTLANDRMSVPLKIS 

SASPILTIDGGLWLNVERL*

 

>CYP6N2 Anopheles gambiae CYPm3r4 =, 501aa 2 aa diffs with CYP6N2 04IgeneA of Hilary Ranson

MLLYLLLLAVTAAIWYVRRKYTFWADRGVPYVKPRFPFGNIQGIGRRMHSSQLMTKFYNEMKTSGRPFGGIYFFTNPVALALELDFVKNVLVRDFAHFHDRGVYYNEKDDPISGHLFNIEGTKWTNLRKKLIPTFSSGKMKMMCPTIVSVGGQFRECLERCIAHSDGEVEMKELLARFTTDVIGTCAFGIECNSLNDPNAEFLRMGRKVFEVPRGRILKFFFMATFKDFSRRIHIKGTAEDVSQFFFKVVRETIEYREQNNIVRNDFMNLLMQLKNSGQLDGSGEEVGKLSLNEIVAQAFVFFLGGFETSSTTMSYCLYELALNEAIQQRARECVVEAVKTHGGLSYEALMDMPYIDQCINESLRKYPPGANLIRQVSQDYRVPGTDVTFPKGMNVMIPVYAIHHDADNYPDPERYDPDRFAPEACESRKPYSFIPFGEGPRICIAARFGMLEARVGLAVLLMHFSFARCSKTNVPLVISSRHAVLTPEGGLWLKVEKLKE*

 

>CYP6N2 Anopheles funestus AY987357

ALNEQIQQRARQCVLDAVKKHGGLSYEALMDMPYIDQRINESLR

KYPPGANLIRQVSQDYRVPGTDVTFPKGMNVMIPVYAIHHDPEHYPDPERYDPDRFAA

DASEARKPYSFIPFGEGP

 

>CYP6N3v1 Aedes albopictus AF283836

MLIYLTVLALTLAVLWVRKRYSYWKERGIPYVEPSFPSGNIRGM

GRKEHFSTQMQRCYKELKGKGPVGGVFFFINPVALAMDLDFIKTVLVKDFQYFHDRSI

YYNEKDDPLSAHLVALEGTKWKNLRAKLTPTFTSGKMKSMYPTIIGVAEEFQKMMESE

VGGNTEIEMKDVLARFTTDVIGTCAFGLECNSLYDPDAQFRCMGRKIFAIAKGRFVKL

IAAQQFRSLARSLHVTLIDKEVSDFFIGAVKDTIKYREENNIERNDFMSLLMKLKKVD

NSDNTGEDSEALTDEQIAAQAFVFFLAGFETSSTAMSNSLYELAQNSELQDKARKSVM

DSIKKHGSLTYEAIQDMQYIDQCINESLRKYPPASNLTRIVSKDYKLPNCDVVLQQGS

TIIVPVYALHHDAEYYPNPEKYDPDRFTPEEVAKRNPYCFLPFGEGPRNCIGMRFGIM

QARVGLAYLLKDFSFTLSSKTPVPLKISPHNPILTSEGGLWLNVEKL

 

>CYP6N3v2 Aedes albopictus AF283837

MLIYLTVLALTLAVLWVRKRYSYWKERGIPYVEPSFPSGNIRGM

GRKEHFSTQMQRCYKELKGKGPVGGVFFFINPVALAMDLDFIKTVLVKDFQYFHDRSI

YYNEKDDPLSAHLVALEGTKWKNLRAKLTPTFTSGKMKSMYPTIIGVAEEFQKMMESE

VGGNTEIEMKDVLARFTTDVIGTCAFGLECNSLHDPDAQFRRMGRKIFAIAKGRFVKL

IAAQQFRSLARSLHVTLIDKEVSDFFIGAVKDTIKYREENNIERNDFMSLLMKLKKVD

NSDNTGEDSEALTDEQIAAQAFVFFLAGFETSSTAMSNSLYELAQNSELQDKARKSVM

DSIKKHGSLTYEAIQDMQYIDQCINESLRKYPPASNLTRIVSKDYKLPNCDVVLQQGS

TIIVPVYALHHDAEYYPNPEKYDPDRFTPEEVAKRNPYCFLPFGEGPRNCIGMRFGIM

QARVGLAYLLKDFSFTLSSKTPVPLKISPHNPILTSEGGLWLNVKKL

 

>CYP6N3v3 Aedes albopictus AF283838

MLIYLTVLALTLAVLWVRKRYSYWKERGIPYVEPSFPSGNIRGM

GRKEHFSTQMQRCYKELKGKGPVGGVFFFINPVALAMDLDFIKTVLVKDFQYFHDRSI

YYNEKDDPLSAHLVALEGTKWKNLRAKLTPTFTSGKMKSMYPTIIGVAEEFQKMMESE

VGGNTEIEMKDVLARFTTDVIGTCAFGLECNSLHDPDAQFRRMGRKIFAIAKGRFVKL

IAAQQFRSLARSLHVTLIDKEVSDFFIGAVKDTIKYREENNIERNDFMSLLMKLKKVD

NSDNTGEDSEALTDEQIAAQAFVFFLAGFETSSTAMSNSLYELAQNSELQDKARKSVM

DSIKKHGSLTYEAIQDMQYIDQCINESLRKYPPASNLTRIVSKDYKLPNCDVVLQQGS

TIIVPVYALHHDAEYYPNPEKYDPDRFTSEEVAKRNPYCFLPFGEGPRNCIGMRFGMM

QARVGLAYLLKDFSFTLSSKTPVPLKISPHNPILTSEGGLWLNVEKL

 

>CYP6N3v4 Aedes albopictus AF284783

VDNSDNTGEDSEALTDEQIAAQAFVFFLAGFETSSTAMSNSLYE

LAQNSELQDKARKSVMDSIKKHGSLTYEAIQDMQYIDQCINESLRKYPPTSNLTRIVS

KDYKLPNCDVVLQQGSTIIVPVYALHHDAEYYPNPEKYDPDRFTPEEVAKRNPYCFLP

FGEGPRNCIGMRFGIMQARVGLAYLLKDFNFTLSSKTPVPLKISPHNPILTSEGGLWL

NVEKL

 

>CYP6N4v1 Aedes albopictus AF284782

MLVYLTVLALTLAILWVRRRYSYWKERGIPYVEPSFPAGNLRGM

GRTEHLSAQMQRCYKELKGKGPVGGMFFFINPVALAMDLDLIKTVLVKDFQYFHDRSV

YYNEKDDPLSGHLFSMEGAKWKNLRAKLTPTFTSGKMKMMLPTIVGVADEFQKLMESE

VKKSSEIEMKEILARFTTDVIGTCAFGLECNSLHDPDAQFRRMGRKIFSFGSGRLLKA

IVAQQFRSLARSLHISLIDKEVSDFFMGAVKDTIKYREENKIERNDFMSLLMKLKNAE

SLGDDKNVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYCLYELAQRADLQNKARKCV

LDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPASNLTRTVSKDYKLPNSNVVLQQG

STLIVPVYALHHDAEYYPNPEKYDPDRFTPGEVAKRNPYCFLP

 

>CYP6N4v2 Aedes albopictus AF284784

NVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYYLYELAQRADL

QNKARKCVLDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPVSNLTRTVSKDYKLPN

SNVVLQQGSTLIVPVYALHHDAEYYPNPEKYDPDRFTPEEMAKRNPYCFLPFGEGPRV

CIGLRFGMMQARVGLAYLLRDFSFKLSSQTPVPLKISPRSPVLTSEGGLWLKVEKL

 

>CYP6N4v3 Aedes albopictus AF284785

NVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYCLYELAQRADL

QNKARKCVLDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPVSNLTRTVSKDYKLPN

SNVVLQQGSTLIVPVYALHHDAEYYPNPEKYDPDRFTPEEMAKRNPYCFLPFGEGPRV

CIGLRFGMMQARVGLAYLLRDFSFKLSSQTPVPLKISPRSPVLTSEGGLWLKVEKL

 

>CYP6N4v4 Aedes albopictus AF284786

NVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYCLYELAQRADL

QNKARKCVLDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPASNLTRTVSKDYKLPN

SNVVLQQGSTLIVPVYALHHDAEYYPNPEKYDPDRFTPEEMAKRNPYCFLPFGEGPRI

YIGLRFGMMQARVGLAYLLRDFSFTLSSQTPVPLKISPRSPVLTSEGGLWLKVEKL

 

>CYP6N4v5 Aedes albopictus AF284787

NVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYCLYELAQRADL

QNKARKCVLDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPASNLTRTVSKDYKLPN

SNVVLQQGSTLIVPVYALHHDAEYYPNPEKYDPDRFTPEEMAKRNPYCFLPFGEGPRI

CIGLRFGMMQARVGLAYLLRDFSFTLSSQTPVPLKISPRSPVLTSEGGLWLKVEKL

 

>CYP6N4v6 Aedes albopictus AF284788

NVPTEALTVEEVAAQAFVFFLAGFETSSTAMSYCLYELAQRADL

QNKARKCVLDAIKKHGSLTYEAMQDMQYIDQCINESLRKYPPASNLTRTVSKDYKLPN

SNVVLQQGSTLIVPVYALHHNAEYYPNPEKYDPDRFTPEEMAKRNPYCFLPFGEGPRI

CIGLRFGMMQARVGLAYLLRDSSFTLSSQTPVPLKISPRSPVLTSEGGLWLKVEKL

 

>CYP6N5 Aedes aegypti CYPm3r8 =, 501 aa not same gene as 6N1 h.r. (only 82%)

MWIHLLVITLLVAVYWVRQRFAYWEKRGVPYVPPTFPQGNLAGVGKKRHMSEILQSCYKQLKSSGRPYGGIHFFINPVALLIDPDLIKTVLVKDFPYFHDRNLYHNDRDDPLSRHLVAMEGSKWKNLRAKLTPTFTSGKMKLMFSTVTAVAEEFDRCMSDEVKINPVVEMKDLLARFTTDVIGSVAFGLECNSLKDPDAKFRVMGRKVFQASPYRALKIFLAAQFPEIARALHVKLTQPDVSDFFMGVVKDTIDFRRNNNVQRNDFMTLLMKVMKEQIENGEAGGDPKDQLTMDDIAAQAFVFFLAGFETSSTAMSFCLYELALNQELQDKARQNIAEVLKNYDTISYEAVHEMKYIEMCINESLRKYPPATTLTRRVEKDYRVAGTDQVLEKGIMVAVPVYALHHDPEHFPNPEQFDPERFTAKQSEKRHPFAFLPFGEGPRICIGLRFGMMQARIGLVYLLKHFRFTLANDRMSVPLKISSASPILTIDGGLWLNVERL*

 

>CYP6N6 Aedes aegypti 1.371_4 AAGE01504815 88% to CYP6N3v1 Aedes albopictus CYP6N6v1 6T1.4

MWIYLTVLALTLAVLWVRKRYAYWKERGIPYVEPSFPAGNIR

GMGRKEHFSTQMQRCYKELKGKGPVGGVFFFINPVPLALDLDFIKTVLVKDFQYFHDRSI

YYNEKDDPLSAHLVALEGAKWKNLRTKLTPTFTSGKMKTMFPTIIGVADEFQKMMKNEVV

GNTEIEMKDILARFTTDVIGTCAFGIECNSLQDPNAQ

FRRMGRKIFSVAKGRLLKLITAQQFRSLARMLGITLIDK

DVSDFFIGAVRDTIKYREENKIERNDFMSLLMKLKNDESSQDTNSGDVE

TLTVEQIAAQAFVFFLAGFETSSTAMSNSLYELAQNSDLQNKARKSVMDAIKKYGSLTYE

AMQDMQYIDQCINESLRKYPPASNLTRTVSTDYKLPDSNVVLQQGSTLIVPVYALHHDA

EYYPDPEKYDPDRFTPEEVAKRNPYCFLPFGEGPRNCIGMRFGMLQARVGLAYLLRDFSF

TLSNKTPVPLKISPHSPILTSEGGLWLNVRKL*

 

>CYP6N6v1 Aedes aegypti 6T1.4 62% to CYP6N2, 97% to 6I2.2

 QVFVFFLAGF ETSSTAMSNS LYELAQNSDL QNKARKSVMD AIKKYGSLTY

 EAMQDMQYID QCINESLRKY PPASNLTRTV STDYKLPDSN VVLQQGSTLI

 VPVYALHHDA EYYPDPEKYD PDRFTPEEVA KRNPYCFLPF GEGPRNCIGL

 RLG

 

>CYP6N6v2 Aedes aegypti 6I2.2 61% to CYP6N2, 97% to 6T1.4

 QVFMFFVAGF ETSSTAMSNS LYELAQNSDL QNKARKSVLD AIKKHGSLTY

 EAMQDMQYID QCINESLRKY PPASNLTRTV STDYKLPDSN VVLQQGSTLI

 VPVYALHHDA EYYPDPEKYD PDRFTPEEVA KRNPYCFLPF GEGPRNCIGL

 RLG

 

>CYP6N7 Ochlerotatus sollicitans DQ427077

ETLRKYPPLPNILRNVTKPYHVPDMNVTLEEGYRVLLPVYAIHH

GPEYYPDPERYDPDRFTPEQVEKRNPYCFLPFGEGPRICI

 

>CYP6N8 Ochlerotatus sollicitans DQ427073

ETLRKYPPFMTIIRQVTKDYYDPDMNVTLEKGNGLIISVHAIHN

DARLYPEPERFDPERFSPEEVAKRHPMAFIPFGEGPSICI

 

>CYP6N9 Aedes aegypti 1.371_1 AAGE01173027

MIALLLIGAVTLVFLFVKQRFNYWKVRGVPYVRPTFPLGNLWGIGTKKHLSEGLEDLYVQLKGKAQLGGIYFFINPVVLVTDLDLIKTILIKDFNFFHDRSIYYNEKDDPLTAHLFTMEGIKWKNMRVKLTPTFTSGKMKLMFPIVRDCANELEKCISKEIVDGKEIEVKDILARYTTDVIGNCAFGLECNSLHNPNAEFREMGRKVFQLQGLGFLKLLLTQQFSTLSRALGATVLQPDVAKFFLKTVSDNVDYREKNKIERNDFIDLMIKLKNGQTLEHDKSDQRVEKLSIEQVAAQSFVFFFAGFETSSTLMSFCLYELAQNQDLQDKARKDILDTLNKHGSLSYEAVHEMKYLENCISETLRKHPPASNIFRTATQDYTVPGTSLTIEKGTSVMIPTLAIHRDPEYYPDPMKFDPDRFTADQVAARHPFAFLPFGEGPRVCIGMRFGLMQARVGLATLLKNFRFTVGERLETPAQLDPSSAILLIKGGLWLKVDKI.

 

>CYP6N10P Aedes aegypti 1.371_2p AAGE01078584 pseudogene 100%

MLLYLLLTVVTLAYLWIGRRYSYWKQRSVPYVEPRFPFGNLQGLNKRHFGLLAQDVYSKL KGSGSKFGGMFFFVNPVAVILDLDFAKDVFVKDFQYFHDRGVYSNEKVDPITSHLVAMEGIKWKNLRAKLTPTFTSGKMKMMFPTITAVADEFRKCMVNEVDKGGEIEMKEFLARFTT

DVIGSCAFGLECNSLADPEAEFRKMGKKALTMSPMGFLR RILSVTFRDLAKFLGVRISDPDVATFFMNVVRSTIEYRERNKVQRNDFMDLLIKLKNVEPIDENTNQLGPLTFNEIVAQAFVFFLAGFETSSTTMCFCLYELAKNQELQDKARRNIDEVLAKYGTMTYEAVH

EMRYMENCINESLRKYPPLPNILRNVNKPY

 

>CYP6N11 Aedes aegypti 1.371_3 AAGE01020246 Charle?s version 100%

MLLFLLLSVVTAAYLWVIWRYSYWKRRSVPYVEPSFPFGNLQGLNKRHFGLLTQDVYSKL

KGTGCKFGGMFFFVNPMVVILNLDFAKDVFVKDFQYFHDRGEYSNEKADPIMAHLVTMEG

TKWKNLRTKLTPVFTSGKMKMMFPIITAVAEEFRKCMAKEADKGEDIEMKELLARFTTDV

IGNCAFGLECNSLMDPEAEFRKMGRKAMAMSSADFLRRKLCNSFRGLAKLLGVRLSDPDV

SDFFMNAVRSTIEYRERNKVQRNDLMDLLIKLKNAELIDEKSDRLGPLTFNEIAAQAFVF

FLAGFESSSTAMSFCLYELAKNQELQDKARRNINEVLVKHGTLTYEALYEMTYIENCINE

SLRKYPPVTNIVRNVSKPYRVPGMNVTLEEDCRVLLPVYAIHHDPSLYPNPDQFDPERFN

PENSAARHPMAFVPFGEGPRICIGLRFGSMQARIGLTYLLKNFRFTLSEKMHDPLKMMSN

TIILASEGGLWMRIEKL*

 

>CYP6N12 Aedes aegypti 1.371_5 AAGE01273771? 100% to CYP6Nae2, 85% to CYP6N3v1 Aedes albopictus

MLIYLTVLALTLAVLWIRKRYSYWMDRGILYVEPS

FPAGNLRGMGRKEHLSSQMQRCYKELKGKGPVGGMFFFINPVALAMDLDLIKSVLVKDFQ

YFHDRSVYYNEKDDPLSAHLFTMEGAKWKNLRAKLTPTFTSGKMKMMYPTIIGVADEFQK

LMKSEVSS

NAEIEMKEILARFTTDVIGTCAFGLECNSLHDPDAKFRAMGRKIFSFANGRF

LKAVIAQQFRSLARSLHIALVDKEVSDFFLGAVRDTIKYREENKIERNDFMSLLMKLKDD

GNTGNTETLTVEEIAAQAFVFFLAGFETSSTAMSYCLYELAQNSDLQNKARKSVMDSIKK

HGSLTYEAMQDMQYIDQCINESLRKYPPASTLTRSVSKDYKLPNSNVVLQQGSTLIVPVYA

LHHDAEYYPDPEKYNPDRFTPEEVAKRNPYCFLPFGEGPRICIGMRFGMMQARVGLAYLL

RDFSFTLSSKTPVPLKISPRSPVLTSEGGLWLKVQKL*

 

>CYP6N13 Aedes aegypti 1.371_7 476419050 52% to CYP6N3, 63% to 6N2

MWIFLLLSIAVLLILQVRRKYSYWKRHGVPFIQPRFPFGSITPVGDRVHSSQLMARFYNQ

LKGTYPFAGMYFFTNPVVLALDLDFIKNVLVRDFQYFHDRGLYHNEKDDPLTCHLFNIEG

TKWTNLRRKLLPTFSSGKMKMMCPTILAIADRFRTAIENSISDQNEIEMRDFLARFTTDV

IGTCAFGIDCNSLENPDAEFLKMGNKIFEVPTSRIIAYFFVSTFQELSKKLHIKAVPEDV

SRFFYKVVRETMAYRQSSGVQRNDFMNLLMQLKEKGELEGSDEKLGTLTLDEVVAQAYVF

FLGGYETSSTNMCFCLYELALNGEIQEKARECVQKAVAKHGGLNYEALMDMPYLEQCIY 

EALRKYPPIANLFRSVTQDYNVPNSNVMLPKGMNVWIPIYAIH

HDPEFFPEPELFDPERFTQEECEKRKPFTYMPFGEGPRTCIATRFGMMETKTGLATLLMN

FKFTKSARLEVPPKFSTKHVMLTPVGGLWVKVEKIEQ*

 

>CYP6N14 Aedes aegypti 1.371_8 AAGE01021887

MWLNLLVMVFALSVILVRRRYSYWKRIGVPFIQPRFPLGSIGSIGTRIHSSQLLAQFYQQ

LKGSHPFAGIFYFLQPVALALDLEFVKNVMVRDFQYFHDRGLYYNEKDDPLSSHLFNIEG

TKWTTLRRKLVPTFSSGKLKMMCPTVVSVADRFKMCIEKSIAKEEAIEMRELLARFTTDV

IGSCAFGIECNSLENPDDKFRKMGEKVFDVSPFAILAFFFLSTFKDLARKCRISITDSEV

AAFFSTIVQKTITYREKNNVQRNDFMNLLMQMMKKNKEDESEENSVTLTLDEVVAQSYVF

FLGGFETSRTTMSYCLYELSLNQEVQNRARKCIQSAVAKHDGLNYEALMDMPYLEQCIN 

ESLRKYPPISNALRSTTKDYAVPGTEVILKKGTDVIVPIYAIHHDPEYYPDPELFDPD 

RFSADQCAKRKPFTFMPFGEGPRMCVASRFGMMETKIGLAAMLMSFRFSKCEKSIVPLKI

SPNHLMLTPAGGLWLKVEQLESDETEMGFSKLISDERVNRLGYSM*

 

>CYP6N15 Aedes aegypti 1.371_9 AAGE01004071? 100% to CYP6Nae4

MWNLSTSSNPHTIVPAHPKEILLLATSSVPFIPARFPVGSFDGVGVRNHPSQLLAKFYR

QMKGLHPFVGVYYFLQPVVVVLDLDFAKTILIRDFQYFHDRGLYYNEKDDPISGNLLHLE

GSRWTNQRKKLIPTFSSGKLRMMCPTILKVADNLKVSFERYVAERDEIEIKDILARFSTD

VIASCAFGLDCSSLLEADDEFRRMGTKVFDISGWKLLKLFFVFAFGNVARRCHMKLIDED

ISQFFFKVVRETIDFRKKNHVHRKDFLNLLIQLKDNG

ELEGSNEKLGTLTLNEVVAHSFVFFLGGFETASTTMSYCL

YELSLNEEVQERARQCVKAAIHKYGDLNYDDLLDMPYLEQCINETLRKYPPSTIYRIVTQ

NYHVPDSSIVFPKGMSVMIPVYAIHHDPEFWPSPELYDPDRFAPEECVSRNPLTFIPFGE

GPRMCVAARLGVLQTKIGLATLLMNFRFSRCKNSTEPLQYSPKHFILTPVGGLKMRVEKIQ*

 

>CYP6N16 Aedes aegypti 1.457_3 AAGE01005098 100% to CYP6Nae3

MWIYLLIAAITLSVLLVRRKYSYWKRHGVPYIKPTFPFGNIRPAGNRVHSSQLMTRYYNELKGKHQFGGIFFFTNPVALA

LDLEFIKDVLVRDFQYFHDRGMYYNERDDPISGHLFNIEGTQWTNLRKKLLPTFSSGKLKMMSPTIISVAERFQECLEKC

ITVDTEIEMKDLLARFTTDVIGTCAFGIDCNSLNDPEVEFRKMGNKMFELPTGRILKFFFISTFKNLARKARLKSVPEDV

SEFFFRVVRETIDYREKSHIQRNDFMNLLMQLREKGALEGSDEKVGTLSMNEVVAQAFVFFLGGFETSSTTMSYCLYELS

LHEDIQERARECVQSAIAKHGGFNYDAVMDMNYLELCINESLRKYPPGANLVRCATKDYQVRNSSVVFKKGMSVMVPIYA

IHHDAEYYPDPERYDPERFGVEELAKRPPFTFMPFGEGPRICIAARFGMMESKIGLAALLMNFKFSKCSKSIVPLVISNK

HVVLTPAGGLWLKVEKLEQ.

 

>CYP6N17 Aedes aegypti 1.457_2 AAGE02018066.1 60% to 6N2

MWIYLLIGIITSLVLFVRRKYLFWERQGVPFIKPKFPFGNLLVNGKRVHTSQLTTYYYNA

LKGKKHPIGGVFFFTTPFAVVLDRELMRNVLIQDFQHFHDRGLYYNEKDDPISCHLFNIE

GSYWTNLRKKLSPIFSSGKLKLMCPMVITIAERFQKCLSKSITQNQQEAEMKEWLNRFTI

DVIGTCAFGIECNSLTNPEEKFRKMGVKMFHVANSRIIKFFFISLFKNLAKKVHIKSVPE

DVSEFFFKVIRKTIAFREMNHVLRNDFINLSMQLMADGKLEGSDEDVGKITLNEVVAQSF

VFFLAGYETSSTVMMFCLYELSLQEDIQRRARENVITAVSRHGGLNYDALMDMGYLDQCV

N

ETMRKYPPAGNLGRCVTKDYNIPNTNITLRKGLNVVIPVH

GIHHDAEYYPDPERFDPERFSAEESTKRLPFTFMPFGEGPRNCIAARFGMLMAKVGVASM

LMRFQFSKCSKTAVPLVISPKHASMSPEGGMWLKVKEIK*

 

>CYP6N18 Culex_quinquefasciatus_33

100% idenctical to v1 at the amino acid level (are these different sequences?)

75% to 6N16 Aedes, 74% to 6N2 Anoph.

MWIYLLITVITLSIWFVRRKYSFWKRNNVPFIEPRFPFGNIQAVGRRVHSSQLMTRFYTQ

TKGKHPFVGIFFFTNPVALALDLEFVKSVLVRDFAYFHDRGVYFNEKDDPISGHLFNIEG

TRWTNLRKKLIPTFSSGKMKMMCPTIVTVADRFRECIQKHISEDSEVEMKDLLARFTTDV

IGTCAFGIDCNSLNDPDVEFRKMGKKVFELPPRRMLKFFFMATFKELARKFHIKGTAEDV

SEFFFKVVRETIEYRERNNVQRNDFMNLLIQLKDNGELDGSDESVGSLSFNEVVAQAFVF

FLGGFETSSTTMSYCLYELSLNEEIQERARQCVRDAVKKHGGLNYEAAMDMDYIEQCINE

SLRKYPPGANLIRSVTKDYAVPDSDLIFHKGMNVMIPVYAIHHDPEYWPDPEQFNPDRFT

PEETAKRRPFTFMPFGEGPRICIAARFGILETKIGLATLLQNFRFSRCSKSVVPLVISPR

HAVLTPEGGLWLKVEKLEE*

 

>CPIJ016856 CYP6N18 Culex pipiens 100% to CYP6N18 Culex_quinquefasciatus

MWIYLLITVITLSIWFVRRKYSFWKRNNVPFIEPRFPFGNIQAVGRRVHSSQLMTRFYTQ

TKGKHPFVGIFFFTNPVALALDLEFVKSVLVRDFAYFHDRGVYFNEKDDPISGHLFNIEG

TRWTNLRKKLIPTFSSGKMKMMCPTIVTVADRFRECIQKHISEDSEVEMKDLLARFTTDV

IGTCAFGIDCNSLNDPDVEFRKMGKKVFELPPRRMLKFFFMATFKELARKFHIKGTAEDV

SEFFFKVVRETIEYRERNNVQRNDFMNLLIQLKDNGELDGSDESVGSLSFNEVVAQAFVF

FLGGFETSSTTMSYCLYELSLNEEIQERARQCVRDAVKKHGGLNYEAAMDMDYIEQCINE

SLRKYPPGANLIRSVTKDYAVPDSDLIFHKGMNVMIPVYAIHHDPEYWPDPEQFNPDRFT

PEETAKRRPFTFMPFGEGPRICIAARFGILETKIGLATLLQNFRFSRCSKSVVPLVISPR

HAVLTPEGGLWLKVEKLEE

 

>CYP6N19 Culex_quinquefasciatus_31

68% to 6N11 Aedes, 57% to 6N1v2 Anoph.

MLFYLALVAVSLTFFWVGRRFSYWKQLGVPYVEASFPFGNLKGMNKRHLGYIAQDLYVKL

KSTGKKFGGAFFFVSPTALILDLDFAKDVFVKDFQYFHDRGVYCNEKADPITAHLVTMSG

TKWKNLRTKLTPTFTSGKMKMMFPTIVGVAEEFRKGLLVEAEAGGEVEMKEFLARFTTDV

IGTCAFGLECNSLKDPDAEFRRMGKKALTLSTMDFLRRILTVTFKDVAMKFNVRLSNPDV

ANFFMNAVRETVDYREKNKIQRNDFMDLLIRMKNAEPIEGGDPNQVGQLTIEEIAAQSFV

FFLAGFETSSTAMTFCLYELAQNQELQDKARKNVLDVLKEHGSISYEAVHDMKYIEMCIN

ESLRKYPPIANILREVTKDYHVPDMNVTLPKGHRIMLPIYAIHHDPEYYPAPDQYDPERF

TPAAVAARHQMAFVPFGEGPRVCIGQRFGMMQARVGLAYLLKNFRFRLSSKTAVPLKILA

SSTVLATEGGLWLNIEKL*

 

>CPIJ016852 CYP6N19 Culex pipiens 100% to CYP6N19 Culex_quinquefasciatus

MLFYLALVAVSLTFFWVGRRFSYWKQLGVPYVEASFPFGNLKGMNKRHLGYIAQDLYVKL

KSTGKKFGGAFFFVSPTALILDLDFAKDVFVKDFQYFHDRGVYCNEKADPITAHLVTMSG

TKWKNLRTKLTPTFTSGKMKMMFPTIVGVAEEFRKGLLVEAEAGGEVEMKEFLARFTTDV

IGTCAFGLECNSLKDPDAEFRRMGKKALTLSTMDFLRRILTVTFKDVAMKFNVRLSNPDV

ANFFMNAVRETVDYREKNKIQRNDFMDLLIRMKNAEPIEGGDPNQVGQLTIEEIAAQSFV

FFLAGFETSSTAMTFCLYELAQNQELQDKARKNVLDVLKEHGSISYEAVHDMKYIEMCIN

ESLRKYPPIANILREVTKDYHVPDMNVTLPKGHRIMLPIYAIHHDPEYYPAPDQYDPERF

TPAAVAARHQMAFVPFGEGPRVCIGQRFGMMQARVGLAYLLKNFRFRLSSKTAVPLKILA

SSTVLATEGGLWLNIEKL

 

>CYP6N20 Culex_quinquefasciatus_28

55% to 6N1v2 Anoph., 67% to 6N9 Aedes

MIYLALIAVATLLVLFVRQRYNYWKVRGVPYLDPVFPAGNVWGLGTRLHLSEVLQKCYEK

LKGKGPFGGVYFFLGPTVLATDLDFIKTILVKDFQYFHDRSFYYNEKDDPLTGHLFTIEG

QRWKNLRAKLTPTFTSGKMKLMFPIVADVAVELKKCLVTEKDDGGEVELKDVLARYTTDV

IGKCAFGLDCNSLENPNAEFREMGRKIFTTTPFSIIKLFFVQQIKPLARKLGVTVLNQEV

TKYFLKAVKDTVEYRESNNVERNDFMNLLIKLKNAEPVDEGSSRSMEKLSLNEISAQAFV

FFFAGFETSSTLMSFCLYELAMNQDLQDRARQNVRDVLSQHGSLTYEAIHDMKYLENCIS

ETLRIYPPASILFRTATQDYRVPNTDFTIEKGTATNIPVLAIHRDPEIYPDPMKFDPERF

NADQVAKRHPFAYLPFGEGPRVCIGMRFALMQTRVGLATLLQNFRFTVSPRTRIPAKINP

ASGIIMAEGGLYLQVDRIGDCEVEIK*

 

>CPIJ016855 CYP6N20v1 Culex pipiens 99% to CYP6N20 Culex_quinquefasciatus 1 aa diff

MIYLALIAVATLLVLFVRQRYNYWKVRGVPYLDPVFPAGNVWGLGTRLHLSEVLQKCYEK

LKGKGPFGGVYFFLGPTVLATDLDFIKTILVKDFQYFHDRSFYYNEKDDPLTGHLFTIEG

QRWKNLRAKLTPTFTSGKMKLMFPIVADVAVELKKCLVTEKDDGGEVELKDVLARYTTDV

IGKCAFGLDCNSLENPNAEFREMGRKIFTTTPFSIIKLFFVQQIKPLARKLGVTVLNQEV

TKYFLKAVKDTVEYRESNNVERNDFMNLLIKLKNAEPVDEGSSRSMEKLSLNEISAQAFV

FFFAGFETSSTLMSFCLYELAMNQDLQDRARQNVRDVLSQHGSLTYEAIHDMKYLENCIF

ETLRIYPPASILFRTATQDYRVPNTDFTIEKGTATNIPVLAIHRDPEIYPDPMKFDPERF

NADQVAKRHPFAYLPFGEGPRVCIGMRFALMQTRVGLATLLQNFRFTVSPRTRIPAKINP

ASGIIMAEGGLYLQVDRIGDCEVEIK

 

>CPIJ020199 CYP6N20v2 Culex pipiens yellow part not a P450

MAVFVREYKSNCYSIAAYFCSKIVADFPLMLAGVTCFQLIAYYLTGQLNETSRIVMFWAV

CALMGWTAQMYGMVAGSVFPVDVSPFVVPSSMIPMILFSGFFIRYSELLDVFKPLTYVSP

FRYGFEGLALTTYGMNRTEIGCEDMFCYYRKSVKVLELLEVKDSCYWMDVGGLGVWILVL

HILLY

98% to CYP6N20

YFHDRSFYYNEK

DDPLTGHLFTIEGQRWKNLRAKLTPTFTSGKMKLMFPIVADVAVELKKCLVTEKD

DGGEVELKDVLARYTTDVIGKCAFGLDCNSLENPNAEFREMGRKIFTTTPFSIIKLFFVQ

QIKPLARKLGVTVLNQEVTKYFLKAVKDTVEYRESNNVERNDFMNLLIKLKNAEPVDEGS

SRSMEKLSVNGVSAQA

 

>CPIJ016853 CYP6N21P Culex pipiens

(missing approx 14 aa in middle) probable pseudo

CYP6N 58% to CYP6N11 & = frameshift and deletion

MWFYLALAAALLAYSWISKRYSYWTARGVPTVNGVFPLGNLVGIGRRHMAFMIRDCYRKLKTSGKKFGGIYFFVNPVVLA

LDLDFVKDVLVKDFQYFHDRGVYYNEKDDPLSAHLISLDGSKWKNLRTKLTPTFTSGKMKMMYSTITAVGERMQDHLADE

IKPGDPIEIRDFLARFTTDIIGSCAFGLECNSLVDPETMFRQMSRKAFITTPTQFLKAMFGLTFRDLARG &

VGVVRDTIEYRE

RNKVNRNDFMDLLIKLKNAEPLEEGSDNLGPLTFNEIAAQAFLFFLAGFETSSTTLSYCMYELARNSDIQDKARKSVSEV

LKRHGSMSYEAVQDMKYLECCIN (1)

ESLRKYPPVANIFRDITMNYKVPNSGVILEKGYRVAIPVYGIHHDPEYYPDPETFNP

DRFTPEQSTKRHPMAFLPFGEGPRNCIGLRFGMLQTKVGLAYLLQKFRFKPTARTPSPLKIAPSNVIMSPEGGLWLKVEK

VE.

 

>CPIJ016854 CYP6N22 Culex pipiens 60% to CYP6N9

MYIILLLVITLAILFIKQRYNYWKVRGVPYLDPAFPTGNVRGLGTRLNLAEVLHSCYERLKDRGGPFGGIFFFLGPQVVA

TDLDFVKTILVRDFQYFHDRSLFYNERDDPLSAHLFTIEGSRWRALRAKLTPTFTSGKMKLMFPIVRDVAGELEKCLGQE

LAMDSNVEMKDILARFTTDVIGNCAFGLECNSLKNPGAEFREMGRRVSTLPPFTMVKFFLAQQIKPEARALGVTIMERDV

TDFFMSTVKDVVEYREKSKVQRDDFMNLLIELKNSAKDSERLTLNEIAAQVFLFFFAGFDTSSTLMLFCLYELALNQDVQ

DKARQNVLEVLKHHGALSYDAVFDMKYLDKCISETLRMYPPAAVIFRTATKDYPVPQTNFIIEKGTPINISVLGFTVTLE

LYPDPMKFDPERFNPDQVAKRHPFAYLPFGEGPRLCIGMRFAQMQTRVGLATLLQNFRFTVSPRTPIPPKIVPSSGLFVP

QDNFWLNIERIE.

 

>CPIJ005900 CYP6N23 Culex pipiens 65% to CYP6N12 added EXXR motif

MLLYLAVLTLSLAVLWIRKRYSYWSDRGVKYLKPTFPFGNIRGLGRKEQLALAFQRLYLQ

LKGSGPFGGAFFFVNPVAMALDLDFVKNVLVKDFQHFHDRSIYYNERDDPLSAHLVTIEG

TKWRNLRTKLTPTFSSGKMKMMFPTIVGVAEQFRELLLEEVESGGEVEMKEILARFTTDV

IGTCAFGLECNSLHDSDAAFRRMGRKVMEPPPGRLFVVILAQQFRKIARALRVKTIDTDV

SQFFMNAVRETVEYREKNHVERNDFMNLLIKMKNGQQVEDGTNVDTEGLTLEEIAAQAFV

FFLAGFETSSTAMTYCLYELARNPELQQKARDDILKTIEKHGSLSYEAVHDMHYIEMCIN (1)

ESLRKYPPIGQLTRTVSKHYKVPSTEHTLEKGTTVAIPVYGIHHDPELYADPERYNPDRFLPEELAKRN

PYCFLPFGEGPRNCIGLRFGMMQARIGLATLLKDFRIRMSSKTQEPLRIDAKKVVLTFEG

GLWLHIEKIQGK*

 

>CPIJ019704 CYP6N24 Culex pipiens 68% to CYP6N11

MLFYLALVAVSLTFFWVGRRFSYWKQLGVPYVEASFPFGNLKGMNSRHLGYIAQDLYVKLKSTGKKFGGTFFFVSPTALI

LDLDFAKDVFVKDFQYFHDRGVYCNEKADPITAHLVTMSGTKWKNLRTKLTPTFTSGKMKMMFPTIVGVAEEFRKGLLVE

AEAGGEVEMKEFLARFTTDVIGTCAFGLECNSLKDPDAEFRRMGKKALTLSTMDFLRQILTVTFKDVAMKFNVRLSNPDV

ANFFMNAVRETVEYREKNKIQRNDFMDLLIRMKTAEPIEGGDQVGQLTIEEIAAQSFVFFLAGFETSSTAMTFCLYELAQ

NQELQDKARKNVLDVLKEHGSISYEAVHDMKYIEMCINESLRKYPPIANILREVTKDYPVQDMNVTLPKGHRVMLPIYAI

HHDPEYYPAPDQYDPERFTPAAVAARHQMAFVPFGEGPRVCIGQRFGMMQARVGLAYLLKNFRFRLSEKTAVPLKILASS

TVLATEGGLWLHIEKL.

 

>CYP6N25 CPIJ011129 Culex pipiens 60% to CYP6N12

MILYLLLSILVLSFLWIQRQYSYWERRGVPYVKASFPRGNLQGVGKKFHMSTAIQACYNK

LKGKGPFGGIFFFLNPVVLVMDLELVKHVLVKDFQFFHDRSLYYNEKDDPLTGNLLNIEG

TRWRNLRAKITPTFTSGKMKMMFPTIVAIADQFHALLVRESAEGVEMEMKEALARFTTDV

IGRCAFGLECDSLSNPESIFRQMGSRLFSKRSFRLVVAQQFRELARFLGYVTFDKEVSTF

FLNIVRETIEYREESGVSGKDFMDLMIKLKNSESIDDSEGSSLGALTFNEIAAQAVVFFA

AGFETSATTMSYCLYELALNPALQGKARDEVTHVIRKHGILTYEAAQEMQYVGACIDEAL

RKYPPGPSLSRAVTKNYKVPNTNTTLEKGTSVLIPVYAIHHDPEYFPEPERYVPDRFLPE

QQAARNPYSYLPFGEGPRNCIGLRFGLTVARIGVAYVLKGFRISLSRRTPVPLELSRQKM

ILTIEGGLWLHLEKL

 

>CYP6N26P CPIJ005899 Culex pipiens pseudogene 66% to CYP6N12

has duplication of part of exon 1, & = frameshift and deletion

MLLYLTILALGLVVLWIRKRYSYWSDRGVIYLKPHFPSGNLQGVGRKQHRDQVIRRCYQQ

LKGSGPFGGIFFFTSPVALALDLDLVKSVLVKDFQHFHDRSV

YYNERDDPLSAHLFTMEGNRTKWRNLRAKLTPTFTSGKMKMMFPTISGV

YYNERDDPLSAHLFTMEG--TKWRNLRAKLTPTFTSGKMKMMFPTI

LGVADQFRQLLL

KEASGGGEVEMKEILSRFTTDVIGSCAFGLECNSLHDSEAVFRRMGRKVFELPPGRIVMATLAQQFRSIARALRITIIDP

DVSQFFMNVVRETVEYREKNRVERNDFMNLLIKLKNGQPVEDGLTLEEIAAQAFVFFLAGFETSSTAMSHCLYELAQNPE

LQEKARADVRETIKKHGSLSYEAAQDMQYIGNCIN

ESLRKYPPVGQLTRAVSKDYKVPGTDKILAKGATL &

YDPDRFLPEQVAKRNPYCFLPFGEGPR

NCIGLRFGMMQARIGLATLLKDFRIRLSGKTMVPLELDPRKAVIGFKGGLWLHIEKV.

 

>CPIJ019705 CYP6N27P Culex pipiens 95% to CYP6N22 end in a seq gap

MLYIILLLVITLAILFVKQRYNYWKVRGVPYLDPAFPTGNVRGLGTRLNLAEVLHSCYEQ

LKSRGGGPFGGIFFFLGPQVVATDLDFVKTILVRDFLYFHDRSLYYNERDDPLSAHLFTI

EGSRWRALRAKLTPTFTSGKMKMMFPIVRDVAGELEKCLGQELAMDSNVEMKDILARFTT

DVIGNCAFGL*CNSLKNPGAEFREMGRRVSTLPPFTMVKFFLAQQIKPLARAVGVTIMQR

DVTDFFMSTVSSDDTAREQSPA

 

>CYP6P1 Anopheles gambiae (mosquito) CYPf2r7 =, 509aa

MSLLGVLLLGVVLLLSLAYLFLRSKHNYWRSRGFPCKPSPSLLYGQMQGNGTTRHAAYVTQEIYRYAQDRGERYMGYSFFFMPIVMVCDIELVKTVLVKDFAVFHDRGMYSNPRADPLSGNLFALEGHEWRALRQKLTPTFTSGRMKQMFGTMLQVATELHRHLLEQIDRELEMKAVLARFTTDVIGTCAFGIECNTLRNPDSDFLKYGRRVFEHRMLAMVKMTFAMLFRAQAVKLGVKVTDDDLEAFFMNLVHDTVEHRERNGVQRNDFLNLLLQIKNKGCLEEQEQEGSASADRTGMTMNELAAQVFIFFVAGFETSSTVMNFCLYELAKNPHIQERLRDELNRSIDANGGELTYDMVMGHEYLGQVVNETLRKYPPLETTLRVAGQDYTIPGTRHVIPRHVGVQIPVYAIHHDPAHYPEPECFDPDRFSAEACRNRTPYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLPTAQTPDRIVFDPKSFILSPAGGNYLRIVQV*

 

>CYP6P1 Anopheles funestus EU852642

MALVGVILLGVVLLLSIAYLFLRERHSYWRKRGFPCKPNPSLLF

GQMQGNGSTKHAAYVTQEIYNYAKERGERFVGYSFFFMPLVMVCDIELVKTILVKDFS

VFHDRGMYSNARTDPLSGNLFALEGHEWREMRQKLTPTFTSGRMKQMFGTMLQVAAEL

HKHMLTNIDRDLEMKDVLARFTTDVIGTCAFGIECNTLDNPDSEFLKYGKRVFEHRLF

AVVKMTFAMLFRNTATKLGIKVTDADLERFFLNLVHETVEYRERNEVQRNDFLNLLLE

IKNKGSFVEQEEGHTAPNALGMTMNELAAQVFIFFVAGFETSSTVMNFCLYELAKNPD

IQERLRDELNRAIETNDGELTYEVVMGQEYLGQVVNETLRKYPPLETTLRVTAQDYRI

PGTDHVIPRNVGVQVPVFAIHRDPEHYPDPECFDPDRFSAEECKKRLPYTFLPFGEGP

RMCIGMRFGMMQVKVGLVTLLRSFRFFPSAQTPERIVFDPKSFILSPTGGNYLRVEKI

 

>CYP6P2 Anopheles gambiae (mosquito) CYPf2r8 =, 507aa

MELLTLTLSLLVALATGLYLFVRNRYNYWSNRQFPTLPNQKLLFGHVKGVNTERHASYISSEIYREFKKRGDAFGGFNMFVIPAVMAIDPEFIKTILVKDFHIFHDRGLFSDPEIDPLSGTLFALQGKAWKILRQKLTPTFTSGKMKQMFATVLEVAERLGQHVATHTGQMEMKDVLARYTTDVIGTCAFGIECNTLRNPDSDFLKYGNKVFEQKVSTMIKIILVLMGRKISSKFTLKITDADVETFFMNLVRETVEYRERNNVKRNDFLNLLLQIKNTGKLWEGEEDHIGKGEVGMTMNELAAQVFIFFLAGFETSSTTMNFCLYELAKHPDIQERLRREIERAVEENGGELTYDVVMGTEYLNWVVDETLRKYPPLETVTRAPEHDYTVPGTAHVIPKGTMIQIPIYALHHDAQYYPDPERFDPERFRPEVANARPAYVYMPFGEGPRICIGLRFGMMQTKVGLITLLRQFRFSPTEQTPDRIRFMPNVFVLSPDSGNYLEVEKL*

 

>CYP6P3 Anopheles gambiae (mosquito) CYPf2r4 =,   509 aa

MELINAVLAAFIFAVSIVYLFIRNKHNYWKDNGFPYAPNPHFLFGHAKGQAQTRHGADIHQELYRYFKQRGERYGGISQFIVPSVLVIDPELAKTILVKDFNVFHDHGVFTNAKDDPLTGHLFALEGQPWRLMRQKLTPTFTSGRMKQMFGTIWDVGIELEKCMEQSYNQPEVEMKDILGRFTTDVIGTCAFGIECNTLKTTDSEFRKYGNKAFELNTMIMMKTFLASSYPTLVRNLHMKITYNDVERFFLDIVKETVDYREANNVKRNDFMNLMLQIKNKGKLDDSDDGSLGKGEVGMTQNELAAQAFVFFLAGFETSSTTQSFCLYELAKNPDIQERLREEINRAIAENGGEVTYDVVMNIKYLDNVIDETLRKYPPVESLTRVPSVDYLIPGTKHVIPKRTLVQIPAYAIQRDPDHYPDPERFNPDRFLPEEVKKRHPFTFIPFGEGPRICIGLRFGLMQTKVGLITLLRKFRFSPSARTPERVEYDPKMITIAPKAGNYLKVEKL*

 

>CYP6P4 Anopheles gambiae (mosquito) CYPf2r6 =, 506aa

MDLLSYVLTAFVFVVSIAYLYLRSRHNYWRDRCFPYTRQKPHLLYGHMEQFQSKHASYINEELYWEFKNRGEPIGGMSMFFLPGLIVADPELVKSILVKDFSVFHDRGVFNDAKADPLSAHLFALEGHEWRVLRQKLTPTFTSGRMKQMFGTIQQVAGEFLKYMNEHCHREIEMKDVLARFTTDVIGTCAFGIECNTLKNPDSDFRKYGNKVFEQDTLLMLKFMFATTFKGLAKRIGMKLTDEGVERFFLQVVRETVEYREMNNVQRNDFMNLLLQIKNTGSLDGGDVPIKGAAGLTMNELAAQVFVFFLAGFETSSTTMNFCLYELAKNPDIQDRLREEIERAVEENGGEVTYDMVMNVQYLDNVINETLRKYPPIESLSRVPMRDYTVPGTKHVIPKDTFIQIPVYALHRDPEFYPEPDQFNPDRFLPEEVKKRHPYVFLPFGEGPRICIGLRFGVMQAKIGLITLLRNFRFTPSSQTPAKIVFDPKSFILSPSTGNYLKVDKI*

 

>CYP6P5 Anopheles gambiae (mosquito) CYPf2r5 = ,509aa

MEPVTIVLTAFIFVVSIVYLFVRSKHRFWKDQGVPHAPKPHLFYGHVKGQSRTRHGADINQELYRYFKQRGVPYGGISLFIMPSLIVVDPELVKTILVKDFNVFHDRGVYSNPRDDPFTGNLFGLEGTPWRLLRQKLTPTFTSGRMKQMFGTIWAVALELEKYMEENYNQPEVEMKDVLGRFTTDVIGTCAFGIECNTLKTPDSDFRKYGNKAFELDPITLTKFFFATSYPQLARKLHVRTTQQDVEDFFMKIVRETVDYRETNNVQRNDFMNLLLQIKNKGKLDDHGTVVGKGEVGLTHNELAAQVLIFFLAGFETSSTTQSFCLYELAKNPDIQDRLREEINRAIEENGGEVTYDVAMNIQYLDNVINETLRKYPPVETLTRKPSSDYVIPGTRHIVPKDTVVQIPIYAIQRDPDHYPDPERFDPDRFLPEEVKKRHPYVFLPFGEGPRICIGLRFGMMQTKVGLINLLRRFRFSPSARTPERVVYDPKMFTLSPIGGNYLKVDKIA*

 

>CYP6P5 Anopheles funestus EU852646

MEPITLVLSGFIFVVSIVYLFVRSKHNFWKDQGVPYAANPHFFY

GHVKGQSRTRHGADINQELYQQFKQRGVPYGGISLFIMPSLIVVDPELVKTILVKDFN

VFHDRGVFSNPKDDPFTGNLFGLEGNPWRLLRQKLTPTFTSGRMKQMFGTIWDVALEL

EKYMEQNYRQPEIEMKDVLGRFTTDVIGTCAFGIECNTLKTPDSEFRKYGNKAFELDP

VTLTKFFFASSYPQLARKLHVRTTQQDVEDFFMKIVRETVDYREMNNVQRNDFMNLLL

QIKNNGKLDDHGTIVGKGEVGLTHNELAAQVLIFFLAGFETSSTTLSFCLYELAKNPG

IQDRLRDEITRAIDDNGGEVTYDVAMNIQYLDNVINETLRKYPPVETLTRKPAHDYVI

PGTKHIIPEGTIVQIPIYAIQRDPDHFPDPERFDPDRFTPEEVKKRHPYVYLPFGEGP

RICIGLRVGLMQTKVGLINLLRKFRFSPSASTPEKVVFDPKMFTLSPTGGNYLKVEKV

V

 

>CYP6P6 Anopheles minimus AY128947

MELINLVLAAFIFVWSVVYLFIRNKHNYWKDNGFPYAPNPHFLF

GHAKGQTLTKHAADIHLELYKQFKQRGDRYVGMSQFIIPSVFVIDPELVKTIMVKDFN

VFHDRGVFTNAKDDPLSGHLFALEGNPWRLLRQNVTPTFTSGRMKQMFGTLWDVALEL

DKYMEENYRQPDMEMKDVLGRFTTDVIGTCAFGIECNTLKTPDSEFRKYGNKAFEFNL

SIMIKIFLASSYPELVRALKMKITFDDVERFFLKIVRETVDYREQNNVKRNDFMNLLL

QIKNKGKLDDSEDIVGKGEVGMTQLELAAQAFVFFLAGFETSSTTQSFCLYELAKNPE

IQERLRQEINQAVEENDGQVTYDVAMNIQYLDNVINETLRKYPPVESLNRVPSVDYLI

PGTKHVIPKRTLVQIPVHAIQNDPDHYPDPERFDPDRFNPEEVKKRHPFTFIPFGEGP

RICIGLRFGVMQTKVGLITLLRKFRFSPSARTPDRVTFEPKMITLSPNAGNYLKVEKV

 

>CYP6P7 Anopheles minimus AY426719

MELVTTILSLLFVLASGLYWFLRNRYNYWTNRGFPTVPNQKLLY

GHVKGTNTERHASYITAEIYQQLKKRGDSFGGLNVFIIPAVMVVDPELIKTILVKDFH

IFHDRGLFSDPEVDPLSGTLFALQGKPWKILRQKLTPTFTSGKMKQMFTTIRDVAEQL

GTYVDEHLHQEELEMKEILVRYTTDVIGTCAFGIECNTLKDPDSEFLKYGNKVLDQKV

STMIKIIFIMVMRKFKSNFVLKITDADVESFFLNLVRETVEYRENNNVKRNDFLNLLM

QIKNTGKLWEAEEEHVGKGEVGMTQNELAAQVFIFFLAGFETSSTTMNFCLYELAKNS

ELQERLRKEINRALEANGGELTYDVVMGIEYLNKVVDETLRKYPPLESITRAPEQDYT

IPGTKHVIPKGTMVQIPIYALHHDPEYYPEPERFDPERFQPEVANARPPYVYMPFGEG

PRICIGMRFGMMQTKVGLITLLRQFRFSPTAKTPETIRFMPNVFILSPDRGNYLHVEK

I

 

>CYP6P8 Anopheles minimus AY426720

MTLLGVILLGVVLLLSVAYLFLRERHSFWRKRGFPCMPNPSLLF

GQMEGNGSTKHAAYVTQEIYNNAKDRGERFLGYSFFFMPLVMVYDIELVKTILVKDFT

VFHDRGIYSNARIDPLSGNLFALEGHEWRELRQKLTPTFTSGRMKQMFGTMLEVAEKL

HKYILTNVDREMEMKDVLGRFTTDVIGTCAFGIECNSLDNPNSEFLQYGKRVFEHRLF

ALVKMTFAMLFRNTATKLGVKVTDADLETFFLNLVHETVEYRERNDVQRNDFLNLLLQ

IKNKGCLEEQEDGQTVPNGSTGMTMNELAAQVFIFFVAGFETSSTVMNFCLYELAKNA

DIQERLREEINRTIENNGGELTYEVVMGQEYLGQVVNETLRKYPPLETTLRVTSQDYT

IPGTEHVIPRKVGVQIPVFAIHRDPELYPDPECFDPDRFTKEECKKRPAYTFLPFGEG

PRMCIGMRFGMMQVKVGLATLLRSFRFFPSEKTPERIVFDPKSFILSPTGGNYLRVEQ

V

 

>CYP6P9 Anopheles funestus EU852650

MELINVVLAAFIFVVSAVYLFIRNKHNYWKDNGFPYAPNPHFLF

GHAKGQAQTRHAADIHLELYKKFKQRRERYVGMSQFIIPSVFVIDPELVKTILVKDFN

VFHDRGIFTNARDDPLSGHLFALEGNPWRLLRQKLTPTFTSGRMKQMFGTLWDVALEL

DKYMEENYRQQEIEMKDVLGRFTTDVIGTCAFGIECNTLKTPDSEFRKYGNKAFELDL

LIMMKFFFASAYPSLVRKLRMKITFDDVEEFFVKIVRETVSYREMNNVKRNDFMNLLL

QIKNKGKLDDSDDGSVGKGEVGMTQLELAAQAFVFFLAGFETSSTTQSFCLYELAKNP

DIQERLRQEINQAIEENDGQVTYDVAMNIQYLDNVINETLRKYPPVESLNRVPSVDYV

IPGTKHVIPKRTLVQIPVHAIQHDPEHYPDP

 

>CYP6P10v1 Ochlerotatus sollicitans AY948075

MLTILLAGFILLLTAAVLYIHRRNRFWSDRGIPCAPNPRFFFGH

VKGQVTDRHASYVNRELYQHFRSRGEPFGGFSFFAVPAVMIVDPELVKTVLVRDFNVF

HDRGIFNNPKDDPLSGQLFLLEGLQWKVLRQMLTPTFTSGRMKAMFGTILDVAEELRE

YLVQNHEREPVVEMKEVLARFTTDVIGTCAFGIECNTLKNPDSDFLKYGKRVFEQKPW

NVFKFIFASLFKDLSKALGVKLTDSGVEKFFMGLIRETVEFREKNNVQRNDFMNLLLQ

LKNKGRLEDMDEKEELSKRGLTMDELAAQCFVFFIAGYETSSTTMNFCLYELAKNQDV

QERLREDIQEAVAANGGRVTYEMVMGLPYLDNVVNETLRKYPPIESLSRVPTADYTVP

GTKHVLPKGTMTAIPVYALHHDPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPR

NCIGLRFGLMQTKIGLITLLRNFRFSPSSKTPDALVFDVKSFVLSPEGGNYLRYDKI

 

>CYP6P10v2 Ochlerotatus sollicitans AY948076

MLTILLAGFILLLTAAVLYIHRRNRFWSDRGIPCAPNPRFFFGH

VKGQVTDRHASYVNRELYQHFRSRGEPFGGFNFFAVPAVMIVDPELVKTVLVRDFNVF

HDRGIFNNPKDDPLSGQLFLLEGLQWKVLRQMLTPTFTSGRMKAMFGTILDVAEELRE

YLVHNHEREPVVEMKEVLARFTTDVIGTCAFGIECNTLKNPDSDFLKYGKRVFEQKPW

NVFKFIFASLFKDLSKALGFKLTDSGVEKFFMGLIRETVEFREKNNVQRNDFMNLLLQ

LKNKGRLEDMDEKEELSKRGLTMDELAAQCFVFFIAGYETSSTTMNFCLYELAKNQDV

QERLREDIQEAVAANGGRVTYEMVMGLPYLDNVINETLRKYPPIESLSRVPTADYTVP

GTNHVLPKGTMTAIPVYALHHDPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPR

NCIGLRFGLMQTKIGLITLLRNFRFSPSAKTPDALVFDVKSFVLSLEGGNYLRYDKI

 

>CYP6P10v3 Ochlerotatus sollicitans AY948077

MLTILLAGFILLLTAVVLYIHRRNRFWSDRGIPCAPNPRFFFGH

VKGQVTDRHASYVNRELYQHFRSRGEPFGGFSFFAVPAVMIVDPELVKTVLVRDFNVF

HDRGIFNNPKDDPLSGQLFLLEGLQWKVLRQMLTPTFTSGRMKAMFGTILNVAEELRE

YLVQNHEREPVVEMKEVLARFTTDVIGTCAFGIECNTLKNPDSDFLKYGKRVFEQKPW

NVFKFIFASLFKDLSKALGVKLTDSGVEKFFMGLIRETVEFREKNNVQRNDFMNLLLQ

LKNKGRLEDMDEKEELSKRGLTMDELAAQCFVFFIAGYETSSTTMNFCLYELAKNQDV

QERLREDIQEAVAANGGQVTYEMVMGLPYLDNVINETLRKYPPIESLNRVPTADYTVP

GTNHVLPKGTMTAIPVYALHHDPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPR

NCIGLRFGLMQTKIGLITLLRNFRFSPSAKTPDALVFDVKSFVLSPEGGNYLRYDKI

 

>CYP6P10v4 Ochlerotatus sollicitans AY948078

MLTILLAGFILLLTAAVLYIHRRNRFWSDRGIPCAPNPRFFFGH

VKGQVTDRHASYVNRELYQHFRSRGEPFGGFSFFAVPAVMIVDPELVKTVLVRDFNVF

HDRGIFNNPKDDPLSGQLFLLEGLQWKVLRQMLTPTFTSGRMKAMFGTILDVAEELRE

YLVQNHEREPVVEMKEVLARFTTDVIGTCAFGIECNTLKNPDSDFLKYGKRVFEQKPW

NVFKFIFASLFKDLSKALGVKLTDSGVEKFFMGLIRETVEFREKNNVQRNDFMNLLLQ

LKNKGRLEDMDEKEELSKRGLTMDELAAQCFVFFIAGYETSSTTMNFCLYELAKNQDV

QERLREDIQEAVAANGGRVTYEMVMGLQYLDNVINETLRKYPPIESLSRVPTADYTVP

GTNHVLPKGTMTAIPVYALHHDPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPR

NCIGLRFGLMQTKIGLITLLRNFRFSPSAKTPDALVFDVKSFVLSPEGGNYLRYDKI

 

>CYP6P10v5 Ochlerotatus sollicitans AY948079

MLTILLAGFILLLTAAVLYIHRRNRFWSDRGIPCAPNPRFFFGH

VKGQVTDRHASYVNRELYQHFRSRGEPFGGFNFFAVPAVMIVDPELVKTVLVRDFNVF

HDRGIFNNPKDDPLSGQLFLLEGLQWKVLRQMLTPTFTSGRMKAMFGTILDVAEELRE

YLVHNHEREPVVEMKEVLARFTTDVIGTCAFGIECNTLKNPDSDFLKYGKRVFEQKPW

NVFKFIFASLFKDLSKALGFKLTDSGVEKFFMGLIRETVEFREKNNVQRNDFMNLLLQ

LKNKGRLEDMDEKEEPSKRGLTMDELAAQCFVFFIAGYETSSTTMNFCLYELAKNQDV

QERLREDIQEAVAANGGRVTYEMVMGLPYLDNVINETLRKYPPIESLSRVPTADYTVP

GTNHVLPKGTMTAIPVYALHHDPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPR

NCIGLRFGLMQTKIGLITLLRNFRFSPSAKTPDALVFDVKSFVLSPEGGNYLRYDKI

 

>CYP6P10v6 Ochlerotatus sollicitans AY948079

ETLRKYPPIESLSRVPTADYTVPGTNHVLPKGTMTAIPVYALHH

DPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPRICI

 

>CYP6P10v7 Ochlerotatus sollicitans DQ427078

ETLRKYPPIESLNRVPTADYTVPGTNHVLPKGTMTAIPVYALHH

DPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPRICI

 

>CYP6P10v8 Ochlerotatus sollicitans DQ427079

ETLSKYPPIESLSRVPTADYTVPGTNHVLPKGTMTAIPVYALHH

DPEYYPEPEWFDPDRFTPEAVQSRPAYVFLPFGEGPRICI

 

>CYP6P10v9 Ochlerotatus sollicitans DQ427080

ETLSKYPPIESLSRVPTADYTVPGTKHVLPKGTMTAIPVYALHH

DPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPSICI

 

>CYP6P10v10 Ochlerotatus sollicitans DQ427081

ETLRKYPPIESLSRVPTADYTVPGTKRVLPKGTMTAIPVYALHH

DPEYYPEPERFDPDRFAPEAVQSRPAYVFLPFGEGPRICI

 

>CYP6P11 Ochlerotatus sollicitans DQ427084

ETLRKYPSVPVLERKAFRDCKVPGYDLVIPKGMKVQVPAFAIHR

DERHYPDPEVFNPDRFHPEEVAKRHICTFLPFGEGPRICI

 

>CYP6P12v1 Aedes aegypti 1.702_1 AAGE02023125.1

48326  MLPLLLAVVTILLTAAALYIRSRHRFWSDRGIPCAPNPEFLFGHVRGQVTNKHAAYVNRE  48147

48146  LYQQFKARGEGFGGYSFFAVPAVIIVDPELVKTILVRDFAVFHDRGIYNNPKDDPLSGQL  47967

47966  FLLEGLQWKILRQMLTPTFTSGRMKAMFGTIMDVAEEFRQFLVDSRKRESVIEMKEILAS  47787

47786  FTTDVIGTCAFGIECNTLKNPDSDFLKYGKKVFEQRVSTLMKFIFASLFKDLARKLRIKI  47607

47606  TDAGVEKFFLGLVRETVEFREKNNVLRNDFMNLLLQLKNKGRLVDQLDEADEVAARGLTM  47427

47426  EELAAQCFVFFIAGYETSSTTMNFCLYELAKNPDIQEKLREDIEEAVASNSGRVTYDL  (0) 47253

44758  GLRYLDNVVN (1) 44729

44670  ETLRKYPPIESLNRVPTSDYTVPGTKHVLPKQTMITIPIYALHHDPDFYLDPDNFD  44503

44502  PDRFLPEAAQARHPYAFIPFGEGPRNCIGMRFGLMHTKIGLITLLRNFRFSPSPKTPDKI  44323

44322  AFDVKSFVLSPDGGNYLRYDKI*  44254

 

>CYP6P12v2 Aedes aegypti AAGE02030882.1 96% to AAGE02023125 allele?

8678  MLPFLLAVVALLLTAAGLYIRSRHRFWSDRGIPCAPNPEFLFGHVRGQVTNKHAAYVNRE  8499

8498  LYQQFKARGEGFGGYSFFAVPAVIIVDPELVKTILVRDFAVFHDRGIYNNPKDDPLSGQL  8319

8318  FLLEGLQWKILRQMLTPTFTSGRMKAMFGTIMDVAEEFRQFLVDSRERESVIEMKEVLAS  8139

8138  FTTDVIGTCAFGIECNTLKNPDSDFLKYGKKVFEQRMSTLFKFIFASLFKDLARKLGVKI  7959

7958  TDAGVEKFFLGLVRETVEFREKNNVMRNDFMNLLLQLKNKGRLVDQLDEADEVAARGLTM  7779

7778  EELAAQCFVFFIAGYETSSTTMNFCLYELAKNPDIQEKLREDIEEAVASNGGRVTYDLVM  7599

7598  GLRYLDNVVN (1)  7593

7510  ETLRKYPPIESLNRVPTSDYTVPGTKHVLPKQTMITIPIYALHHDPDFYLDPDNFD  7343

7342  PDRFLPEAAQARHPYAFIPFGEGPRNCIGMRFGLMQTKIGLITLLRNFRFSPSAKTPDKI  7163

7162  AFDVKSFVLSPDGGNYLRYDKI*  7094

 

>CYP6P13 Anopheles funestus EF152577

MELINAVLAAFIFVVSAVYLFIRNKHNYWKDNGFPYAPNPHFLF

GHAKGQAQTRHAADIHLELYKKFKQRGDRYVGMSQFIIPSVFVIDPELVKTILVKDFN

VFHDRGIFTNARDDPLSGHLFALEGNPWRLLRQKLTPTFTSGRMKQMFGTLWDVALEL

DKYMEENYHQQEIEMKDVLGRFTTDVIGTCAFGIECNTLKTPDSEFRKYGNKAFELDL

LIMMKFFFASAYPSLVRKLRMKITFDDVEEFFVKIVRETVNYREMNNVKRNDFMNLLL

QIKNKGKLDDSDDGSVGKGEVGMTQLELAAQAFVFFLAGFETSSTTQSFCLYELAKNP

EIQERLRQEINQAIEENDGQVTYDVAMNIQYLDNVINETLRKYPPVESLSRVPSVDYV

IPGTKHVIAKRTLVQIPVHAIQHDPEHYPDPERFDPDRFSPEEVKKRHPFTFLPFGEG

PRVCIGLRFGVMQTKVGLITLLRKFRFSPSARTPDCVTFHPKMITLSPIAGNYLKVEKL

 

>CPIJ005955 CYP6P14 Culex pipiens 70% to 6P10v1 Ochlerotatus sollicitans

MALLSLMLTAFVLVASLIYFYLKRRHRFWSNRGIPCAPDPHLFYGHVKGAISVAHGSYIN

QKLYNSLKQRNLSFGGYSFFTIPSIMVVDPEMVKTVMVRDFNVFHDRGIYNDPKSDPLSG

HLFLLEGAPWRALRQKLTPTFTSGRMKSMFGTILEVAEEFRKFMVENHDRGTRELEMKDV

LARFTTDVIGTCAFGLECNTLENPDSDFLKYGSKVFEQTPFQLAKFILASMFKEQAKKLG

VKLTDVGVESFFMGITRETVEFREKNNVQRNDFMNLLLQIKNKGRLTDQPDEPGTMEKVE

PGLTIEELAAQCFVFFVAGFETSSTTMNFCLYELAMNPDIQERLRNDIEKAIAANDGKLT

YEIVMGMQYLDNVVNETLRKYPPVESLNRIPLTDYTIPGTDHVIPSQTMFLIPVYALHHD

PEIYPDPERFDPDRFLPEVVATRHAYSYLPFGEGPRICIGLRFGVMQTKIGLITLLRSFR

FKPTAATPNPLVFDPKSFVLSPIGGNHLRVDKI

 

>CYP6R1v1 Anopheles gambiae 04IgeneB 6R1

MLIVAWLLSAVLSLCFVLCVIHIRKKYSFWSERGVPFVPARFPLGNIQHASHLMLDLYRELKGKHPFGGIFQFTEPVAMI

TDPEMIRNVLVRDFRHFYDRGGYINRQHDPLSGHMLNSGSERWSVLRHASSPIFSTGRLRAFLPEMVQMIDQFQAYLDAK

LAAEGEMIELKGVLERHNTDIAMRFLLGREGNNLLAPEGGLHEAVMRGGFLLPSVWKLFLMTSYRSVARKLRLKVCSREL

TETVERVAAEAINSKLHEHRPEASRRVDLIDQLLKAPGFDGKSSLTLSEI AAQVFLFVAAYETNAITTFYCLYELAQRPE

LQQRARACVCEALEKHGGITYEAIAQMPYLDQCINETLRKHPLAINLIRVVTEDYPVPDSTGIVLPKGLNIIVPVYAIHY

DPQHYPEPERFDPDRFTPEGCRQRAPYTFLPFGAGPKICIGYRQGKLQLRTMLAVLLSSYEFATCAKSTPGALSNAHTVI

KPQGDLWLKVKKLNRVVAA.

 

>CYP6R1v2 Anopheles gambiae CYPm3r3 =, 499aa, 97% to CYP6R1v1

MLIVAWLLSAVLSLCFVLCVIHIRKKYSFWSERGVPFVPARFPLGNIQHASHLMLDLYRALKGKHPFGGIFQFTEPVAMITDPEMIRNVLVRDFRHFYNRGGYINRQHDPLSGHMLNSGSERWSVLRHASSPIFSTGRLRAFLPDMVQMIDQFQAYLDAKLAAEGEMIELKGVLERHNTDIAMRFLLGREGNNLLAPEGGLHEAVMRGGFLLPSVWKLFLMTSYRAVARKLRLKVCSRELRETVERAVEEAINSKLHEHRPEASRRVDLIDQLVKAPGFDGKSSLTLSEIAAQVFLFVAAYETNAITTFYCLYELAQRPELQQRARACVCEALEKHGGITYEAIAQMPYLDQCINETLRKHPLAINLIRVVTEDYPVPDSTGIVLPKGLNIIVPVYAIHYDPQHYPEPERFDPDRFTPEACRQRAPYTFLPFGAGPKICIGYRQGKLQLRTMLAVLLSSYEFATCANTTPGALTNAHTVIKPQGDLWLKVKKLNRVVAA*

 

>CYP6S1v1 Anopheles gambiae 04IgeneC

SPEFARTVLVKDFNYFVDRGVYSNEEVDPLSANLFFLEGNRWGKLRSKLAPTFTSGKLKAMFHTIVDVGNRLDQHLAEKC

QQVKRIDVRQLMACFLTDVIGSCAFGIDCNSLENPNSQFRVMGKRMINLPKLKALKVFFAMMFRKQARALGIRVQTMKDV

SDFFMNVVRDTIRYREEHSERRDDFMQLLIDMMKQDGAAEEDPLKFEEV AAQAFVFFFAGFETSATTLTFVLHLLAKHPE

VQLEGRECVRDVLAKHDNKLSYDAVMEMEYLGWIVNETLRLYPPVATLHRITTQPYQLPNGAILPEGVGVILPNLAFHYD

PDYFPDPYDFKPERFAVKNDFKNNFSYLPFGEGPRICIGMRFGLLQTRLGLAMLLRNYHFTIDPSDAARPLRIDPINLTH

GPEGQVWLNVERIAS

 

>CYP6S1v2 Anopheles gambiae CYPm3r2 =, 498aa

MFVQFLLVVSLGWLWIYLHFKQRYRFWAERQVPFLEPSFPAGNVPDTLKPTIHFAYIIEKLYKRLKSKGDYVGIYFFRDPVLLVLSPEFARTVLVKDFNYFVDRGVYSNEEVDPLSANLFFLEGNRWRKLRSKLAPTFTSGKLKAMFHTIVDVGNRLDQHLAEKCQQVKRIDVRQLMACFLTDVIGSCAFGIDCNSLENPNSQFRVMGKRMINLPKLKALKVFFAMMFRKQARALGIRFNDEDVSDFFMNVVRDTIRYREEHGERRDDFMQLLIDMMKQDGGAEEDPLKFEEVAAQAFVFFFAGFETSATTLTFVLHLLAKHPEVQLEGRECVRDVLAKHDNKLSYDAVMEMEYLGWIVNETLRLYPPVATLHRITTQPYQLPNGTILPEGVGVILPNLAFHYDPDYFPDPYDFKPERFAVKNDFKNNFSYLPFGEGPRMCIGMRFGLLQTRLGLAMLLRNYHFTIDPSDAARPLRIDPINLTHGPEGQVWLNVERIA*

 

>CYP6S2 Anopheles gambiae CYPm3r1 = , 504aa

MLIVAVFVAFFGIFWIYFHFRQRYLFWLNRDVPYLEPTFPFGNMIDIFNPNIHFAHLIQKLYRQLKDRGDYVGLFFFRDPVLLVLSPEFARTVMVKDFNYFVDRGVYSNEEFDPLSANLFFMEGAKWRKLRSKLTPTFTSGKLKAMFHTIVDVANRLDQHLGERCVRMQRIDIKELLARFMTDVIGSCAFGIECNTLENPNSQFRLMGKRMINLPKLKSLKVFFAMMFRKQAQALGIRYNDKDVADFFMNVVRDTIRYRAENGVRRDDFMQLLIDMMQENGAGAGESLTFEEIAAQAFVFFFGGFETSTTTLTFALHLLAQHPKAQRKARKCVRSTLAKHGNEMTYEAIKDMYYLECVIHETLRLYPPVASIHRMTSQPYQLPNGEVIPEGVGVIISNLAFQHDPTLFPDPLAFKPERFEDKTFAKTNPSYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSYTFSLEDCDVDRPLLIDPINLMYGPAGPVWLNVERYVEGSKSS*

 

>CYP6S3 Aedes aegypti 1.371_6 AAGE01028822 Nelson?s version 100% to CYP6Sae

MILILLLLAATALFFRWINAYRARYQFWKEHNVPHLEPRFPVGNAGDILKSTIHFAHIMDNLYRELKHFGDYAGIYFFRD

PVLVVLSPEFAKTVLVKDFNYFLDRGVYSNEKDDPLSANLFFMEGHRWRKLRAKLTPTFTTGKLKAMFHTILAVGEQFDR

YLQDYTKQKDEVEVKDLLARFTTDIIGSCAFGIDCNSLENPESKFRQMGKRMINFPKLKALKIFFAMMYRKQARWLRIRF

NDEDVSDFFFAVVRDTIRYREENNFERKDFMQLLIELKNKGYMEDDGEYVEELQGGRLEKLTFEEIAAQAFVFFFAGFET

SATTMTFALHLLASNQEVQDRGRKCVYEVLERHDGKLSYEALMEMTYIDCIIQETLRIYPPVATIHRITTKPYKLPNGSV

LPEGVGVVIPNLAFQRDPEFFPEPMQFRPERFFEDEKDKRHNFCHLPFGEGPRICIGMRFGLLQTRMGIAMLLKNYRFRL

CPKSVFPLKTDPINLIYGPAGDVWLGIEKIQ.

 

>CYP6S4 Culex_quinquefasciatus_27_2 (replaced duplicate #33)

77% to 6S3 Aedes, 66% to 6S1 Anoph. MNVLLLLLASLLFALLKWIYSHFQSRYQFWKDRNVPYLEPRFPVGNVADTLKPTIHFAHIMDTLYKKLTKLGDDYAGIYFFRDPVLVVLSPEFAKTVLVKDFNYFVDRGVYSNERDDPLSANLFFMEGHQWRKLRAKLTPTFTSGRLKAMFHTILAVGEQFDRFLGGYVDGVNKVEVKDLLARFTTDVIGSCAFGIDCNSLENPKSEFREMGKRMINFPKLKALKVFFAMMFRDTARKLGIRFNDEDVSEFFFTVVRDTIKYREENNVQRKDFMQLLIELKNKGYMDGEVDGAAEEMSGQRLEKLTFEEIAAQAFVFFFAGFETSATTMTFALHLLASHPEIQEKGRSCVLDVLSRHDNKFSYEAIMEMTYLDWIINETLRIYPPVATLHRMTTKPYKLPNGSIIPKGTGLCVPNLAIQRDPQHFPDPLKFRPERFSEEEKSTRHPFSYLPFGEGPRICIGMRFGLLQTRMGLALLLKSYRFSLCSRSPVPLVIDPVNLIHGPAGDVWLGIEKVQ*

 

>CPIJ016857 CYP6S4 Culex pipiens, 100% to CYP6S4 Culex_quinquefasciatus 77% to CYP6S3

MNVLLLLLASLLFALLKWIYSHFQSRYQFWKDRNVPYLEPRFPVGNVADTLKPTIHFAHI

MDTLYKKLTKLGDDYAGIYFFRDPVLVVLSPEFAKTVLVKDFNYFVDRGVYSNERDDPLS

ANLFFMEGHQWRKLRAKLTPTFTSGRLKAMFHTILAVGEQFDRFLGGYVDGVNKVEVKDL

LARFTTDVIGSCAFGIDCNSLENPKSEFREMGKRMINFPKLKALKVFFAMMFRDTARKLG

IRFNDEDVSEFFFTVVRDTIKYREENNVQRKDFMQLLIELKNKGYMDGEVDGAAEEMSGQ

RLEKLTFEEIAAQAFVFFFAGFETSATTMTFALHLLASHPEIQEKGRSCVLDVLSRHDNK

FSYEAIMEMTYLDWIINETLRIYPPVATLHRMTTKPYKLPNGSIIPKGTGLCVPNLAIQR

DPQHFPDPLKFRPERFSEEEKSTRHPFSYLPFGEGPRICIGMRFGLLQTRMGLALLLKSY

RFSLCSRSPVPLVIDPVNLIHGPAGDVWLGIEKVQ

 

>CYP6t1 D. melanogaster AC012831 comp(42975-44564) no introns

MIAVFSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFV

GNVWNLLRGACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQ

FSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEE

HMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPK

RLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLK

RTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQ

SSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRA

GTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQL

EIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLRFVKNSL

 

>Cyp6t1 D. pseudoobscura ortholog 77%? 1 intron

MILVIGVLFIAATVAAIGLLFFVVFPLVCAAGLIIFGIIWLWQRHHFCHWLRLGVPYIRA

TPFVGNVWKLLRGSCCFGDQFRQLYESKEAAGHAYVGIHVLHNHALLLRDPALIKRILVE

DFSQFSSRFETTDPIGDTMGAQNLFFSKHETWRETHKIFAPFFAVSKVRQMYGLLEHIGQ

QLEEHMEDQLNGKSEIELEVKQLCALFTTDIIASLAFGLEAHSLQKPDAEFRRMCVEVND

PRPKRLLHLFTMFFFPRLSRMVRTHLYSDEYERFMRQSMDFVLAQREKSGEKRHDLIDIF

LQLKRTEPPTSIIHRPDFFVAQASFLLLAGFDTSSSTITFALYELAKAPAIQKRLRDELS

DALRTNRHQPLNFDSVNGLSYLRQVVDEVLRLYPPTAFLDRCCNDENGYDLSAWNCGRAL

KLPAGAPVYISVLGLHRDPV

HWPNPNQFDPEHFSPEQREQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILKNFRVE

LCERTLPEMVFDPKAFVLTAKGGTYLRFVKDTL*

 

>Cyp6t2p D. melanogaster AC014742 1042-2504 64% to 6t1

MVIAFFIFL*CAALAVGSVVLLPLIALLAVWLWQRRHFRIWRRLGVPYLPAAPVLGNVLNVE

CCFGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRRILVEDFPEFSSSF

KSTDAIRDTMGSGNLLFTKYKTWWETHKIFA 

LYGLLERI*QNLEAHMKKK

KLNGAESVELEVKQLCALFTTDI

LQSLQNPEAEFRPMCIEVNDPKPKRLSHHLFT

RVRTHLYSEEYERFMRKSMNYVLAQRAEN*EKRYDLIDMFLQMHRTETAEGIIHRPDFYVAQAAF

LLLAGFDTSSSFALYELAKNPTIEHRLQAELRVDLQSSHNHQLSYDTL

TGLVYLRQVLED

LPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVELCERTLPEMRFDP*

ASVLTAHNGTFLRFVRNSL*

 

>Cyp6t3 D. melanogaster AC015208 comp(17123-18689)

MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQ

LYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTL

PLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRM

CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK

PKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA

GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALR

LYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDER

FWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET

CERTVSEIRFNPKSFMLESENEIYLRFCRSSL

 

>Cyp6t3 D.Pseudoobscura

MVSLWLLMLGILSIYLWLRQRYSYFERHNIVHLPVSAWTPLGHLRKLLLLRISFGDLFHN

IYADPRGGQAKVVGFFLFQTPALMVRDPELIRLVLIKHFNSFLNRYEAADAAGDPMGSLT

LPLAKYHNWRESRQSMAQLFTSGRMRESMYPLMMGVVIDLEQYLQRKLGDRSERMLPLSK

MCQLYTTDVTGNLFYSMDVGGLRRGKSQLLKKTKELFDPDPRKVLDFMSIFFLPQWTNLL

RAKVFSEEYAQFMRGLVGHPRERSKGDLIDQLLHLQSSRPSSHYAQHPDFIASQASIILL

AGFETSSALLGFTLYELAKQPDLQKRLREELAEAFSLAPTLTYETLVTLPFLRKVCLEAL

RLYPAAAFINRECTSSDPNGFSLQPHVDFVVPNGMPAYISILGLHRDEK 

YWPEPNRFDPERFDPDRSKDIIPMTYIPFGAGPHGCIGSRLGSLQLKLGLAHILRLCRVE

VCEQTVPQIRFNPKTFMLESKDEIYLRFYRDKL*

 

>Cyp6u1 D. melanogaster AC017706 15959-17471 also AC008288

MHRTLLTALGALSVVYALVKFSLGYWKRRGILHEKPKFLWGNIKGVVSGKRHAQDALQDI

YTAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQ

LDGHKWRSLHAKSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSLQTINISELVGAYNTD

VMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQ

KVALSQLQLHRRRDRQPLQTFLQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCL

YELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLN

ETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERF

EEQARRSRPAAAFLPFGDGLRGCIAARFAEQQLLVGLVALLRQHRYAPSAETSIPVEYDN

RRLLLMPKSDIKLSVERVDKL

 

>Cyp6u1 D. pseudoobscura ortholog

MDLLHRALLTAVGALSLFYALVKVSLGYWKRRGILHEKPKFFWGNIKGVVGGKRHLQDALQVI

YAKYKGRAPFVGFFACLKPFVLVLDLELVRHILVTHAGNFTTRGLYSNDGSEPLSGNLLQ

LDGHKWRALHAQSTGVFTPANINKLLPRIVLISRGVQRSLGKERLQTLNIN

ELVDSYNLDVVASMAFGLSADRTEFRRWTQSYWGKFSLWRAYLALEFPLLAQLLNHKSYA

VSAMTYFQKVVLGQLQEQRRRDRQPLQTFLQLYSNMDQPLDDVQIAAQAFGFVLAGLVPL

NATLSFCLYELARQPELQDRVRAEIRKTLEQHSGQLTTEGLKELLYTKQVLN

ETLRLHTPYPFLLRRATKEFELPGSVFVIARGNNVLIPTAAIHRDPAIYEEPLRFDPDRF

ETEAKRTRPAMSFLPFGDGLRGCIAAQFVEQELLVGLVTLLQYHRYTPCSKTAIPLEYDN

GRLLLMPKTDIHLNVERVDN*

 

>Cyp6v1 D. melanogaster AC011761 comp(54926-57766) also AC015002

MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQL

RRFYFDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGA

LSLFLAKQPEWREIRTRLAPAFAGAKLKQMFSLMEE

IGCDLEWYLKRLTRDLRRGDAERG

AIVSIKDVCDLYNTDMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLFVIFYL

PKLVPLLRPKLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQQDKSH

FTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRL

TYEAVARMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFISNLAIHHDPK

YWPDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIKLGLV

YFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLKVDCL

 

>CYP6v1 D. pseudoobscura ortholog

MVYSTNILLAIVTILTAVFVWSRRTYVYWQRRRVKFVQPAHLLGNLSKVLRLEESFALQL

RRFYFDERFRNEPIVGIYLFHQPALLIRDLSLVRTVLVEDFVSFSNRFAKCDLRHDKMGS

LNLFFAKQPEWREIRTRLSPVFTGAKIKQMFSLMEE

IGCDLEYYLKRLTRDMRRSDASAR

GVIVSIKDVCDLYNTDMIASIAFGLRSYSLRSTQSEIGSHCQDIFRPNVRRIIDFFVIFY

LPKLVPLLRPRLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQKDKS

HFTHHRDFLAAQAASFEVAGIETCSSSLSFALYELAKQPLMQARLRREIRETFEESPAGS

LSYELIGRMQYLEMIVEETHRKYPIVPLLERECTPINKKRFYSLRPHAECYARRGMPIYI

SNLAIHHDPK

YWPDPERFDPERFSAENKSHQAPMSYLPFGAGPKHCIGMQIGQLQIKLGL

IYFLRRHRVELCEKTVERISFDAKFALLASEHRIYLKVADCL*

 

>Cyp6w1 D. melanogaster AC014226 comp(15025-16689) also AC008257

MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFH

EAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLF

FARSPGWRELRTKISPVFTSGKIKQMYPLMVK

IGKNLQDSAERLGSGTEVQVKDLCSRFT

TDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFS

RETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAA

VFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVV

NETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPE

KYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTI

KKIEWAPTSPVMASKRDIILRVEKVSGKKDFGQK

 

>Cyp6w1 D. pseudoobscura ortholog

MSTELLFLIATVAIVFYVWHKRRHSFWKRHGVKEIGPLPILGDTVGFLTGRLPFFDQIRK

FHEAPGLENEPIIGVYLAYRPALVIRDLDLVKTVMIKKFSYFTNRKLQTDPHDDALGYNN

LFFVRSPEWKELRNKISPVFTTGKIKQMYPLMVK

IGKNLEANVGREPKDSIVTIKSLCAR

FTTDLIATIAFGLDANALQDPKSEFFRHNQAIFAPSVSRAIDFAIIFMLPALTTLAKVKV

FSKSTSQFIRSSINYVMAERERSGLRRNDLVDVLLALKREAAASPDKNNKAKNMDYLVAQ

AAVFQTAGYETSSSTMTLALYEVAKNEEIQNRLRQEIEEYFGDDDHISYERIQEMPYLSK

VVNETLRLYPIVGYAERECAQPSQGERFTLAPHHDMELPDGTPVYVSAVAIQRDPKHWPE

PEKFDPERFDASNRDKLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHLLRNHRVLWCDK

TVKTIEFAPFCGVLASKDEIYLRVERVSS*

 

>CYP6X1v1 Lygus lineolaris (Heteroptera:  Miridae) Lygus bug AY054411.1

Yu Cheng Zhu 8/17/01

MIYFILALAIIWAFVKLYTHVFNYWEQRGFPYVEGKFPLGSDPCLSRPSKFLGLEVQEHYRKLSGHPLGGIYVGRRPDLI

VRDPKIIKNIMVKDFAHFRNRGVEIPSKDSPLTQHLFALEGTKWRALRVKLTPTFTSGKLKLMYSLFVECAQRLERKLNE

DSMKNEGVVDIKDTIARFTTDIIGSCAFGLEIDSLNNPDEPFRKIGMRLFQRNLKGRLIELIYSLAPNLRNYLKLSRTSK

ETEKMFMSGIGQTIEYREKNNVRRNDFLDLLIELKNQGHLYVDRQKDSNIENDHSQDGEAQEKIEMDLGMI TAQCFVFFI

AGFETSSSVQSYALYELAYHQVIQDKVRREIEEVTSKFGGLNYQALHEMPYLDQVINETIRKYPTLHTLTRVCTKPYAVP

GTKYVIEEGIRVLIPVYSLHHDRQYFPDPERFDPDRFSDTNKSSITPFTFLPFGEGPRNCIGMRFGLLQTKIGLVTLLKS

KRVLPTSQTKSPLVFSSSLSVISQNEGSIVLKLENI

 

>CYP6X1v2 Lygus lineolaris AY054412

MIYFILALAIIWAFVKLYTHVFNYWEQRGFPYVEGKFPLGSDPC

LSRPSKFLGLEVQEHYRKLSGHPLGGIYVGRRPDLIVRDPKIIKNIMVKDFAHFRNRG

VEIPSKDSPLTQHLFALEGTKWRALRVKLTPTFTSGKLKLMYSLFVECAQRLERKLNE

DSMKNEGVVDIKDTIARFTTDIIGSCAFGLEIDSLNNPDEPFRKIGMRLFQRNLKGRL

IELIYSLAPNLRNYLKLSRTSKETEKMFMSGIGQTIEYREKNNVRRNDFLDLLIELKN

QGHLYVDRQKDSNIENDHSQDGEAQEKIEMDLGMITAQCFVFFIAGFETSSSVQSYAL

YELAYHQVIQDKVRREIEEVTSKFGGLNYQALHEMPYLDQVINETIRKYPTLHTLTRV

CTKPYAVPGTKYVIEEGIRVLIPVYSLHHDRQYFPDPERFDPDRFSDTNKSSITPFTF

LPFGEGPRNCIGMRFGLLQTKIGLVTLLKSKRVLPTAQTKSPLVFSSSLSVISQNEGS

IVLKLENI

 

>CYP6X1v3 Lygus lineolaris AY125086

MIYFILALAIIWAFVKLYTHVFNYWEQRGFPYVEGKFPLGSDPC

LSRPSKFLGLEVQEHYRKLSGHPLGGIYVGRRPDLIVRDPKIIKNIMVKDFAHFRNRG

VEIPSKDSPLTQHLFALEGTKWRALRVKLTPTFTSGKLKLMYSLFVECAQRLERKLNE

DSMKNEGVVDIKDTIARFTTDIIGSCAFGLEIDSLNNPDEPFRKIGMRLFQRNLKGRL

IELIYSLAPNLRNYLKLSRTSKETEKMFMSGIGQTIEYREKNNVRRNDFLDLLIELKN

QGHLYVDRQKDSNIENDHSQDGEAQEKIEMDLGMITAQCFVFFIAGFETSSSVQSYAL

YELAYHQVIQDKVRREIEEVTSKFGGLNYQALHEMPYLAQVINETIRKYPTLHTLTRV

CTKPYAVPGTKYVIEEGIRVLIPVYSLHHDRQYFPDPERFDPDRFSDTNKSSITPFTF

LPFGEGPRNCIGMRFGLLQTKIGLVTLLKSKRVLPTAQTKSPLVFSSSLSVISQNEGS

IVLKLENI

 

>CYP6Y1 Anopheles gambiae (mosquito) CYPm3r6 =, 504aa

MFLQLVGVVLAIVLSCLAWIHRRYHFWKDRSVAYIKPRFPFGNFATLGKVEHIAPITQRHYDHFKRQNVPYGGVFMLTSPLLYIFDTKLIKQLLVKDFHHFPNRGVYFNERDDPLSAHMFAIEGQKWRTLRAKLSPTFTSGRIKMTLPLITQVCERFCEHLNESLQSSDEIEVHDLLSRYTIDVIGACAFGIECNSFREPDNEFRRYGKIAFDKLRHSPLVVYLMKAFRAHANALGMKQLHDDVSGFFMRVVKDTVEYREREQIVRNDFMDLLLKLKNTGRLEADGEEIGRLTFEEIAAQAFIFFTAGYDTSSTAMSYTLYELALNPEVQERARECVKQTLQKYDGKLSYEAVSEMSYLEQCISETLRKHPPVAILERNADKDYRLPDSGLLLRRGQKIMIPIYAMHHDPAHFPEPEQYRPERFSPDEVARRDPYCYLPFGEGPRVCIGMRFGSIQAKLGLASLLDRFRFSACDRTQIPVQYSRTNFILGPANGVWLRVEVLDA*

 

>CYP6Y1 Anopheles funestus AY987361

DFSLYELALKQDVQDKARQCVKETLQKYGGKLSYEAVSDMSYLD

QCINETLRKHPPVAILERNADKDYRLPDSGLLLRRGQKIMIPIYAMHHDSTHFPDPEQ

YRPERFSPEEVAKRDPYCYLPFGDGPR

 

>CYP6Y2 Anopheles gambiae (mosquito) CYPm3r5 = , 519aa

MELVVTSVISLGVLLATLCLCVYLLVVRKYSFWRSYHVPYVEPELPYGNFKEMGKSIHPAHLSQRFYEQYKAVPGSPGFVGLYIFLNPVLLVTDLKLAKRILIEDFHHFPDRGVYFNEKDDPLSAHLFAIEGQRWKDLRAKITPTFTSGRMKAAFPLVLGIAEQFCGFLREQYTSDDVVEVRDLMARFTTDVIGSYAFGLELNSFRDPQNEFRRIGRKHFDTPRNHPLKVFIMKTFRGLANRLGLKLLHDDVAAFFQSVIRETIHHREGHGVRRNDFLDLLIRLKNTGSLEGSHEIVGRLSGDEIAAQAFIFFTAGFETSSSAMTYTLYELALNQEAQRKARECVLETLAKHDGVVSYESSKNMLYLDQCIYETLRKYPPVAILERIVTKPYRIPDTSVTLHPGMKIMIPAYAIHHDPDIYPEPATYDPDRFTPERMARRDPCAYLPFGEGPRICIGLRFGMMQARIGLALLLKHFQVLPCKETDVPLTYSPRAFVLTPVNGVRLRLVKYDAHGAAEGN*

 

>CYP6Y3 Aedes aegypti (yellow fever mosquito) 1.371_10 AAGE01054542 76% to 6Y1

MWLVYLVWLVAAVLLAVYLWIKKRFNFWKDRGVEYIEPEFPFGNFKTLGKVEHIAPITQR

HYDYFKQKGVPYGGVFMLTSPLLYILDTKLIKTLLVKDFNHFPNRGVYFNEKDDPLSAHMFAI

EGNKWKTLRNKLSPTFTSGRIKMTFPLVVGVCQQFCDHLGEVVQQSNEVEMHDLLSRYTI

DVIGTCAFGIDCNSFREPDNEFRKYGKIAFDKLPHSPLVVYLMKAFRSYANAFGMKQLHE

DVSSFFSKVVKDTIEYRESNNVVRNDFMDLLLKLKNTGRLEESGEEIGKISFEEIAAQAF

IFFTAGYDTSSTAMTYTLYELALNQKAQEKARKCVLDIFAANNGTLTYESVGNMGYLDQC

INETLRKHPPVAILERNADRDYKLPDSDIVIKKGRKIMIPTFAMHHDAEHFPDPERYDPDR

FSPEQVACRDPYCYLPFGEGPRICIGMRFGTIQARVGLASLLKRFRFRVCDKTQIPVRYSK

TNFILGPANGVWLRVEKL*

 

>CYP6Y4 Culex_quinquefasciatus_29

57% to 6Y3 Aedes, 64% to 6Y2 Anoph.

MSPIQLIVNGLLVILFIALGALIFIKHRYGYWRRRGVSYLEPEFPFGNFKEMGKSIHPAH

LTQQIYTQFKGRSSFVGLYIFLNPVLLVTDLSLIKRILIKDFNHFPNRGVYFNERDDPLS

AHLFSLEGRKWHDLRAKISPTFSSGRIRMTFPAVLEVAQRFCTYLEQSCIGKEAAEIRDA

MARFTTDVIGSCAFGIECNSFKEPDNEFRRVGRKHFDTPRNHPLKVFVMKTFRGLANGLG

IKLIHDDVAEFFLDVVRRTISHREENNVSRNDFLDLLIKLKNTGRLEADGGDIGQLSFSE

IAAQAFIFFTAGFETSSSALTYTLYELALNPVIQEAARVSVFETFDKFNGELSYECCQAM

TYLDQCINETLRKYPPVVNLERAVDKDYLIEESNLILPKGLKIMIPAFAIQHDPDFYPNP

ERYNPTRFSPDQQAARDQCTFLPFGEGPRICIGLRFGMLQARVGLAMILKNFRILRCEKT

EDPVVYSTRAFVLTPINGMWLKLEKLSK*

 

>CPIJ016850 CYP6Y4 Culex pipiens 100% to CYP6Y4 Culex_quinquefasciatus

MSPIQLIVNGLLVILFIALGALIFIKHRYGYWRRRGVSYLEPEFPFGNFKEMGKSIHPAH

LTQQIYTQFKGRSSFVGLYIFLNPVLLVTDLSLIKRILIKDFNHFPNRGVYFNERDDPLS

AHLFSLEGRKWHDLRAKISPTFSSGRIRMTFPAVLEVAQRFCTYLEQSCIGKEAAEIRDA

MARFTTDVIGSCAFGIECNSFKEPDNEFRRVGRKHFDTPRNHPLKVFVMKTFRGLANGLG

IKLIHDDVAEFFLDVVRRTISHREENNVSRNDFLDLLIKLKNTGRLEADGGDIGQLSFSE

IAAQAFIFFTAGFETSSSALTYTLYELALNPVIQEAARVSVFETFDKFNGELSYECCQAM

TYLDQCINETLRKYPPVVNLERAVDKDYLIEESNLILPKGLKIMIPAFAIQHDPDFYPNP

ERYNPTRFSPDQQAARDQCTFLPFGEGPRICIGLRFGMLQARVGLAMILKNFRILRCEKT

EDPVVYSTRAFVLTPINGMWLKLEKLSK

 

>CPIJ016851 CYP6Y5 Culex pipiens 60% to CYP6Y4

(missing about 80 aa near N-term in a seq gap)

MWLVLLTWLAIALPLGAFAWFKKRFRFWSDRGVEFIEPELPYGTQDAR

 

TLRNKLSPTFTSGRIKMTFPLV

VEVCKQFCDHLEEVVQGVNEVEMHDLLSRYTIDVIGTCAFGIECNSFRDPDNEFRRYGKI

AFDKLPHSPLVVYLMKAFRKYANALGMKMLHEDVSSFFSNVVRDTIDYREKNNVVRNDFM

DLLLKLKNTGRLEEAGEEIGKLSFDEIAAQAFIFFNAGFDTSSTAMTYTLYELAMNREAQ

EKARKCVLDIFAANGGQLTYESVANMGYLDQCISETLRKHPPVAILERNADKDYRIPDTD

LVIAKGRKIMVPIFAMHHDEEHFPDPEAYKPERFSPEEVAQRDPYCYLPFGEGPRICIGM

RFGQIQARVGLANLLRRFRFSVCDRTQIPVKYSRTNFILGPANGVWLKVEKL

 

>CPIJ019703 CYP6Y6 Culex pipiens 59% to CYP6Y4

This seq is nearly the same as CPIJ016851 (5 aa diffs)

with 53 extra aa from the gap region, still missing the N-term

gc boundary after VVRQ

MLSSPAAVHLDVKLIKTLLVKDFGYFPNRGVYFNERDDPLSAHMFAIEGQKWK

TLRNKLS

PTFTSGRIKMTFPLVVEVCKQFCDHLEEVVQGVNEVEMHDLLSRYTIDVIGTCAFGIECN

SFRDPDNEFRRYGKIAFDKLPHSPLVVYLMKAFRKYANALGMKMLHEDVSSFFSNVVRDT

IDYREKNNVVRNDFMDLLLKLKNTGRLEEAGEEIGKLSFDEIAAQAFIFFNAGFDTSSTA

MTYTLYELAMNREAQEKARKCVLDIFAANGGQLTYESVANMGYLDQCISETLRKHPPVAI

LERNADKDYRIPDTDLVIAKGRKIMVPIFAMHHDAEHFPDPEAYKPERFSSEVVRQ (0)

RDPYCYLP

FGEGPRICIGMRFGQIQARVGLANLLRRFRFSVCDRTQIPVKYSRTNFILGPANGVWLKV

EKL

 

>CYP6Z1 Anopheles gambiae (mosquito) CYPm3r14 =, 494 aa

MILYTIGLIVTFVFLALKYVYSYWDRQGLPNLRPEIPYGNLRILAQKKESFNVAINDLYDRSSERLVGVYLFFRPAILVRDAHLAKRIMVNDFQHFHDRGVYCNEHSDPMSANLFALPGQRWKNLRAKLTPTFTSGQLRHMLPTFLAVGSKLEQYLERLANEKQIVDMRDIVSRYVLDVVASVFFGFEANCLHDPDDAFRVALRDLNNPDSFINNIRTAGVFLCPGLLKFTGINSLSPPMKKFTTEVISSHLHQRETGQVTRKDFIQMLTDLRRKAGSSGEETLTDAQCAANVFLFYGAGADTSTGTITFTLHELTHNAEAMAKLQQEVDEMMERHHGEITYDNINGMKYLDLCVKETLRIYPALAVLNRECTIDYKVPDSDTVIRKGTQMIIPLLGISMNEKYFPEPELYSPERFDEATKNYDADAYYPFGAGPRNCIGLRQGLLLSKIALVMMLSRFNFSATIPRKIKFEPVSITLAPKGGLPMRIENRAKH*

 

>CYP6Z2 Anopheles gambiae (mosquito) CYPm3r13 = , 488aa XM_317252.2|

MFVYTLALVAAVIFLVLRYIYSHWERHGLPHLKPEIPYGNIRTVAEKKESFGTAINNLYHKSSDRLLGIYLFFRPAILIRDPHLAKRIMVNDFQNFHDRGVYCNEEHDPFSANLFALPGQRWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLIDRMNKVADEKAIVDMRDIASRFVLDTIASVFFGFEANCIHNSEDPFLSTLRRANRGRNFIDNFRSSGVFICPGLLKLTRMTSLQPELIKFVMEIITHQIDHREKNQITRKDFVQLLIDLRREADKGSEEALTIEQCAANVFLFYIAGAETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLLSISMNEKYFPDPELYSPERFDEATKNYDADAYYPFGAGPRNCIGLRQGVLVSKIGLVFLLSKFKFQATTPAKVKFAAATVGLTPDAGFPMRIDHRK*

 

>CYP6Z3 Anopheles gambiae (mosquito) CYPf2r10 = , 498aa

MFVYTLALFAVVLYLALRYVYSYWARQGFPHLRPEIPYGNLRALAEKRESFGVAVNELYTRSTERLLGVYLFFRPAILVRDAHLAKRILVADFQHFHDRGVFCDEHRDPMSANLFALPGARWKRLRAKLTPTFTSGQLRQMMPTFLDVSEKLLAELEPLAAEGRVVDMRDISSRYVLDVIATVFFGFETHCLRDPNDPFVEPLRDLNNPNSFVNNIRSAGVFVCPGLLKLTGLSSLPPGMRQFATEVVTHQIEHRERHPQQRRKDFIQLLIDLRREANGQDALTIAQCAANVFLFYVAGADTSTGVISFTLHELTHNGEAMAKARQEIDHVLERHGGVISYESLQELAYLDLCVKETLRKYPGLPILNRVCTEDYPVPGAADVVIRAGTQVIIPLLGISMDEKYFPEPEVYMPQRFDEQAPNYDPDAYYPFGLGPRNCIGLRQGIMLSKIGLVLMLSRFDFEATVPRKVRFEPANVTLTPDGGLPMKITVRGDRAKVQ*

 

>CYP6Z4 Anopheles gambiae (mosquito) CYPm3r12 = , 492 aa

MFVYTLALVATVIFLVLRYIYSHWERHELPHLKPEIPYGNIRTVAEKKESFGIAINNLYHKSSDRLLGIYLFFRPAILIRDPHLAKRIMVNDFQNFHDRGVYCNEEHDPFSANLFALPGQRWKNLRAKLTPTFTSGQLRNMLPTLLDVGNKLIDRMNKVADEKAIVDMRDIASRFVLDTIASVFFGFEANCIHNSEDPFLSTLQRLTKSRKFMDNFRTSGVFICPGLLKLTRITSLPPELISFVMEIITHQIDHREKNQITRKDFVQLLIDLRREAENGSEKALSIEQCAANVFLFYIAGAETSTATISFTLHELSHNPEAMAKLQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLRKYPGLPILNRECTIDYKVPDSDVVIRKGTQVIIPLLSISMNEKYFPDPELYSPERFDEATKNYDADAYYPFGAGPRNCIGLRQGVFVSKIGLVLLLSKYNFQATTPAKVKFAVATVVVTPEDGFPMRVEHRC*

 

>CYP6Z5v1 Ochlerotatus sollicitans DQ427067

GLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSMDEKYFPE

PDRYYPERFDEATREYDEKAYFPFGEGPRNCIAFRMGVLVAKIGLILLLSKFSFKATQ

GPKITFVPASVPLLPKGGVSLKISCRNK

 

>CYP6Z5v2 Ochlerotatus sollicitans DQ427068

GLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSMDEKYFPE

SDRYYPERFDEATREYDEKAYFPFGEGPRNCIAFRMGILVAKIGLILLLSKFSFKATQ

GPKISFVPASVPLLPKGGVSLKISSRNK

 

>CYP6Z5v3 Ochlerotatus sollicitans DQ427069

GLPILNRECTLDYKVPDSDVTIRKGTQIVVPLFAYSMDEKYFPE

PDRYYPERFDEATREYDERAYFPFGEGPRNCIAFRMGILVAKIGLILLLSKFSFKATQ

GPKISFVPASVPLLPKGGVSLKISCRNK

 

>CYP6Z5v4 Ochlerotatus sollicitans DQ427070

GLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSMDEKYFPE

PDRYYPERFDEATREYDEKAYFPFGEGPRNCIAFRMGILVAKIGLILLLSKFSFKATQ

GPKISFVPASVPLLPKGGVSLKISSRNK

 

>CYP6Z5v5 Ochlerotatus sollicitans DQ427071

GLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSMDEKYFPE

PDRYYPERFDEATREYDERAYFPFGEGPRNCIAFRMGILVAKIGLILLLSKFSFNATQ

GPKISFVPASVPLLPKGGVSLKISSRNK

 

>CYP6Z5v6 Ochlerotatus sollicitans DQ427075

ETLRKYPGLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSM

DEKYFPEPDRYYPERFDDATRDYDEKAYFPFGEGPRICI

 

>CYP6Z5v7 Ochlerotatus sollicitans DQ427082

ETLRKYPGLPILNRECTLDYKVPESDVTIRKGTQVVVPLFAYSM

DEKYFPEPDRYYPERFDEATREYDEKAYFPFGEGPSICI

 

>CYP6Z6 Aedes aegypti (yellow fever mosquito) 1.371_16 CYP6Zae2

MFIYTFALFWLALVLVLRYIYSYWDRNGLASIKPQIPYGNLKSVAQK

TQSFGVATCELYWKSQERLAGIYLFFRPAVLIRDAHLAQRIMTTDFSYFHDRGVYCNEEI

DPFSANLFAL

PGKRWRNLRHRFTPLFTSGQLRCMMPTILDVGHKLQKFLEPAAERQEVVDIREIVSRGVL

ELIASLFFGFEADCINDPDDAFSKTLREFQLGGFMNNFRTACTFVCPELLQVTRISSLSP

QMIKFATDVVTKQIEHREKNNVSRKDFIQLLIDLRREEANNNEVALSFEQCAANVFLFYV

AGSDTSTSAITFTLHELTQNPEVMDKLQSEIDEMLVQTNGELTYTAIKELPYLDLCVKET

LRKYPGLAILNRKCTKSYAVPESSVVIQEGTQIMIPLLAYGMDEKYFPEPERYYPERFNK

QSKNYDEKAYYPFGEGPRNCI

AYRMGVMVSKIGLILLLSKFKFEATQGPKIVFSAATVPLVPKGGIPVKISNR*

 

>CYP6Z7 Aedes aegypti (yellow fever mosquito) 1.371_17 AAGE01005406

MLFVYTLTILSIAITLVLKFVYSYWDRYGVQNIKPHIPFGNLKTVVKKTESFGVAINQLY

WQTKGQLVGIYLFFRPAILIRDAHLAQQIMTTDFNHFHDRGVYCNEEGDPFSASLFSLPG

KRWRNLRNKLTPLFTGGQLRGMMPTILAVGDKLX

KHLEPVAENREPIEIRDIVSRFV

LEIIATVFFGFEANCIKDRNDAFCRVLREAQRESMYTNFRAAAVFVCPGLLKYTGISSLE

PEVKEFVSGIVTEQIEHREKNGATRKDFIQQLIELRREDSQNQNVRMSIEQCAANVFLFY

IAGSETSTGTITFTMHELSQHPEVMKKLQAEIDDTLAKSNGEITYENVNQIQYLDLCVKE

TLRKYPGLPILNRECTSDYKVPDLDLVIRKGTQVVIPLYGISMDEQYFPEPECYKPERFD

GASKNYDEKAYYPFGEGPRNCIAFRMGVLVSKIGLVLLSSKFNFKPTQGPKIVFSPAAVP

LVPKGGISLMISRRDKVADLYMGLHISVVLKVVCS.

 

>CYP6Z8 Aedes aegypti (yellow fever mosquito) 1.371_18 AAGE01065173 6Z3 like

MFIYTFALFWLAVAFAIRYIYSYWDRNGLPSIKPHIPYGNLKAVANRTESFGVATCDLYW

KSKDRLVGIYLFFRPAVLIRDAHLAQQIMTTDFSHFHDRGVFCNEEVDPFSANLFALAGK

RWRNLRNKFTPLFTAGQLRCMMPIILSVGHKLQNVLEPAAKKQEVLEIRELVSRCVLDII

ASVFFGFEANCINDPNDAFIQNLRELQYDGFFNNLRAAASFICPELLKLTRISSLSPEMI

RFVTDIVTKQIEHREKNKVTRKDFIQLLIDLRREDTNNNEAALGFEECAANVFLFYVAGS

DTSTSAVAFTLHELTQNAETMGKLQTEIDEMLVKTSGELTYDGIKEMSYLDLCVKETLRK

YPGLAILNRECTKSYAVPNSDILLKKGTQVVIPLLAYGMDEKYFPEPDRYLPERFDKSTK

NYDEKAFYPFGEGPRNCIAFRMGVMVSKICLVLLLSRFNFEATRGPKIDFTPSTVAL

LPKGGIPVKISIR.

 

>CYP6Z9 Aedes aegypti (yellow fever mosquito) 1.371_19 CYP6Zae1

MLFIYSVALLCIAVTLALKYVYSYWDRHGLPSVKPHIPFGNLKTVVKKTESFGIAINQLYWQTKGQLAGIYLFFRPAILV

RDAHLAQQIMTTDFNHFHDRGIYCNEEGDPFSANLFALPGKRWRNLRNKLTPLFTGGQLRGMMPTILEVGEKLQKHLEPV

AERQEVVEIRDIVSRFVLEIIATVFFGFEANCIEDRDDSFSKVLREAQGERLSAVLRAAAMFVCPGLLRYTGISSLEPQV

IAFVSEIVTKQIEHREKNSVTRKDFIQQLIEIRRGSGENQVPAMSIEQCAANVFLFYAAGSETSTGTIAFSMHELSHHAD

VMKKLQDEIDDALAKSNGAITYESVMQMQYLDLCVKETLRKYPGLPFLNRECTMDYKVPDSDLVIRKGTQLVLPIYGFSM

DEQYFPEPECYIPERFEEASKNYDEKAYYPFGDGPRNCIAYRMGVLITKIGLILLLSKFTFEATQGPKMMFSSASVPLLP

KDGISLKISNRKR*

 

>CYP6Z10 Culex_quinquefasciatus_05

58% to CYP6Z4 Anoph.

MILLSLALLGLILFLGLRYIYSYWERHELPHVKPEIPYGNLRPVAERRECFGVAISELYKKSTEQLLGIYLFFAPAIMVRDARLAKQIMTSDFASFHDRGVFVDERNDPFSANLFALPGKKWRTLRNKLTPTFTSGKLRNMLPTILDESKRFQDYLTRVVGDKGDTVEMRDLASRYIVDIIASVFFGFEADSMNDPEHPFRVVGREAVADSFSNNIRSAATFVCPGLLKLIQIPSTPPKISGFMIDLVKQQMEYREKNNVSRKDFFQQLVDLRKEDLLKGEDTMSIEECAAQVFLFYIAGSETTSVTITYTLHELSHNSKAMEQLVAEIDETLAKSNGEINYDIVKGMRYLDVCVKETLRKYPGLPILNRECTQDFQVPQSKVVIKKGTQIIIPISAYGMDERYFPDPDSYIPERFFEESKNYDDNAYQPFGDGPRNCIGIRMGVFVAKAALIMLLSNFTFEATQGPKIEFAASSVTLLPKGGIKFKVGQRKVKAA

 

>CPIJ015428 CYP6Z10 Culex pipiens 98% to CYP6Z10 Culex_quinquefasciatus

MILLSLALLGLILFLGLRYIYSYWERHELPHVKPEIPYGNLRPVAERRECIGVAISELYK

KSKEQLLGIYLFFQPAILVRDARLAKQIMTSDFASFHDRGVFVDEKNDPFSANLFALPGK

KWRTLRNKLTPTFTSGKLRNMLPTILDESKRFQDYLTRVVGDKGDTVEMRDLASRYIVDI

IASVFFGFEADSMNDPEHPFRVVGREAVADSFSNNIRSAATFVCPGLLKLIQIPSTPPKI

SGFMIDLVKQQMEYREKNNVSRKDFFQQLVDLRKEDLLKGEDTMSIEECAAQVFLFYIAG

SETTSVTITYTLHELSHNSKAMEQLVAEIDETLAKSNGEINYDIVKGMRYLDVCVKETLR

KYPGLPILNRECTQDFQVPQSKVVIKKGTQIIIPISAYGMDERYFPDPDSYIPERFFEES

KNYDDNAYQPFGDGPRNCIGIRMGVFVAKAALIMLLSNFTFEATQGPKIEFAASSVTLLP

KSGIKFKVGQRKVKAA

 

>CPIJ004410 CYP6Z11 Culex pipiens 60% to CYP6Z10

MFLLPIALLVAGFVFRCLVHIFSYWKRYGLPHLKPEIPFGNLRALLERRQCIGVAISELYRQSAEQLVGVYLFFKPAILV

RDAGLANQIMTSDFASFHDRGTWNNPRSSNVFSLPLRPWKQVRHVLSPCFTPGKLRLMIPTVLDVGKKLEDYLSESAERG

EIVELRDICTRYVLDIIALTMLGFEADTLNHPDHPFYTIGRELVRNSFLNNIRTAATFLFPEFYKLTKIPSISPKLSRYL

VSLFNEQSDFRERNNVSRKDFFQSLLDLRQEDREHNRKALSVQQCASNINVFYIAGSETTGGTVIFTLHELTHHPEVMEK

LVNEIDETLERSEGLIDYDVIKGMRYLDVCVKETLRKYPGLPILNRKCTQDYQVPNSKVIIRKGTQLIIPLLAYAKDERY

FPEPDKYSPERFLEESKNFVDDAYTPFGDGPRQCIATQMGIVIAKITLVMLLSKFRFEATQGPTLEFAVSQVPLGPKHGI

KLRIFRRNVNTAENTGEVRYSRNII.

 

>CPIJ004411 CYP6Z12 Culex pipiens 60% to CYP6Z10

MFLLTIGLLGLVLYLGLRYIFSHWDRHQLPSIKPEVPYGNLRDVAKRRQSFGVLISDLYWKSTEQLLGIYLFFQPAILVR

DAHLAKQIMVTDFGSFHDRGVYNDEKTFSSNVFSLPLKPWKPLRQKLAPNFSTGRLRSIIPTILDAGKKLEHYLDRSADK

EEVVELREVVTRYVLDIIGLVMFDLKVDTLNNPEHPFCLVGQEILRNSFSNNLRTAATFVCPGIYKITNISSISPIVETF

MIDLFTRQKEIREKSSLNKKDFIQSLIDLHSEDRDQNREALNTLECGSNMFIFYIAGSETSSGTTIFTLHELTHHPEVMA

KLVKEIDETLERSKGLIDYDVIKGMQYLDVCVKETLRKYPGLPILNRKCTQDYQVPNSKTVIRKGTQLIIPLLGFAMDER

YFPEPEKYSPERFLEASKNYVDDAYAPFGDGPRQCIATQMGITVVKVTLVMLLSKLNFEATQGPKIKFAAASVPLRPDGG

IKLKISRRIVAAK.

 

>CPIJ019586 Culex pipiens (not certain about exon boundaries)

CYP6Z13P pseudogene 58% to CYP6Z10, & = frameshift and small deletion

63% to CPIJ008566

MLLLSVALLAIVLLLGLQYIFSYWHRHGLPHLKPEIPYGNLRSVAKRQQSLGVAITELYR

RSTEPLVGIYLFFTPAILVRDATLAKRILTVDFGSFQDRGVLYDKKRDLFSCNMFAAPLS

SWRPVRSKLTAAFSLSQLRGMLPTVLDVGTKLEDRLGVAAESGDAVDLNGICMRYVVDVI

AEVLFGFKADSIGNPEHPFYTIGGKLIQNTVMNNVRTSGTFI &

LSSISRKVSNFMISLVRQQMKYR

AKNDLARKDFLQLLTDLHQED

LSVEECAANVNLFYTAGSETTKATVIYTLHELAHHPEVM

GRLVEEVDECLKQSGGEISYDLVKSMSYLDVCRKETLRKYPGLFFLNRKCTHDYQVPNSW

LVIKKGTQLVIPLKAYGMDERYFPNPESYIPERFLEDTKNYDENAYAPFGNGPRKCIAPR

MGIFVAKVTLVRLLSKFRFEATQELKIEFAPSVVPLVPKDGVRMKIHRRCI

 

>CPIJ019587 CYP6Z14 Culex pipiens 61% to CYP6Z9

MIIYSLILICSSIYLILRYIYSYWDRHDLPNLKPDIPFGNIRTVALKQESFGVALNALHA

KTTGQLVGIYLLFRPAILIRDAHLAHRIITSDFNYFHDRGVHCDESSDPFSAHLFALPGK

RWRSLRNKLTPTFTAGQLRGMLPTILTVGRKIQAFLEPKAKRGQVIEARDLISRFVLEIV

ASVFFGYEINSIHDPEDSFRTVLRSFREDNHVTNLRTVGAFLCPALLKVSRVKTVPEVLD

NFVNKIVREQIEYREKNNVTRKDFIQLLIDLRQEKSDFGLSLEQCAANVFLFYAAGADTT

TDAITYTIHELTHRPDLMQKVQVEIDDALEKSNGEINYDVVHEMKLLDNCVKETLRKYPF

PILNRECTQDYQVPDSKLIIRKGTPVIIPLQAYGMSEEYFPEPNRYLPERFDPSTKNYDE

KAYFPFGDGPRNCIGSRMGSSVSKIGIIMLLSRFNFEATQGAQIDFARAQIALAPENGIS

LKISNRISNLM

 

>CPIJ008566 CYP6Z15 Culex pipiens 66% to CYP6Z10

MFLLSIVLLGLVTFLGLYYIFSYWSRYGLPHLKPEVPYGNLRAVAERRQSFGVAISELYR

KSTEQLLGIYLFFQPAILVRDASLAKQIMTSDFGSFHDRGIYHDEKSFSSNIFSASLKPW

KQVRHKLTPNFSTGKLRNMVPTVLDVGKKLESYLAEHADRGEIVELREICTRYVIDIIAL

VLFGFEMDSINDPDHPFYVVGRELVRNSFSNNLRTAATFICPGILKLTKISSVSPKVSDF

MVELVKKQLELREKDCVTRKDFFQSLIDLRHEDRDREALSIVECASNVNLFYIAGSETTG

GTIIFTLHELTHNPAVMKQLLAEIDEALERSGGQIDYDVVKGMRYLDVCIKETLRKYPGL

PILNRKCTQDYRVPNSKMTIRKGTQLIIPLLAYAMDERYFPEPEKYMPERFFEETKNYDD

DAYAPFGDGPRQCIATQMGITVAKVTLVMLLSKFSFEATHGQRIEFAPSSVPLGPKDGIK

LKISRRNI

 

>CPIJ020018-pt 1 CYP6Z16 Culex pipiens

(partial CYP6Z- gaps in contig missing 5')

84% to CPIJ019586

PEHPFYTIGGKLVRNTLINNVRTSGTFICPDLLKLMR

VSSISREVSNFMTNLATQQMKYREKNDLARKDFLQLLNDLHQVDLSAEECASNVNLFY

TAGSETTKSTVIYTLHELAHHPEVMRRLVEEVDEYVKQSGGEISYDLVKSMPYLDLCVKE

TLRKYPGLFFLNRKCTHDYKVPNSRLVIKKGTQIIIPSMAYGMDERCFPNPESYIPERFL

EETKNYDEDAYAPFGEGPRKCIAPRMGIFVAKVTLVRLLSKFRFEATQELKVEFAPSVIP

LVPKDGVRMKIHKRSVW*

 

>CPIJ020018-pt 2 CYP6Z17 Culex pipiens

(partial CYP6Z- gaps in contig missing 5')

92% to CPIJ019587   CYP6Z14

GLSLEQ

CATNVFLFYVAGADTSTDAITYTVHELTHRPDLMKKVQAEIDDALEKSNGEINY

DVLHEMKLLDNCVKETLRKYPFPILNRECTQDYQVPDSKLIIRKGTPVIIPLQAFGMSEE

YFPEPNRYLPERFDSSTKNYDEKAYIPFGDGPRNCIGSRMGSAVSKIGIIMLLSKFNFEA

TQGAEIGFARAQIALAPENGISLKISNRIRNSI*

 

>CYP6AA1 Anopheles gambiae (mosquito) CYPf2r1 = , 505aa

MGYVSVVLFLVVPALTLLYLYLKQHYRHWANRNLPQLEASFPLGNMKGVGSEIHFNDVLNEAYAKGKAQSAPLVGLYFMLKPILIVTELDMVKRILVKDFSSFHDRGLYVNERDDPLSGHLFALDGERWRYLRNKLSPTFTSGKIKLMFSTICEIGDEFLATVNRFVERDEPLDVKLLSQCFTCDVVGSCAFGLQCNSLKNGGSKLLEIGDKVFKPPAWRNMLAFALISFKKLAKRLRLPVLPGEVTSFFMPLVTETVADRERNSIERPDFLNLLIQLKNKGTVEDETTEGLQKLTLDEVAAQAFVFFFAGFETSSTTLSFALFELANNPDIQERVRAEMLEKLQLHDGKITYDALKEMTYLDQVINETLRMYPPVPQLIRVTTQPYKVEGANVSLEPDTMLMIPIYAIHHDASIYPDPERFDPDRFALAATHARHTHAFLPFGDGPRNCIGMRFGLLEVKFGIVQMVSKLRFTVSERMQMPLRMSKTASILEAEGGIWLNATKL*

 

>CYP6AA2 Anopheles gambiae ,501 aa CYPf2r2 =

MTVWLLLVVVVATLLYYYVWRRYRYWRDRGIAELDPSFPLGDMKGVGTTRGFNDMLDEAYGRVRGKSAAVGVYFLISPILIVADLDLAKQILVKDFHLFHDRGMYVNERDDPLSGHLFSIGGERWRYLRNKLSPTFTSGKIKSMFFTIREIGDELLACFDKYIDCGDPIDIKLLCQCFTCDVVGSCAFGLQCNSLKNGGSKLLEIGDKVFRASPMRMVYSMAIGIFPRLSRALRLPALPGDVSAFFRPLVQSTVEHRERNAVERPDFLNLLIQLKNKGTVEDEATEELQKLTLDEVAAQAFVFFFAGFETSSTTLSFALFELANNPNIQERVRAEVLEKLQLHDGRITYDALKEMTYLDQVINETLRLYTPVPQLFRVTNESYHLPSLNVTLEKGTMVLIPVHSYHHDPALFPEPYRFDPDRFTADAMKARHSHAFLPFGDGPRNCIGMRFGLLEVKFGLVQVLNKLRLTVNERTALPLRMSKRSGFPEAEGGIWLNASRL*

 

>CYP6AA3 Anopheles minimus AY129952

MGYVNVVFYLVLPALGLLYYYVKQHYRYWANRNIPQLEASFPVG

NMKGVGSKLHFNDVLGEAYDKGKSKTAPLVGLYFMLKPVLIVTDLDMVKRILVKDFNS

FHDRGLYVNERDDPLSGHLFALDGERWRYLRNKLSPTFTSGKIKLMFTTICEIGDEFL

ASVTRYVDREAPIDVKLLSQCFTCDVVGSVAFGLKCNSLKNEGSKLLEIGDKVFKPPA

WRNMLTFMLISCKKMAKRLHLPALPSEVGSFFMPLVSETVHDRERNAIVRPDFLNLLI

QLKNKGTVEDESSEGLEKLTLDEVAAQAFVFFFAGFETSSTTLSFALFELANNPAIQE

RVRAEVLEKLKLHDGQITYDALKEMTYLDQVINETLRMYPPVPQLIRVSTQPYTVEAT

NVTLDRDTMLMVPIYAIHHDANIYPEPERFDPDRFAPDAVHSRHTHAFLPFGDGPRNC

IGMRFGLLEVKFGIVQMLSKLRFTVNSRMQLPIKLSKAAAMLEVEGGIWLNATKL

 

>CYP6AA4 Anopheles funestus EU852640

MGYVNVVLYLVLPALTLLYYYAKQHYRYWTKRNVPQLEASFPVG

NMKGVGTKRHFNDVLDEAYDKGKAESAPLVGLYFMLKPVLIVTDLDMVKRILVKDFNS

FHDRGLYVNERDDPLSGHLFALDGERWRYLRNKLSPTFTSGKIKQMFTTICEIGDEFL

ASVNRYVDRDAPIDVKLLSQCFTCDVVGSCAFGLQCNSLKNEGSKLLEIGDQVFKPPV

WRNMLVFLLISCKELGKRLRLPVLPGDVTSFFMPLVTETVRDRERNAIERPDFLNLLI

QLKNKGTVEDDATEGLEKLTLDEVAAQAFVFFFAGFETSSTTLAFALFELANNPDIQE

RVRAEVLEKLKLHDNQITYDALKEMTYLDQVINETLRMYPPVPQLIRVATQPYAVAGT

NVTLDRDTMLMVPIYAIHHDATIYPDPKRFDPDRFATDALHSRHTHAFLPFGDGPRNC

IGMRFGLLEVKFGIVQMVSKLRFTVSSRMQLPLKMCTSAAILEAEGGIWLNGTKL

 

>CYP6AA5v1 Aedes aegypti (yellow fever mosquito) 1.702_3 AAGE02023125.1  55% to 6AA2, 97% (12 aa diffs to AAGE01185776)

15290  MVFLFTTLCLLLPHLGLLYYYVRRKFAYWADRGVPYVPGSLPMGSFNGMGSTKHFVELLD  15111

15110  PVYKQYRNTHKAVGMFLSINPVLLAVDPDLVKQILVKDFNSFHDRGMYFNERDDPLASHM  14931

14930  FSVEGERWRFLRNKLSPTFSSGKIKYMFLTVREIGLEFLASFEPFMERKEPVEIGIQAQK  14751

14750  FTCDVIGSCA FGLSCNALKDESTELLDIADRVFNPKPLEMMYMLLLICFRKWAVKLRLKQ  14571

14570  TPADIERFFVNMVRKTVEHREKNNISRPDFLQLLMQLKNKGTLEESKEDSKETISMNDVI  14391

14390  AQAFLFFFGGFETSSKALSFALFELALNPELQEKARDEVLRTLDKHDGLLTYEALKDMTY  14211

14210  VEQIVH (1)  14193

14133  ESLRKYAPIGNVIRKANEPYQIHSPDIILEKGTMVMIPVHSIHHDPEIYPDPSR  13972

13971  FDPDRFTPEAISARHSHSFLPFGDGPRNCIGMRFALLEVKFGIAQLLSRLRFTVNEKTQL  13792

13791  PLRYDPKTNVASALGGLWLDVERI*  13717

 

>CYP6AA5v2 Aedes aegypti (yellow fever mosquito) AAGE01185776 probable allele

MAFLFTTLCLLLPLLGLLYYYVRRKFAYWADRGVPYVPGSLPMGSFNDMGSTKHIVELLDAIYKQYRNTHK

AVGMFLSINPILLAVDLELVKQILVKDFNSFHDRGMYFNERDDPLASHMFSVEGERWRFL

RNKLSPTFSSGKIKYMFLTVREIGLEFLASFEPFMERKEPVEIGIQAQKFTCDVIGSCAF

GLSCNALKDESTELLDIADRVFNPKPLEMMYMLLLICFRKWAVKLRLKQTPADIERFFV

NMVRKTVEHREKNNITRPDFLQLLMQLKNKGTLEESEEDSKETISMNDVIAQA 682

681 FLFFFGGFETSSKALSFALFELALNPELQEKARDEVLRTLDKHDGLLTYEALKDMTYVEQIVH (1)

    ESLRKYAPIGNVIRKANEPYQIHSPDIILEKGTMVM 325

324 IPVHSIHHDPEIYPDPSRFDPDRFTPEAISARHSHSFLPFGDGPRNCIGMRFALLEVKFG 145

144 IAQLLSRLRFTVNEKTQLPLRYDPKANVASALGGLWLDVERI*

 

>CYP6AA6 Aedes aegypti (yellow fever mosquito) AAGE01569058

MGLYNTVLYLVLPIVWLLYTYFRRKYSYWADRNVPQVPGSL

PLGSFNGMGTKYHFVDVLKRVYDTYHKTHKAIGMYLSVKPILFVSDLDLIKKILVKDFNS

FRDRGMYYNEKDDPLSAHLFSIEGERWRFLRNKLSPTFTSGKIKYMYLTICE

IGEEFLACFDKYLDRKEAVDIKPLAQRFTSDVISSVAFGLKTNALKNEGSELLNKGDSVF

KPGRWETIRIFALLSYRDLAKKLGLRQFPRDVTDYFMDIIRGTVDHREKTNVMRQDFLQL

LLKLKNKGTIEDHEEESKEKITLNELAAQAFLFFFAGFETTSTTVSFALFELANNAEVQEKTR

QEVQRVLAKHGGHLTYDAIKDMTYLEQVVNETLRKHPPVGNLIRLANDPYRIDSLGTDIE

RDTMIMIPVHAIHNDPDIYPDPERFDPYRFTPEAINARHSHCFIPFGDGPRNCIGMRFAL

VEVKFGIAQLLTRLRFTVNEKTQFPVRYDPKSQFAEVKGGIWLNVERI*

 

>CPIJ005959 CYP6AA7 Culex pipiens 59% to CYP6AA6

MSLLNTLLYLVLPVAALIYLFVRRKLSYWADRNVPHAPGSFPMGSLQGMGTKYHMSHILE

RIYQQFKNESPAVGFYLTMKPTLMVTDLELVKQVLVKDFNSFRDRGVYYNEKDDPVSAHL

FAIDGEKWRFLRNKLSPTFTSGKIKYMFNTMQEIGDEFVECFGRYEEREEAVDVKTLCGW

FTCDVIGSCAFGLNCNSLKNEESELITIANRLFKPSPIDAMWQFFFMSFRDLSAKLRLLI

LPRDIAKYFMTLIPETVTYREQNNVTRPDFLQLLIQLKNKGTVDGAEQESSGETLTMNQV

VAQSFVFMLGGFETTSTALTFALFELANNPEIQEKVRVEVSSVLARHDGKITYDALKEMT

YLEQVVNETLRMYPPVPFVARNSNHSYHITHPDVTLDADTMVLVPVYAIHYDPDIYQNPT

RFDPDRFTPEATQARHTHAFLPFGDGPRNCIGLRFALLEVKFGIAVLLSKFRFSTSAKMI

LPLELDISAPMMAAKGGVWLDVNKINSKE

 

>CPIJ005958 CYP6AA8 Culex pipiens 64% to CYP6AA6

MSLLSTVLYLVLPAIGLLYAYLRRKYAYWNDRNVPNDPGQFPMGTFAGTGTKYHFTQTMDSVYRQFKRVSPVAGMYMTVS

PVLLLIDLELVKQVLVKDFNFFRDRGIYYNERHLFSIEGDKWKFLRNKLSPTFTSGKIKYMFLTVREIGDQFLQGFDKYV

DSKSPVDLKALAKRFTCDVIGSCAFGLNCNSLKNEGSELLTIGDKVFNAGPLQFFKIIFMTSCTAISRKLGLKVVPKDVT

EYFMNVVRGTVDHREKNNVMRSDFLQLLMQLKNKGTVEDHEEESQDKISMDEVAAQASLFFFAGFETSSTALSFALFELA

NNQGIQEKTRAEVKRVLAAHGGQITYEALKDMSYLEQVVNETLRLHPPVGNLFRVANQPYRLSKTDLTIEKGTLLMIPVT

SIHQDPEIYPNPWQFDPDRFTPEAIQARHSHAFLPFGDGPRNCIGMRFALLEVKFGIAALLSKLKFTVNSRTQVPLELNV

KSTLIEAKGGLWLDVARI.

 

>CPIJ005957 CYP6AA9 Culex pipiens 66% to CYP6AA6

MPQTCSFMNQPIGLLNTILYLVVPVFALFYLFLRRKYSYWADRNVPHEPGQFPMGSLKGMGSKYHLIQITDRIYSKFKGT

GSMAGFYVTLSPTVLVTDLELVKQILVKDFNSFRDRGMYYNEKEDPLSAHLFSIEGEKWRYMRNKLSPTFTSGKIKYMFL

TMQEIGDEFVHSFDKYAEAQEPVDMKALAQRFTCDVIGSCAFGLNCNSLKNEGSELLAMGDKVFKLNQWQMLKAFFVMSY

RDLSLKLGLRQLPVEVTDYFMNVIQGTVDHREKNNVVRPDFLQLLMQLKNKGTIEDHAEDSADKITMDQAAAQAFLFFFA

GFETSSTALSFAIFELANNPDIQEKARAEVQRVLAVHGGHLTYEAIKDMTYLEQVVNESLRMYPPVGNIIRIANQPYQLT

SPNVVIEKGTMVMIPAYSIQRDPDIYPNPSQFDPDRFTPEAIQARHTHTFLPFGDGPRNCIGMRFALLEVKFGIAQLLSR

LSFTLNSRVRLPLELETKSSMMEIKGGLWLDVKKI.

 

>CYP6AB3 heme1 Depressaria pastinacella AY295773.1

MHFLIALGILLIILYLYGIKNHKYWEKKGVPYVKPIPFFGTNFKVFMQRICISDQLCKYYEQFPNEKFVGAFIGDRIGLVLREPELIKRVMVTDFQYFHPRGVNPHKTVYEPLLKNLFTGDGDMWKLLRQRITPAFTSGKLKAMFPLIVERAERLQIIAATAAESHGEVDVRELMARFTTDFIGACGFGIDADTLNDEESTFRRLGKRIFTLTKRDGFVFMLKTIAPEIFKNLHMFAPEIEKTTVDLVTSIMQQRKYKHSGRNDFIDFLLELKGKGKIVGESVEKRNPDGTPKIVEMELDDMIMAAQVFIFFAAGFETSSSTTSYTLHQLAFHPEEQKKCQDQIDEVLSRHGGKLSYEAIKEMTYLDMIFKESMRMYPSLGILTRRCVQKYTFPGTNLTIDEDVLVCIPVHALHNDEKYFDEPEKFKPERFSPENIKNIPKYVYLPFGDGPRACI

GERLGHMQSLAGLAALLSKFSVAPSKNTLRQPITDPTCTVVKSIKGGLPLSLVARKV

 

>CYP6AB4 Bombyx mori 64% TO 6AB1

MLTAAIFVIIVALVYLYSTRTFRYWEKRGIKHDKPVPFFGTDSEGYLLRKSMTQTAVDAY

LKYPNEKVIGFFRSSRPELIIRDPDIIKRILTTDFAYFYPRGLNPHKKVIEPLMRNLFFA

DGDLWRLLRQRMTPAFTSGKLRAMFPLVVERAERLQSRTLEIASQPLDARELMARYTTDF

IGACGFGLDADSLNDEDSAFRKLGAAIFNITVQQAIVAALKEIFPGIFKHFKYSSKYETD

FMSLVSSILKQRNYKPSGRNDFIDLLLECRMKGEIVVESIEKMKPDGTSEVVRMELTEQL

LAAQVFIFFAAGFETSSSATSFTLHQLAFHPEIQEKVQKELDQVLAKYNNKLCYDAIKEM

RYLESAFKEAMRMFPSLGFLIRECARQYTFPELNLTIDEGVGIIIPLQALHNDPEYFDSP

NEFRPERFMPSEYNHNKTKFVYLPFGDGPRGCI

GARLGLMQSLAGLAAVLSKFTVKPAPSTKRHPVVEPKSSVVQSIKDGLPLLFIERTKS*

 

>CYP6AB5 Bombyx mori BAAB01021567.1 BAAB01206787.1 58% to 6AB3

MFFYLLIVILITLYYYGVR

TFDYWKKKGVNHDPPLPFFGNNLRQFMQKASMAMMATETYKKYPEEKVVGFYRGTSPELV

VRDPELIKRILVTDFSSFYARGFNPHKKVIEPLLKNLFFADGDLWRLIRQRFTPAFSTAK

LKAMFHIITERAEKLQMIAENEAYENFCDVRELMARYTTDFIGACGFGLNIDSLSDENSQ

FRKLGKRIFKRDLSDAVRAALKLMFPELCKHLTFLTPELEKSMTYLVQNVIREKNYKPSG

RNDFIDLMLELKQKGKLLGESIEAKNANGTPKQVELEFDDLLMTAQVFVFFGAGFETSST

ASSYTLHQLAFNPECQEKTQKEIDEVLSKHNNKITYDAIKEMTYLEMAFNEAMRLYPSVG

YLVRMCTVPEYTFPEINLTINEDVKLMIPIQAIQKDEKYFKDPERFHPERFSSGAKANLK

PYTFLPFGEGPRACV

GERLGQMLSMAGLVAVLQKYTVEPVEISLRDPIPDPTTTVSEGFVHGLPLKLRRRERRI*

 

>CYP6AB7 Depressaria pastinacella EF111023

MYLLIALGVLLIILYLYGIKNHKYWEKKGVTYVKPIPFFGTNFR

VFMQKISFSDQLYKYYQQFPNEKFVGIFLGDRIGLLLRDPELIKSVMSTDFHHFHRRG

INSHKTVHEPLHKNLFTGDGDMWKLLRQRITPAFTSGKLKAMFPLIVERAERLQIIAA

TTAESQSEVDVRELMARFTTDFIGACGFGIDADTLNDEESTFRRLGKRIFTVTKRDGL

VLMLKSIAPETFKYLHMLPPEVEKTTVGLVKSIMQQRNYKHSGRNDFIDLLLELKGKG

KIVGESVEKRNSDGTPTIVEMELDDLLMAAQVFIFYAAGFETSSSTTSYTLHQLAFHP

EEQKKCQDQIDEVLSRHGGKLSYDAIKEMTYLDMIFKESMRMYPSLGFLMRRCTQKYT

LPGTNVTVDEDVVVLIPVHALHNDEKYFDEPEKFKPERFSPENIKNIPKYVYLPFGDG

PRACIGERLGQMQSLAGLAAVLSKFSVAPSKNTLRHPITDPSSLIVQSIKGGLPLSLV

ARKF

 

>CYP6AB8 Bombyx mori AADK01010774.1,

MLTAAIFVIIVALVYLYSTRTFRYWEKRGIKHDKPVPFFGTDSEGYLLRKSMTQTAVDAY

LKYPNEKVVGFFRSSRPELIIRDPDIIKQILTTDFAYFYPRGLKPHKKVIQPLMRNLFFA

DGDLWRLLRQR

MTPAFTSGKLRAMFPLVVERAERLQARSLKIASQPLDARELMARYTTDFI

GACGFGLDADSLNDEDSAFRKLGAAIFNITVQRAIVAVLKQIFPRLFKHF

KYSSKYETDFVSLVSSILKQRNYKPSGRNDFIDLLLECKMKGEIVVESIE

KMKPDGTPEIIRMVLTEQLLAAQVFVFFAAGFETSSSATSFTLHQLAFHP

EIQEKVQKELDQVLAKYNNKLCYDAIKEMRYLESAFKEAMRMFPSLGFLI

RECARQYTFPELNLTIDEGVGIIIPLQALHNDPEYFDSPNEFRPERFMPS

EYNHNKTKFVYLPFGDGPRRCIGARLGLMQSLAGLAAVLSKFTVKPAPST

KRHPVVEPKSSVVQSIKDGLPLLFIERTKS

 

>CYP6AB13 Manduca sexta Contig_546_FL sent to genbank

77% to CYP6AB2 Trichoplusia ni

MLFVLLVIVFTCLYYYGVRTFDYWKKKGVKHDPPLPYFGNNLKQFMQQASMCMMATEVYK

KYPEEKVVGFYRGTSPELVVRDPEIIKRVLVTDFNCFYARGFNPHKKVIEPLLKNVFFAD

GDLWKLIRQRFTPAFSTGKLKAMFPLITERAEKLQVLAEDIVDEEYYDVRELMARYTTDF

IGVCGFGINMDTMSDDNSQFRRLGKRIFERNFRDGVCGALKLMFPELCKNLTLLSPELEI

SMVKLVQSVLRDRNYKPSGRNDFIDLMLELKEKGKIIGESIESRNPDGSKKIVELEMDDL

LMTAQAFVFFGAGFETSSTASSYTLHQLAFNPDCQKKVQQEIDTVLAKYNNKLTYEAVKE

MHYLEMAFYEAMRMYPSVGYLIRECTVPEYTIPEINLTINEGVKLMIPMQAIHKDEKYFR

DPENFDPERFQDGAKEDIKNFVFLPFGEGPRACVGARLGQMQSMAGIAALLHKFSVEPAA

CSLKNPLPEPTGIVSEGXIGGLPLKLRRR

 

>CYP6AD1 Anopheles gambiae CYPf2r9 = , 500aa

MVAFTWVLVLCTIVLTGVAVRMFLRRRQTFWQRHGIPAARHPHPLYGNVGGLVTKHHTATVLQRLYREFRERKLPAGGFNLYFSPVLLVVDRQLIERVLVNDFAQFQNRGLYASATVNPLSSETLFSVAGERWHRMRQQLRPALGSSSVRTMFATTARIAQTLVVYIGAQSRRRDLEWTDLMARYATDVIGSCAFGIDCRTIRDPGSEFRAMGHRAFRCSLRRMWKLRFGYACRRVADAMRLCVSEPSVEQFFLQLCQSTVLHRESYQVVKRDFLQQLLEMKANGALDMRQVAGQCYSFFIAGFETSASLLSFCLYELAKHGAVQDRLRGSIVAALDETDGQLSYDMVMALGYLDQVVKETLRMYPPVDFLFRVASNDYPIDGFGTIPQGTLLVVPVHALHRDPAYYPQPDVYNPDRFAASSKLSGASKNRPPFMPFGLGPRHCIGDTFGLMLVKVGLVAMVRSFRFTLDVDRTPENVTFKPRSLVLAAGSGMYLNVERV*

 

>CYP6AE1 AY295774 Depressaria pastinacella parsnip webworm N-term

MSVILILSSILTLLITSIYLISTRKFNYWKKKNVPHLKPKLILG

NYGDFLLMKKPNGLVVQEICQAFPNEPYIGAYYGTEPALIVQDAEIIKLITIQDFSYF

NSREVGDHTHKEDMSKNIFSTNGDRWKVVRQHMTPLFTSSKMKNMFHLIEKCSHEFER

MLDREFKMSNVQEVRALTARFTMDCIVSCGFGLDANTMGDNSKENPFTKLSNSIFEVS

NLRFLAMQARNLWPSIFYGLGLRTFPKSIDDFFHELITNVFKQRQYTPTSRNDFVDLI

MNWTKKDYLTADSFKHDKEKGSTKISLKVDDKLLVAQCSIFFGAGHETSATTLSYTLF

ELAKNPEAQKRAIEEVDAYLLKNNNKLGYDCVTELPFLEACLDETLRLYPVLSVLTRE

VVEDYTLPTGLHLDKGVRIHLPLYHLHHNPDNFPEPEKYRPERFVGDERKNIKPYTYM

PFGEGGRTCIGMRFSKMQTLSGLVTFLKKYRVELAKGTSPTVEFEPRALVFISKNGIN

LQMMEREGWEKRLFAK

 

>CYP6AE2 Bombyx mori

MSVSALVFAAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFGNYMRYITLQSFLGDVM

QKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYFNSRENRDYNHKEVFTQNL

FFANGDRWKVIRQNLTPLFSSSKMKNMFYLVEKCNHSLEDMLDKETKDLQSIEIRSAMIR

YTLDSICSSAFGIETNTLSEGAENSPFPSMGSTIFSSSITRGLKLIGRSMWPGIFYKLGL

RCFPTEIDDFFERLLTEVFENRGYKPTNRNDFVDLILSLKQNDYLTGDG

LVPKNVDAKKVTVKVDDALLIAQCVVFFGAGFETSATTLSAALYELAKNPEAQRRAQEEV

DELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVLPNITREAVTDYTFPDGLRIDKGMR

VHVPVYAIHRNPDNFPDPEEFRPERHLGDAKNDIKQFTYFPFGEGPRICI

GMRFGKMQTIAGMVTCLKKYNFELADGMSKTVPFRSTTVLTQPSTGLFLKATPRDGWKQRIFAR*

 

>CYP6AE3P Bombyx mori

MSVSALVFSAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFGNYMRYITLQSFLGDVM

QKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYFNSRENRDYNHKEVFTQNL

FFANGDRWKVIRQNLTPLFSSSKMKNMFYLVEKCNHSLEDMLDKETKDLQSIEIRSAMIR

YTLDSICSSAFGIESNTLREGGENSPFANMGSIVFSSSITRGLKWISRSMWPGIFYKLGL

QCFPAEIDGFFER

LLTEVFENRGYKPTNRNDFVDLILSLKQNDYLTGDGLVPKNVDAKKVTVKVDDALLIAQC

VVFFGAGFETSATTLSAALYELAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEA

CMNEAMRLYPXXXXXTRETVADYTFPDGLRIDKGMRVHVPVYAIHRNPDNFPDPEEFRPE

RHLGDAKNDIKQFTFFPFGEGPRICI

GMRFGKMQTIAGLITCLKKFNFELADGMPRTLAFRSTTLLTQPSTGLFLKATPRDGWEQRIFAR*

 

>CYP6AE4 Bombyx mori

MLFLTLLFILSVCVYFIY

YRVCNRRFDYWRKKNVSFVPPVPILGNYSGYILLKESISKVVHNLCKLFP

NDPYIGAFFGTEPTLIVKDPEFIKLVLTKDFYHFNGREGSKYTHNEVVTQNIFFTYGDRW

KVIRQNLTPLFSSLKMRNMFHIIEKCSGIFENLLDEESLAPEVEMKSLMSRFTMDCIGGC

AFGVDTKAMQEPKDNIFTTMGYLFFESTTYRGIKNVLRAIWPGIFYGLGLKVFPTDLNEF

FSKLLVGIFEARDYKPSSRNDFVDLLLNLKKNRHIVGDRLQKTTTGDEGADSKFELEVDD

GLLVGQCLAFFSAGFETTSTISNFTLYELAKNPDVQKRAQKEVDEYIKKHNNKLDYDCVK

ELPFVEACIDEALRLYPVLGVLTREVMEQYTFPTGLTLDKGDRVHIPVYHLQRDPEYFPE

PELFKPERFYGEEKKNIRPFTYLPFGDGPRICI

 

>CYP6AE5 Bombyx mori

MILTIIFILSLCVYILYRISTRKFDYWQKKNVNYVQPTPFLGNYSGYILLKENLL

DVVYNLSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLTKDFFYFTGKECFEYTHKEVIT

QGIIFTYGDRWKVIRQNVTPLFSSSKMRSMFRIIEHCSGVFENLLD EESLAPEVEMKSLM

SRFTMDCIGGCVFGVDINAMQEPKDNIFTTMGCLFLETTTSRGIKNVVKAIWPEIFYGLG

FKVFPTDIHKFFSKLLVRIFEARDYKPSERTDFVDLLLNLKKNRHIVGDRLQKIKTGDEG

ADSKFELEVDDGLLVGQCLAFFSTGFETSSTISNFTLYELAKNPDVQKRAQKEVDEYIKK

HNNKLDYDCVKELPFVEACIDEALRLYPLFGVISRQTGERYTFPTGLTLDKGDRVHIPVY

HLQRDPEYFPEPELFKPERFYGEEKKNIRPFTYLPFGDGPRICI

GMRFAKMQILAGLVTILKKYTVQLADGMPETIDIEPKAIVTQPAISLRLKFVPRNDLQKRIFA*

 

>CYP6AE6P Bombyx mori

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNYSGYILLKENLLDVVHN

LSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHGREGSKYTHNEVITQGIFF

TYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLLD

EESLAPEVEMRSVMSRFT

MDCIGGCVFGVDINAMQEPKDNIFTTMGCLFLETTTSRGIKNVVKAIWPEIFYGLGFKVF

PTDIHKFFSKLLVRIFEARDYKPSERTDFVDLLLNLKKNRHIVGDRLQKIKTGDEGADSK

LELEVNDDLLVAQCVSFFIAGFETSSNSLTFTLYELAKNPDVQKRAQKEVDEYIKKHNNK

LDYDCVKELPFVEACIDEALRLYPLFGVISR

DKRERYTFPTGLTLDKGDRVHIPVYHLHHDPEYFPEPELFN

PERFYGEEKKNIRPFTYLPFGAGPRVCI

GERFAKMQMLAGLVPILKRYTVRLAEGMPETINFEPKAIASQPNIGVRLNLLPRNN

 

>CYP6AE7 Bombyx mori

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNYSGYILLKENLLDVVHN

LSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHGREGSKYTHNEVITQGIFF

TYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLLDEESLAPEVEMRSVMSRFTM

DCIGGCAFGVDTNAMQEPKDNIFKTMGYLFFESTTHRGIKNVFKAIWPEIFYGLGFKVFP

TDLNEFFSKLLVGIFEARDYKPSSQNVFINLLLNLKKNRHIVGDRLLKIKTGNVRAESKI

KLEVDDELLVSQCVAFFIAGFETSSTISSFTLYELAKNPDVQKRAQKEVDEYIKKHNNKL

DYDCVKELPFVEACIDEALRLYPVLGVLTREVMEQYTFPTGLTLDKGDRVHIPVYHLQRD

PEYFPEPELFKPERFYGEEKRNIRPFTYLPFGAGPRTCI

GQRFAKMQMLAGLVTILKRYTVRLAEGMPETINFEQRAIVTQPNIGIRLNLLPRNN*

 

>CYP6AE7    Bombyx mori strain Laos            GenEMBL EF432656

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNY

SGYILLKENLLDVVHNLSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHG

REGSKYTHNEVITQGIFFTYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLL

DEESLAPEVEMRSVMSRFTMDCIGGCAFGVDTNAMQEPKDNIFKTMGYLFFESTTRRG

IKNVFKAIWPEIFYGLGFKVFPTDLNEFFSKLLVGIFEARDYKPSSQNVFINLLLNLK

KNRHIVGDRLLKIKTGNVRAESKIKLEVDDELLVSQCVAFFIAGFETSSTISRFTLYE

LAKNPDVQKRAQKEVDEYIKKHNNKLDYDCVKELPFVEACIDEALRLYPVLGVLTREV

MEQYTFPTGLTLDKGDRVHIPVYHLHRDPEYFPEPELFKPERFCGEEKRNIRPFTYLP

FGAGPRTCIGQRFAKMQMLAGLVTILKRYTVCLAEGMPETINFEQRAIVTQPNIGIRL

NLLPRNN*

 

>CYP6AE8 Bombyx mori Laos strain

            GenEMBL EF528486

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MSVSAVVFAAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFG

NYMRYITLQSYIGDVTQKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYF

NSRENSDYNHKEIVTQNLFFANGDKWKVVRQNLTPLFSSLKMKNMFYLVEKCNHSLED

MLDKEIKDLQIIEIRSAMIRYTLDSICSSAFGIESNTLSEGGENSPFANMGSIVFSSS

ITRGLKWISRSMWPGIFYKLGLQCFPAEIDGFFERVLTEVFENRGYKPTNRNDFVDLI

LSLKQNDYLTGDGLVPKNMDAKKVTVKVDDALLIAQCVVFFGAGFETSASTLSAALYE

PAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVLPNITREA

VADYTFPDGLRIEKGMRVHVPVYAIHRNPDNFPDPEEFRPERHLGDAKNDIKQFTFFP

FGEGPRICIGMRFGKMQTIAGMVTCLKKYNFELADGMSKTVPFRSTTVLTQPSTGLFL

KATPRDGWKQRIFAR*

 

>CYP6AE9v1  Bombyx mori strain Laos

            GenEMBL EF535809

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MFLLINICVILFVIYYLVTKKYSYWRNRNVSHEKPVLLLGNYGD

LILQKKNFGEMARAICQKFPGEPVVGAFFGTEPVLIPQDPEVIKTILTKDFYYFNGRE

ISEHVHKELLSYNLFATYRDEWKILRQNLTPIFSTAKLKSMFTLIEKCSKSFQNLLED

ETKISKELEVRTLMQRFTIECIGSCIFGVDTDTLGNDKMNPFKAAGSQLSDFSRLVFV

KGIVRAIWPTLFYALGFKTFTTELDIFKKLVNAVFAQRKHKPTTRNDFVDLILTWKNN

NTITGDSIGSFKNSDKTKFSIDVNDDLLLAQCLVFFAAGFETSAMTSSYTLHELAKNQ

RALKKACDEVDAYLLRHGNKINYDCVTELPYLEACIEETLRLYPVLGIITREVMEDYV

LLDKIHLKKGDRIHVPVFHLHHNPEHFPNPEEYRPERFYGEEKRKVKPYTYLPFGEGP

RICIGMRFAKMQSIAGLITILKKFRLELPEGAPTKIEFKPEAFVTTPKDLIKIKFLER

EGWQQRVFV

 

>CYP6AE9v2 Bombyx mori

note: name changed fron CYP6AAE8 (old CYP6AEgg)

MFLLINICVILFVIYYLVTKKYSYWRNRNVSHEKPVLLLGNYGDLILQKKNFGEMAQAIC

QKFPGEPVVGAFFGTEPVLIPQDPEVIKTILTKDFYYFNGREISEHVHKELLSYNLFA

TYGDEWKILRQNLTPIFSTAKLKSMFTLIEKCSKSFQNLLEDETKISKELEVRTLMQRFT

IECIGSCIFGVDTDTLGNDKMNPFKAAGSQLSDFSRLVFVKGIVRAIWPTLFYALGFKTF

TTELDIFKKLVNAVFAQRKHKPTTRNDFVDLILTWKNNNTITGDSIGSFKNSDKTKFSI

DVNDDLLLAQCLVFFAAGFETSAMTSSYTLHELAKNQRALKKACDEVDAYLLRHGNKV

NYDCVTELPYLEACIEETLRLYPVLGIITREVMEDYVLLDKIHLKKGDRIHVPVFHLHH

NPEHFPNPEEYRPERFYGEEKRKVKPYTYLPFGEGPRICI

GMRFAKMQSIAGLITILKKFRLELPEGAPTKIEFKPEAFVTTPKDLIKIKFLEREGWQQRVF

 

>6AE12v2 Helicoverpa armigera DQ256407

MITLLLSLVIPLVFFAIYITSKRKYEHWEKKKIPHLKPVPILGNFGEYILQKTYQGQVAQKICKKFPNEPFIGAY

YGTEPALIVQDPELIKIVMTKDFYFFSGREVSNYSHKEMFTQNLFFTYGDRWKVLRQNLTPLFSSAKMRNMF

HLIEKCSRVFEKVLDKETQKCDEIEVRALMAGFTMDCIGSCAFGVDTNVMEKTEDNIFRKIADLIFDIQGFRAF

KNVARAIWPSVFYGLGFRAFPREIDNFFNNLMSGIFKGREYKPTNRNDFVDLVLKLSNNKTMTGDSLLNMK

SDADKKVVLEVDEEMLVAQCVLFFAAGFETSSTTLSYALYELAKNPEAQEKALAEVDEYLRRHDNTLKYECV

AGTPYLEACVDEALRLYPALGLLTREVAEDYTFPSGLEVEKGLRVHLPVYHLHHHPEHFPDPEQFRPERFLAEN

KQNIKPYTYMPFGEGPRICIGMRFARMQMAAGLLTLLKKYRVELAPGMKRELVFEPGAIVTQPIGGIKLKFVE

RENWKERLLKTP

 

>CYP6AE14 Helicoverpa armigera DQ986461, gossypol-induced

MITSLLLTAVFVIIFTIYLVSKKKYQYWEKRKVPHLPPVPLLGNFGNFIL

QRQFLGYTLQQICGKFPNVPYVGAYFGTEPALIVQDPEHIKLVMTKDFYF

FSSREISEYADRERFTQNLFSTSGNKWKVLRQNLTPVFTSAKMKNMFHLI

EKCSHVFEDFLDKEAKSNEVEMRALVARYTMDCIGTCAFGVETKTMNVTE

NNPFTAVGNSIFMLSRVQGFKFVLRGIYPSLFYLLGFRTLPPEVNAFFSN

LMTGVFKGRNYTPTSRNDFVDFVLKWKQNKTMTGDSLTNMKYDSQKKVTL

EVDDDLLVAQCFIFFAAGYETSATTLSFTLYELAKHPEAQKRAIAEVDDY

LRRHNNELKYECLSEMPFVEACFDETLRKYPVLSLLTREVVEDYTFPSGL

KVEKGLRIFLPLYHLHHNPEFFPDPEEYRPERFLPENKDKIKPYTYMPFG

EGPRLCIGMRFAKMQMTAGIITLLKKYRLELAPGMPQNIEFEPNSFVSQV

AGGINLKMIKRESWEGRLLKNLEKAY

 

>CYP6AE21  Bombyx mori Laos strain

           GenEMBL EF432657

           Dong Wang

           submitted to nomenclature committee Oct. 2, 2007

           94% to CYP9AE3P

MSVSALVFAAFVLLVTYIYYWSTRKFEYWKRKNVPYAKPVPFFG

NYMRYITLQSYIGDVMQKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYF

NSRDNSDYNHKEVVTQNLFFANGDKWKVVRQNLTPLFSSSKMKNMFYLVEKCNHSLED

MLDRETKDLQIIEIRAAMIRYTLDSICSSAFGIETNTLSEGGEYSPFANMASIIFSPS

IARGLKWISRSMWPGIFYKLGLQCFPAEIDDFFERLLTEVFENRGCKPTNRNDFVDLI

LSLKQNDYLTGDGLVPKNVDAKKVTVKVDDALLIAQCVVFFGAGFETSATTLSAALYE

LAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVFPNITRET

VADYTFPDGLRIDKGMRVHVPVYAIHRNPDNFPDPEEFRPERYLGDAKNDIKQFTFFP

FGEGPRICIGMRFGKMQTIAGLITCLKKFNFELADGMPRTLAFRSTTLLTQLSTGLFL

KATPRDGWEQRIFAR

 

>CYP6AE22v1 Bombyx mori strain Laos

            GenEMBL EF528485

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

            4 amino acid differences to CYP6AE22v1, probable allele

MYVLTFLLHFILFLVLVVYYITKRNHDYWKNKKVPFEKPYPILG

NYGDYILLKIFFGNVTKRLCEKFPESPYVGTFYGTEPALVVQDPDLIRLILVKDFFYF

HGREVCIYVDREITTQSIFFTYGDDWRVLRHSLTPLFTTSKMKNMFHLIKNCCRVFEN

VLEEKATVKSFEINSIIKYFIMDCVGACLFGVEINAMEKHSQNPIVKISKEIFPKSTT

RGIINVLRGIWPSLFYALRLKLFPEVITMFFTDLLECAFKDRQRNLSQRQDFIDLFMK

LRQNKYLVGDSIPDIKNGRVQKVNLEVTDELLIAQCVSFFGAAFETSSTTLSLTFYEL

AKNPKYQKRAIEEVDDYFAKHNNEIEFDIVSETPYLNACIDETLRLYPSLANLTREVM

EDYTFPTGLKVEKGTRIHIPVYHLQRNPKYFPEPNKFDPRRFLPEAKQTIYPFTYMPF

GEGHRICIAMRFAKMQMLAGFATLLKKYEVAVDDTTPQELTIDPRIIVTTPIENIQLK

LIARQHAL

 

>CYP6AE22v2 Bombyx mori

note: name changed from CYP6AAE9 (old CYP6AEhh)

MYLLTFLLHFILFLVLVVYYITKRNHDYWKNKKVPFEKPYPILGNYGDYILLKIF

FGNVTKRLCEKFPESPYVGTFYGTEPALVVQDPDLIRLILVKDFFYFHGREVCKYVDREI

TTQSIFFTYGDDWRVLRHSLTPLFTTSKMKN

MFHLIKNCCRVFENVLEEKATVKSFEINSIIKYFIMDCVGACLFGVEINAMEKHSQNPIV

KISKEIFPKSTTRGIINVLRGIWPSLFYALRLKLFPEVITMFFTDLLECAFKDRQRNLSQ

RQDFIDLFMKLRQNKYLVGDSIPDIKNGRVQKVNLEVTDELLIAQCVSFFGAAFETSSTT

LSLTFYELAKNPKYQKKAIEEVDDYFAKHNNEIEFDIVSDTPYLNACIDETLRLYPSLAN

LTREVMEDYTFPTGLKVEKGTRIHIPVYHLQRNPKYFPEPNKFDPRRFLPEAKQTIYPFT

YMPFGEGHRICIAMRFAKMQMLAGFATLLKKYEVAVDDTTPQELTIDPRIIVTTPIENIQ

LKLIARQHAL*

 

>CYP6AE25 Ostrinia furnacalis GU301782

MIVFISTFIVIALSLLYYVTTKNHNYWKKKNVVSCPNPKPIFGNYSDYILFKKFVGEVSQ

DICRALPNEPYIGTFYGSDPALLVQDPDILKIILTKDFYYFSSREVSQYTHKEVVTHQNL

FFTYGDRWKVLRQNLTPIFTTAKMKLMFGLIVDCCRILEKSLDLDTKASDAIEVRALAAK

YTIETIGSCGFGIETNSMLQSEQNPFIIIGNKIIDNSTIRGLVWNARVMWPSVFYGLGLK

SFPAEVYKFFDTVSTKIFKARDYKPTARNDFIDCILNLKNNKYITGDSIRSVKDGDNKKI

VMDVDNDMLVGLCMMFFTGGFETSSSTMSYTLYELAKNKEAQRRAQQEIDEYLKAHDNKL

AYDCVTSLTYTEACVDEALRLYPVLAVLTREVVEDYTFPSGLTLEKNSRVHIPLYHLHHN

PKYFPDPEAFKPERFLPENKQNIKPYTYMPFGDGPRICIGLRFAKMQTLAGLLTILKKYS

VELADGTPEKLQFDPRAVVTTPIGGIPLKFTPRDGWEQRTFNK

 

>CYP6AE26 Epiphyas postvittana (Light brown apple moth)

EV813520 EST from male antennae

56% to CYP6AE12v1

MVLVASCRLILGTLVALAVAIGYLIL

SHKYSFWKRYGLPTPKHLPLLGNYADFILMRKNLGDTFTEICKQLPNEPIIGTYYGTEPA

VVVKDPELLKLIITKDFYYFSSRELRDHVHKETSTKNVFSAEGDYWRVIRQNLTPVFSSA

KMKKMFHLIQKRTAEYEKVLAKEIRENPIHDARSFNTRFTMDCIGSCMFGVDTNAMSSAA

NENPFRIISDKILDFSPLKLSKVIFRSIFPTIFYALKMEAFPKEANVFFEDLVKNVFKDR

NYKPGSRNDFVDFMLSFKQNDYLEGDEIKSLKIKDGSTGKIKLSVDDEMLVAQCLVFFAA

GFETSTATMSFTLYELAKKPEVLQKVLDEVDEHMKKHDGKITYDCVTELPYLEACIDESL

RLYPVLGGLTREVIEDYTLPSGVVLKKGVRVHIPVYYLQKHPDYFPEPEDYRPERFLGEN

KQDIKPFTYYPFGEGPRICIGMRFARMQMMAGLVTLLKDYTVELPPSTPRQVTFTPHAFT

TQTKEELKLKFLPRRVLAA*

 

>CYP6AE27 Zygaena filipendulae (zygaenid moth, Lepidoptera) GQ915322

#Zygae_c6669 51% to 6AE8 Bombyx, 52% to CYP6AE11 Helocoverpa armiger, a probable ortholog to the CYP6AE subfamily of moths

MVWMMLLLIVLVLILYYIATFKHDYWKKRGVPYLQPSLFFGNYRDFILMRKNMGEVAESVCKEFPDAPVVGTFYGTDPALIVKDPELIKLITTKDFYYFSGRENSDHINKEMFIKNLFFSYGDYWKVVRQNLTSLFSTSKMKTMFYLIEKCTTQLHNLLEIETKTDDILEVKSFMTRFTMDCIGSCVFGVETDAMGKDNNRNPFRAISDKIFDFSISRTLKTIGRAMWPDIFYGLGYKLLPDDVESFFDNLLNGVFEQRNYEPTARNDFIDLILKFSKNKCITGDSIKTTKVKDEQTKVSVEVEKDFLVSQCFLFFAAGFETTASTLTFTLYELAKNEKAQKLVIQEVDEYLRQRDGKLEYDCVSQLPYLDACVNEALRLYPVLTILTREVTDDYTLPTGLRLEKKTRIHFPMLYIHKNPEYFPNPEEYRPERHLPGERNNIKACTFFPFGEGPRMCIGMRFAKMMMASCLVTFFRRYRVELAEGMPSTVQLHPRYLGSQSINGVKLKFLKRF

 

>CYP6AE30 Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder

FN544262.1

MLAIILSTFAAIFAVLYYLLQRRYNYWKKRNVPYIKPTPLLGNY

GDFILQKKDISSVMEDLCKKMPNEPYIGVFYGTGPTLIVRDLELLKLITTKDFYYFHG

REVSDHVHKEELTNNLFNSAGDEWKVMRQNLTPVFTSAKMKSMFPLIRNCSYEFEKLL

DSESKMDGFEARIQVGRFTMACILSCGFGVDSGTMNGEYDKNNPFVNMGDAFFSVSPL

SSLAFTLRSLWPTIFYALGLEIAPARMSQIMKNFMNSIFEARNYKSTSRNDFIDFILK

FKQSTYLVGDSISNSKTGDNKKEQVLVTDTLLTAQCIVFFLAGYETSATTSNFTLYEL

AKHPEVQRKVQEEIDAYLQKTGNQLNYDVVTELPYTYACIEETMRLFPVLGMITREVM

DAYTMPNGVLLEKGTRIYIPIREIQRDPKHFPEPEVFRPERFLGEERQKIAPYSYMPF

GEGSRICLGMRFAKMQMLAGLVTLLKKFNVELADKNQTIVFDPLSGVTSPKIPLKFKV

TPREGWESRVFTKN

 

>seq6 CYP6AE31(1) Manduca sexta sent to genbank

made from Contig_10481_3'-truncated and Contig_7242_5'-truncated

MFNILLIVFGVLFVVYYLTTRKFNYWKKINVPHLPPVPLFGNYASMILQRKTFGEVVSDICEKFPKAPVVGAYFGTEPVL

IPRDPEVIKTILTKDFYYFNGREVSEYAHRDGDLFTLFATYGDHWKVLRQNLTPLFSSAKMKNMFKMITQNAHAFEKLLE

QDTKQEVLDVKNMMERFTIECIGSCVFGVATNTIEKGEANPFKKAGNDIIK PNKMLAFKGVMRAIWPSIFYGLRIPLFTN

ELNLFRQVLTAVFKERETNPTKTQDFINLIMKWKQQSHIEGDKLRPAHSAENGKTSVDVTDELVRAQCVVFFATGFETSA

VTLTHTLYELSKNERVMQKACEEVDAFMKRYNNHMTYESLSELQYLDACLDEALRKYPVLGCITREVMHDYILSPGIHIE

KGMRVHIPVQYLQNNANLFPEPEEYRPERFIGEEKRNIIPYSYMPFGEGPRICIGMRFAKMQMLAGLVTVLKSYKVTLGD

NVPKKLRFLPESFVTVSADRIKLKFTRRNGWEKALYAQHS

 

>seq7 CYP6AE32 (2) Manduca sexta sent to genbank

made from Contig_2417_3'-truncated and Contig_4726_5'-truncated

MLPLFLILFLSSLLLIIYYVSKRQFGYWERKNVPYMKPAPVLGNYSGYILLKEYIGHSVDKIYRKFPNAPYVGAFYGTEP

TLIVRDPELIKIVMTKDFYYFSSREIAKYCHKEVITQNLFFTFGDRWKVMRQNLTPLFSSGKMKNMFHLIEKCSRVFEKV

LDNETAMSNVLESRSLLIRFTMDCIGSCAFGVDTNTLVNAEGNPFTTMGNEIFASTTSRGIKNITRAVWPFVFYGLGFKS

FPPTIEQFFSKLLTGVFEARGYKPSQRNDFIDLILNL KKNNFIEGDAITNLKTGDADKVQLEVNNDLLVAQCIVFFAAGF

ETSATTSCLTLYELAKCPEAQKRVHEEVDSYMKRHGNKLDYSCVSELPYLLACIDETLRLYPVIGVLTREVVEDYTFPTD

LTVEKGMRVHVPVFSLHRDPEYFPDPEEYRPERFYGEAKHNVKPYTYMPFGDGPRTCIGMRFAKMQMLAGLITLLKKFSV

DLADDMPSAVGFEPKAIVTQPMGGIYLKFNKREGWEQRMLV

 

CYP6AE fragments from several Manduca sexta genes

 

>CYP6AE Manduca sexta Contig_4461_3'-truncated_(presence of PolyA tail)

54% to CYP6AE12 N-term

YLRRVTRDCTAHDERHIKISRENSKYTTKEVTTQNLFFNHGDTWKVVRQNLTPLFSSAKM

KNMFYLIEKCGHSLEKLADEERAISEVVEVKSLMSRYTMDCIGSCVFGIDTKTMEKSSDV

NPFVEMGDIIFQTSRFMGYMLVFRAIWPKIFYGLGLKYFPKDIDNFFKSLMLGVFERRDH

KPTTRHDFVDFTTKLDFYPTTFLTNTRNALNLKFIPREEWQQRVFAR

 

>CYP6AE Manduca sexta Contig_10287_3'-truncated

64% to Contig_10481, 53% to CYP6AE2 N-term

MFDILIIVSGLLLLIYYLFTRKFGYWKRKNIPYPKPVPFFGNYADMILVKKTFGEVVKEI

CDQFP

 

>CYP6AE Manduca sexta Contig_17280_5'- and 3'-truncated

90% to Contig_10481 except two short regions, may be same gene

54% to CYP6AE8, N-term to mid region

YTSGPRSNTKLFSRKYFYYFNGREVSEYAHRDGDLFTLFATYGDHWKVLRQNLTPLFSSA

KMKNMFKMITQNAHAFEKLLEQDTKQEVLDVKNMMERFTIECIGSCVFGVATNTIEKGEA

NPFKKAGNDIIK

 

>CYP6AE Manduca sexta Contig_11225_5'- and 3'-truncated

67% to Contig_730, 57% to CYP6AE12, N-term to mid region

LIIQDPELIKLVVLRRTSTTSAGGKSSDYSEXETVTQNVFFTCCDKWRVLRQNLTPLFTT

AKMKNMFYLIEKCAHVFENVLEEKXYAPKTVTIXELMASFTMDCIGTCTFGVET

 

>CYP6AE Manduca sexta Contig_18570_5'- and 3'-truncated

60% to CYP6AE10 C-term

TSSFTLYELAKHPEIQEKVLQEVDAYFQKNNNQLNYNLVSELPYLDACXDEALRFYPVLG

SLNREAMADYTFXTGLTVEKGMRIHIPVYYLQRHPKYFPEPEEFRPERFLGDEKLKVNPH

VYMPF

 

>CYP6AF1 Anopheles gambiae CYPq3l1 = , 500 aa

MALPIALYLCVSVVCLLVLWIRRRRNYWSTRNVPTIPGHFLLGNFEGLRRQSVADVSNELYRQVDRRERFCGLSIMLQPTLMITDLDLIKSVLIKDFAHFTDHGVYHNERVDVLSCHLFCLEGAKWKSIRSKLSPAFTTGRIRAMFPILRQVADNFAHFLRTEVDGKAELDMKDCCARMMIDNIGGCAFGIECNSFHEPDSAFRRTGELVFDKPRHSQVVSSLLRLYPALGHLLGLKVNHDEVVEFFTGMMRRTVAMRESSNTATPKRNDLIDMMLQLRAASNGSALSMDELMAQAFGFFLAGYETSSSNVTFCLYELALNEHCQERARACVREALRKHGGLTYEALGEMEYLDRCINETLRKYPPLPLLPRLTSKAYRIPGSDVILPAKMRIHLPVYAIQRDERYYPDPDRFDPDRFAPERVAERHFSAFLPFGEGPRICIGQRLGVLQSRIGLATVLANFRVRPGPRTPIPLVFAKDAVTLQSAGEVYLQVEPLQEHE*

 

>CYP6AF2 Anopheles gambiae CYPq3l2 500 aa AAAB01008823.1

MALPIALYLCVSVVCLLVLWIRRQRNYWSTRNVPTIPGHFLLGNFEGLRRQSVADVSNEL  YRQVDRRERFCGLSIMLQPTLMITDLDLIKSVLIKDFAHFTDHGVYHNERVDVLSCHLFC  LEGAKWKSIRSKLSPAFTTGRIRAMFPILRQVADNFAHFLRTEVDGKAELDMKDCCARMM  IDNIGGCAFGIECNSFHEPDSAFRRTGELVFDKPRHSQVVSSLLRLYPALGHLLGLKVNH  DEVVEFFTGMMRRTVAMRESSNTATPKRNDLIDMMLQLRAASNGSALSMDELMAQAFGFF  LAGYETSSSNVTFCLYELALNEHCQERARACVREALRKHGGLTYEALGEMEYLDRCIN    ETLRKYPPLPLLPRLTSKAYRIPGSDVILPAKMRIHLPVYAIQRDERYYPDPDRFDPDRF  APERVAERHFSAFLPFGEGPRICIGQRLGVLQSRIGLATVLANFRVRPGPRTPIPLVFAK 

DAVTLQSAGEVYLQVEPLQEHE* 

 

>CYP6AG1 Anopheles gambiae CYPh2r1 = , 452aa missing middle

MFVTVTLLVTAITFVYVYLAWYSNYWTKRGVPGPAPRLLFGNFPSFILRNRPFVDDFQDIYDKYRSKGNVIGVFNGRQPAV

LVMKPELIKDVLIKNFKQFQDNEFADSVSKDSDPIFGRNPFMLKGEEWKEKRAEVTPAFTTSRMKALFPFVEDVSNRMKQYIAQHTTKGPIETRELCAKYTTDVVSSCIFAAD 

EEIEQFFTDLMEKAVAYREQNNVKRVDYLDHLMALRAKKQLSSLDMAAHGVTFFIDGFETSSLAMCFTLYELARNPDCQETLRSELMAARNEDGSIDYDALLELPYLDQVLYEALRIWPPAAFLSKVCTVPTELEVTDGHKVLIERGLPVMLPVWAVHRDKEYYEEPERFNPDRFSPATGGTKVYREKGCFLPFGDGPRQCLGMRFALMQVKRGLFEVITKYEVSVNSKSKQPIQLDPKAFIVCPLGGIWLDYKPIEA*

 

>CYP6AG2 Anopheles gambiae CYPh2r3 498aa AAAB01008904.1 also BM594498

MLLILFGTVVAFVALVYIFLTWEFGFWEKYGVKGPKPKILLGNIPYLLTKKRHTVYNYDQLYN 

DFKNEPAVGFFSIRSPQLMVRDPELIKEVLSKGFQNFAENDFSDTVDEKSDPLLARNP

FSLSGERWKTRRAEITPGFTNNR 

IKAMAHLMDEVCEHMTDYLRTQAKSSDGVATLDAKE 

VMAKYTTDVVASCIFAID       

AQSFVKENPEIRLMGKRIMNFNFVVQLALLVTTFFPSVKKFYKFTFIPK

DTEQFFIRIMQDAIRYRKENKINRTDFLDHLLQLQDRKQITDIDIAGHGVSFFADGFET   SSIVLTYCLYDLAKYPTIQQELRDEIAKAKQVGGGTMSYEQLGEMALLEQIICESMRIHP  LMAVMAKRCTTDTTLVGPKDRKIFVKKGTTVVLPYYSICFDAEHFADPYKYDPKRFAAEN  GGSKAYRERGVYFPFGDGPRMCLGMRFAVTQVRRAIVEVVERFSISVSSKTIEPFEMDPD 

QFMLMPKGSIWLDFKPIA* 

 

>CYP6AG2 Anopheles gambiae CYPh2r2 AAAB01008904.1

duplicate exons 2 and 3 this gene

NDFKNEPAVGFFSIRSPQLMVRDPELIKEVLSKGFQNFAENDFSDTVDEKSDPLLARNP

FSLSGERWKTRRAEITPGFTNNR

IKAMAHLMDEVCEHMTDYLRTQAKSSDGVATLDAKE

 

>CYP6AG3 Aedes aegypti (yellow fever mosquito) 1.231_4

MWWTVVGVLGGILSAIYLFLSWNFNCWKKDGIKGPKPRLLFGNLPNVLTQKKHIFYEYEKIYNDFKTEPVVGYFSVRTPQ

LMIREPELIKEVLIKGFRYFSANEFSDVVDEKSDPLFARNPFSLSGEKWKTRRGEITPAFTNNRIKALSTLMDEVCDRMT

DHVKKQKESALETKELMSKYTTDVVSNCVFAIDAQSFSKDKPEIREMGRRIMDFNFAAQIILMVTTFLPSVKKFYKFTFV

PREVEQFFIRIMKDAIRHRKENNIVRNDYLDHLLSLQEKKQISEIDMAGHGVSFFADGFETSSLVMTYCLFDLASHPEIQ

TRLREEIRNVQATKGGINYDNIGEMTYLDQVLNETLRIHPIIPVLAKRCTESTVLVGPKDQKIPVSAGTTVVIPYFVQLD

SQYYQEPNKYNPERFSPENGGTKPYRERGVYFPFGEGPRMCLGMRFAIAQVKRGIIEIIDKFEISVNSKTQVPLKYEPKM

FMLYPVGGIWLNYKPIK.

 

>CYP6AG4 Aedes aegypti (yellow fever mosquito) 1.231_5

MWWTVVGVLGGILSAIYLFLSWNFDCWKKDGIKGPKPRLLFGNLPNVLKQKKHIFYEYEKIYNDFKTEPVVGYFSVRTPQ

LMIREPELIKEVLIKGFRYFSANEFSDAVDEKSDPLFARNPFSLSGEKWKTRRGEITPAFTNNRIKALSTLMDEVCDRMT

DHVKKQKEPAVDTKELMSKYTTDVVSNCVFAIDAQSFSKDKPEIREMGRRIMDFNFRAQIILMITTFLPSVKKFYKFTFL

PREVEQFFIRIMKDAIRHRKENNIVRNDYLDHLLSLQEKKQISEIDMAGHGVSFFADGFETSSTVMTNCLFDLASHPEIQ

TRLREEIRNVQATKGGINYDNIGEMTYLDQVLNETLRIHPIIPVLRKRCTESTVLVGPKDQKIPVSAGTTVVIPYFVQLD

SQYYQEPNKYNPERFSPENGGTKPYRERGVYFPFGEGPRMCLGMRFAIAQVKRGIIEIIDKFEISVNSKTQVPLKYEPKM

FMLYPVGGIWLDYKSIK.

 

>CYP6AG5 Aedes aegypti (yellow fever mosquito) 1.231_1 AAGE01005157

MWLIVISILVTIVSLVYHYLTWNFNYWKYRGVPGPLPKPFLGTFSSTFTQKEHPIEENNRIYRLFREYRKDVPFIGGFSF

RSPQLFALSPTLVKDILVKYHKHFRANEVGGTFDSKADPLLARNPFFLDGEEWRSKRAQITPAFTNSRLKALLPIMDNIC

NNMVSYIDRHIPNGPIESKELSAKYTTDVVSSCIFGAEGGSLTSDRSEIREMGNALFQQTFMFIVLAVISSIAPILKRFV

KLSLIPKSIENYFVGLMTEAVRKRKASGTKQVDYLDHLINLQEQKEISILDMAAHGVTFFIDGFETTSEVLGFSLLELSI

DKEIQNRLRQEIHSAEDGQLTFETIMELPYLDQIVNETLRKWPPAYALSKRCTEEITFRLKDNHEVLIEKGITAILPIWA

IHLDKEFYPDPNRFNPDRFSEEDGGHSVRYYQEKGVFLPFGDGPRACIGRRIGLLQVKRALVEIVKNYDFTVNSKTVLPI

KIDPKNIAVTPLGGIWIDYRKL.

 

>CYP6AG6 Aedes aegypti (yellow fever mosquito) 1.231_2 AAGE01002325

MFLTITLIVTAVAAIYLYLTWNYNYWKKLNVPGPSPLPGLGSFPSFITQRRPVADEMDEIYREYKPKYNFVGVFSNRSPR

IMITSSELAKDILSKNFKNFHDNEFGEMTNKEIDPLFGRNPFMLTGDEWKAKRAEITPAFTTSRMKALFPLVEDVCSRMT

KYVTQNRGSVLDSKELSAKFTTDVVSSCIFACDAQSFTSGKPEIREQGRKLMEQSFSSFLILLFIINFPTLAKIFKIGLV

PKSLEKFFTDLMKEAISHRDASGTNRVDYLDYLISLRNKKEISELDMAAHGVTFFIDGFETSSVAISFMLYEIAKNPEVQ

KRLRKELQKVTTDQGTVSYDSLLELSYLDQVVNESLRLWPPAAFISKKCTEPMDLPLTANQNVTIGKEICAIINIWSLHR

DPEYYDDPLTFNPDRFSPETGGTAPYREKGCFIPFGDGPRQCLGMRFARMQVKRCLYELVSNFKITVNEKTKQPMKLDPK

QFLTMPLGGIWLDFEPISK.

 

>CYP6AG7 Aedes aegypti (yellow fever mosquito) 1.231_3 AAGE01024111 JP_25

MFITITLIVSAVTAIYLYLTWHFNYWKKLNVPGPSPLPGLGNFPSFITQKRPVAEEMDEIYREYKPKYNFAGVFSNRSPR

IMITSAELAKDILVKNFKNFHDNEFGELTNKEIDPLLGRNPFLLDGSEWKAKRAEVTPAFTTSRMKALFPLVEDVCSRMT

KYLIKNRGSVIDAKELSAKFTTDVVSSCIFACDAQSFTSEKPEIREQGRKLIEQTFSSFMLLLFIVNFPTLAKIFHVGFI

PKSMEKFFTNLMKDAVRYRDASETNRADYLDYLITLKKKKELSELDMAAHGVTFFIDGFETSSVAISFMLYEIAKNPTVQ

KRLRQELKKVTTDNGTVSYDSLLELSYLDQVVNESLRLWPPAAFMSKKCTEPMELPLTANRSVTIGKEVCAIINIWSLHR

DPEYFDDPLTFNPDRFSPETGGTSPYREKGCFVPFGEGPRQCLGMRFARMQVKRCLYEAVTNFAITVNPKTMEPMRLDPK

QVLTMPLGGIWLNFEPISK.

 

>CYP6AG8 Aedes aegypti (yellow fever mosquito) 1.4359_1 AAGE01024260

MLVTVGLLLTAFAALYLYLTWHFDYWRKRNVPGPEPLPLVGNFPAFFRRNRPVMEEKYQIYKDYCSKYNFVGIFTNRSPQ

IFITSPALARDILVKYFKNFHDNEIGLITNKELDPLFGRNPFVLNGAAWKAKRAEITPAFTASRIKALYVSVENVCAQMT

KYVKEHCESPIEMKELGDKFTTDVVSSCIFGADAQSFIHQDAEIRDMGSKLMDSSLSFALKMAVMTVLPSVAKIANMSLV

SKPREKFFIKLMAEAIRHREESSEKYLDFLDYLSMLKKEKNITELDMAAHGVTFFLDGNETSSATLSLNLYELAKQPEIQ

KRLREELMNATNDDGTISYETLSELPFLEQVFSEGLRLWPPVTFMSKVCTDPIELDLTSTRKVPIERGTCAIISNWSLHR

DPNFYEDPLKFNPDRFAPEKGGIFPYKEKGCYMPFGDGPRQCLGMRFGRMQVKRGIYEVIRNFEISVASRTSDPLKIVSS

PAISLGLSGIWLSFKPIRS.

 

>CPIJ002535 CYP6AG9 Culex pipiens 69% to CYP6AG5 (-) strand

MWLAVVASILISIATLLYLYLTWNFNYWKDRGVSGPRPKLFLGTFSSGFTQKEHPVEENNRIYNHYKNDATFIGGFSFRS

PQLFILSSTLARDILLKYHKHFQANDVSIDVSADPLLARHPFFLQGEDWRVQRAQVTPAFTSNRLKSLFPLMDNVCSKMD

DHIELEAKLGPIESKELAAKYTTDVVASCIFGIEGGSFTAEKSEIREISKALLNQTFMFVVLTVVQSIAPFVRRFVKLSL

IPKRIEDFFVGLMGEAIRTRKANGTRQSDYLDYLIGLQEKKEISVLDMAAHGVTFFIDGFETTSEVLAFALFEIAMNRDV

QKRLRQEILDTENREGSLLFETIMEMSFLEQVVNETLRKWPPAFALTKVCTEDINLELANGKSVMIERGISAILPIWAIQ

LDEHHFPDPERFDPGRFSEAEGGHSAKYYQERGVFLPFGDGPRACIGRRIGLLQVKRALVEIVKKYEITISSKTILPLRI

DPKQFVVAPLGGIWIDYNKI.

 

>CPIJ002536 CYP6AG10 Culex pipiens 70% to CYP6AG6 (+) strand

MLLTITLVVSAVVALYVYLTWNFSYWKKRNVPGPSPHPLFGNFPSFILRNHPIAVEMDNVYREYKSKYNFVGVFSTRSPR

IFVTSAELAKSILIKDFKNFHDNEFAGMTDKELDPILGRNPFMLNGDEWKAKRAEVTPAFTTSRMKSLFSIVEDVGSRMT

KYIRQNKNTPLESKELAAKFTTDVVSSCIFDTDAQSFTNEKSEISEQGRKMFDSSFLFVIVMIFMSLFPKLAKLLKIGMV

SKSVEKFFTKLMAEAIQYREKNGVQRVDYLEHLISLRNKKEISDLDMAAHGVTFFIDGFETSSVAMSFILYELAKNPDVQ

ERLRKELLNASNDQGTITYDLLLELPYLDQVINESLRLWPPAAFLSKKCTEPIELNLTLTEKKLIETDVCAIIPVWSIHR

DPDHFEDPATFNPDRFSPERGGASPYREKGCFMPFGDGPRQCLGIRFARMQVKRGVYEILTHFELTVDSKTVEPLQLDPK

QFLTMALGGIWLNFKPIAV.

 

>CPIJ002537 CYP6AG11 Culex pipiens 68% to CYP6AG6 (+) strand

MILTITLVVTAVAALYVYLTWNYGYWKKRNVPGPDPLPFLGSFPSLILRHRTIMEEMDKIYSDYKNKFNFVGIFSNRSPS

IFVASPALAKDVLIKDFKNFHDNEFGGFTDKDTDPILSRNPFLLNGEEWKEKRSEVTPAFTTSRMKALFPIIEDVGTRMT

KYVKQKGKTALDTRELTAKFTTDVVSSCIFDTDAESFTNEKAVIREMGRKLLDNSFSFFLIAMFIGVMPTLAKLLNVGLI

PKSVEKFFTNLMSEALKHREQKGIKRVDYLEHLISLRNKKNISELDMAAHGVTFFIDGFETSSIAMAFVLYEVARNPDVQ

KQLREELLKASNDQGSISYDTLLELPYLEQVINESLRLWPPAAFLSKKCTEPIELDLTSSQKVHIEKGVYAMIPVWSIHR

DPECYENPTMFNPDRFSPEQGGVSPYREKGCFIPFGDGPRQCLGMRFARMQMKRGVYEILKNFELSVDPKTIQPLQMDPK

QFLTMPLGGIWLTYKAITK.

 

>CPIJ002538 CYP6AG12 Culex pipiens 74% to CYP6AG3 (+) strand

MLCTCLTVLGGLAAVVYLILVWNFNYWKKAGINGPKPKILAGNLPNMWTQKQHIFYDLKKIYDDFKNEPVVGYFSVRTPQ

LMIRDPELIKEVLTKSFRYFASNQFSDLVDEKSDPLFSRNPFSLSGEKWKTRRAEITPAFTNNRIKALSTLVDEVCVRLS

DYVKQNMEKNGSTFDVKELMSKYTTDVVSNCVFAIDAQSFTKENPEIREMGRRIMDFNFKAQVIMFLTTFFPSITKFYKF

TFIAHDVEQFFIRIMKDAIRHRKQNNIVRNDYLDHLLSLEEKKQVTEIDMAGHGVSFFADGFETSSSVITYCLFDLATNP

AIQTQLRQEIRDVQANKGGLTYDNVGEMTFLEQVLNESLRMHVVIPTLAKRCTETVELISSKGKKIRVEAGTAVHIPYMV

HFDSQYYDEPDKFKPERFSPENGGTKPFREKGVFFPFGEGPRMCLGMRFALMQAKRGIVEIIDKFEISVDPKMKMPIVYD

PKSFMLYPDGGTWLKFKVL.

 

>CPIJ009085 CYP6AG13 Culex pipiens 59% to CYP6AG6

MLVTISLLVSAVAAAYIYLVWNFNYWKKRHVPGPDPKPLVGNFPAFILRTRTVMEEMDEI

YNDYKAKYNFVGVFSNRSPRILITCPALAKDILTKHFRSFHDNEFGEFTESAGDAESVLS

ERGQVEGETSGDHASVHDVEGRMKALFPIVEFVSTSMSAYIVKNRNSELDARELAAKFTT

DVVSSCIFDTDAQSFTNEKAQIREMGRRLTNSSFTAFVTMMLLSTCPKLAKMLNIGSGVK

KVEQFFIDLMSEAAMYREKNGTKRVDYLEHLISLRNEKQITEVDMAAHGVTFFFDGFETS

SVVMSFILYELARNPTVQTRLREDCSKASNDQGTISYEDLLELPYLEQVINETLRLWPVG

PFLSKTCTEPVDLELCPGQSVRIEPGVCAVIPFGGIHRDPQFYQDPLTFNPDRFSPETGG

VNPYREMGCFMPFGEGPRQCLGMRFARMQMKRAIYEVVKNFELSVSDKTVQPLRMDPKQL

FTAAVGGIWLNFEPILEQS

 

>CPIJ017014 CYP6AG14 Culex pipiens 60% to CYP6AG6

MIVTISLLVSAALAVYVYLTWNFSYWKQRNVPGPDPRPLLGNFPSLLLRHRTAMDEMDQM

YSDYRAKFNFVGVFNIRQPRIFVTSPALYRDIITKHFRSFSDNEFAELTDVETDPLMGRN

PFLLTGEEWQAKRAEISPAFTASRIKALFAIVEALASRMTKYIEQNQHTALEAKDLAAKL

TIDVVSSCIFDTDAQSFSEDHGEIPEMARKMLEPSFSSLLIMILRSLCPKIAKALNIGMI

PKSVEVFFTNLMKEAIRYRETNSIKRVDYLEHLISLRNKKEITELDMAAHGVTFFFDGFE

ASSLALSFTLYELGRHPAIQTRLRTELLEATNAKGSIDYDTLLELPFLDQVVNESLRLWP

AGPFLSKRCTQPIDLDLSPTQQVRIEPGVCAMIPVWAIHRDPECYTDPDTFNPDRFSPET

GGTNPYREMGCFLPFNEGPRQCLGMRFAKMLVKRGLYEVVKNFEFSVDSKTEEPLRMNPK

VVLTAVVGGIWLNFEPIITK

 

>CPIJ019673 CYP6AG15 Culex pipiens 60% to CYP6AG6

MIVTISLLVSAALAVYVYLTWNFSYWKQRNVPGPDPRPLLGNFPSLLLRHRTAMDEMDQM

YSDYRAKFNFVGVFNIRQPRIFVTSPALYRDIITKHFRSFSDNEFAELTDVETDPLMGRN

PFLLTGEEWQAKRAEISPAFTASRIKALFAIVEELASRMTKYIEQNQHTALEAKDLAAKL

TIDVVSSCIFDTDAQSFSEDHGEIPEMARKMLEPSFSSLLIMILRSLCPKIAKALNIGMI

PKSVEVFFTNLMKEAIRYRETNSIKRVDYLEHLISLRNKKEITELDMAAHGVTFFFDGFE

ASSLALSFTLYELGRHPAIQTRLRTELLEATDAKGSIDYDTLLELPFLDQVVNESLRLWP

AGPFLSKRCTQPIDLDLTPTQQVRIEPGVCAMIPVWAIHRDPECYTDPDTFNPDRFSPET

GGTNPYREMGCFLPFNEGPRQCLGMRFAKMLVKRGLYEVVKNFEFSVDSKTEEPLRMNPK

VVLTAVVGGIWLNFEPIITK

 

>CPIJ019751 CYP6AG16 Culex pipiens 59% to CYP6AG6

MIVTISLLVSAALAVYVYLIWNFSYWKQRNVPGPDPRPLLGNFPSLLLRHRTIMDEMGQM

YSDYRAKFNFVGVFNIRQPRLFVTSPVLCRDIITKHFRSFSDNEFAELTDVDTDPLMGRN

PFMLTGEEWKAKRSEVTPAFTASRMKTLFAIVEALASRMTKYIEQNQHTALEGKDLAAKL

TIDVVSSCIFDTDAQSFSDDHGEIQEMGRKLVEPSFGSLLTVILRSLSPRIAKALNIAMI

PKSIEIFFTNLMKQAIRYREANSIKRADYLEHLISLRNKKEITELDMAAHGVTFFFDGFE

ASSSTISFTLYELGRHPAIQARLRTELMEATNDKGSIDYDTLFELPFLDQVVNESLRLWP

GGPFLSKRCTEPIDLDLTPTQQVRIEPGVCAMIPFWAIHRDPECYTDPDTFNPDRFSPET

GGVNPYREMGCFFPFSEGPRQCLGMRFARMLVKRGVYEVVKNFEFSVDSKTEEPLRMNPK

LFLTAVIGGIWLNFKPIVNE

 

>CYP6AH1 Aedes aegypti (yellow fever mosquito) 1.257_1 AAGE01277917 63% to 6AH1 Anopheles (ortholog)

MLELYIALAVLAVCLYFKWSCSYWRRVGNVDGPQPLPIFGNGLEQITGAKHFGEIFEEVYRTYPTAAWVGIYELFNKPAI

VVRDLELVKEILVGSFQHFNRNSFEVDETIDPLVAINPFTQSGDLWKERRSQVVPVFSQTKIRSCFPIIKNVADNFLEYV

TKTRKTSPDFEAKDICARFTIDSVASCAFGIDAESFTNPNSEFRRVGFELFNPSSIMATVRSLLALFAPKLASLLRIPFV

PPYVDRWFRKLVNEVIRQRKEGEVKRQDLFQAMYDTLTQQGTVDVKNDEIVGHSVTFLTEGFETSSTLMCYFLYELASNQ

HIQDRVLNEIDCVLKEYDGKLTDEAVNKLTYMERAMYETLRMHSPVFTLTKVCTKEYELPPQYTDDVGKRITMKPGMSAI

IPVHAIHLDPEIYPDPCRFEPDRFLDENRKGRHRYAFLGFGEGPRICLGMKFGLSQSKIGIATLLSKYRVVGSDKQELPL

EISRKSFLLASKNGIWVKFVERG*

 

>CYP6AH1 Anopheles gambiae CYPs2l4 499 aa AAAB01008807.1

MLEFYVAVIVLAVCLYFKWSCSYWTRQGGVAGPKPLPIFGNLFEQLTGQKHFGEIFEE

MYRAFPQASWIGYYKISNQPGIVVRDLELVKEVLTSSFSSFNQNDFIIDEKLDPLVAFNP

FVQAGERWKERRGQMTSVFTMNRIRATFPLVQQVAQDFVQFIERTRKMDPHFEGKD 

ICAKYTINVVASVAFGIDAESFTNPNAEFPRMGNALFAPTWLTAIRSQLALFAPGLAKLLRVP 

FVPGYVDRWFRCMVRETIRQREGAK

LASNPSIQDRVVKELRTVLEESDGQLTEAALHKLVYMEAAMMETLRMHTPVFTLPR

ICTQDYELPPQFPTDTKRITLRRGTSVIIPVYAIHYDPDIYPMPYKFDPDRFLEENRKSR

PRHAFLGFGEGPRLCL 

GMKFALHQSKIGIATLLNKYRVKVSSKQELPLEFAKSSFLLNPKSGIWLNFEDRE* 

 

>CPIJ000298 CYP6AH2 Culex pipiens 69% to CYP6AH1

MIELYVALGVLAVCLYFKWSCSHWRRVGNVDGPSPLPLFGNTLEQVLGTKHFGEIFDEVYKSYPSAAWVGIYQMFNKPSI

VVRDLELVKDILVGDFASFNKNAFEVDEKVDPLIAMNPFVQAGEKWKERRAALIPLFSASKIRTVFPIIKNVAENLLQHV

TDSRGASPDFEAKEMCGRFTVDSVSSSAFGIDAESITNPDGEVARNCFEFFNPNSTASFVRSLLLNFCPKVAAALNIGFV

PGHVARWIHGMVGEVLRQRQSGEVKRQDMFQALYESLSQNDQPVRGDEIAGHSLTFLSEGFETSSTLMSYLLYELASNQD

IQERVLNELDFLLKDSNGQLTDEVVQKLSYLELTMYETLRLHSPVFALSKVCVKEYELPPQYGTGNKRVRIAPGTVAIIP

VYGIHLDPEIYPDPYKFNPDRFLEENKKARHRYAFLSFGEGPRICLGMKFGLLQSKIGIATLLSKYRVELSPKQELPLEF

SKTCFLLAPKNGIWVRFVERR.

 

>CPIJ000299 CYP6AH3 Culex pipiens 68% to CYP6AH1

MAGLLIAVAALLLAVYLYLKRSCRYWRRVANIDGPQPSWVLGNISQQITGRKHFGEIFADVYRSYPQASWVGVYELFNKP

AVLVRDLELVKEILVSSFQHFNKNSFEVDASIDPLASMNPFVNVGDQWKEKRSQIVPVLTATRVRTTFPIIKNVAENFLN

YVDRVRGGSPDFEVKEVCGRYTIDSVASCAFGIDAESFANPDAEFARMGFELFNADSAIAWLRAMLALFAPKLASLLKLA

FIPKHIDYWFRSLIENVTNLRKDGKVQRRDLFQAIHDTLSQNGTVPVNSNELIGHSVTFLTEGFETSGTLMSYVLFELAT

NREVQDRVLQELDSALEDDQLTDEAVQKLVYLERAMYETLRLHAATLTLTKVCTKEYELPAQYPTDRKRVRIQPGTAVII

PVYGIHYDPEIFPDPHRFEPDRFLEENKKTRHRYAFLGFGEGPRICLGMKFGLLQSKIGIATLLSKYRVELSPKQQLPLE

VSKSTWLLAPKGGIWVRFVERKM.

 

>CYP6AJ1 Anopheles gambiae (malaria mosquito) CYPs3l3 = , 522aa

MFVSSLLLGGLFYHHPLVAVPLIALVALFYWLVKHNYKFWEIDGVPYPKPSLLTGNLGPSLALKKHISELASDWYNAYPDKPFVGYFKIFTPAIMVKDPVLVKNILSRDFDCFANNDFLLDVRQDPLLSHDPFLVTGERWKRSRSLLTPSFTGAKIKQLFPVMESVADAFVTFIGRHVAQELEAKEIAARFTTQNVVACTFSIDGDCFGEQESEFRRMGRRVFETSPMATVKTMMAVFLPTVAKYIPVPFLLKDVDEWIRSLVANLIIQRSASEKTVQEDLLQSFLKNREKSSTYRIDSPFKNATQTEITAHALTIFLEGFETSSVVLGFALYRLAKSPEVQQNLYNEVKKRIDANGGQLDFDALQQLEYLDWVMLETLRMHPPAATMHKVCTKKYIMRKGFRDEQGHDMSIYVREGTPILIPVLAIHMDPKYYPEPHQFDPERFSPARKVTHEGATFLPFGEGPRMCLGMRFAQAQVKLAMVKLILNYRVTVGPNDKPFAIDSRSFVYQARDGLRIVFERR*

 

>CYP6AK1 Anopheles gambiae (malaria mosquito) CYPs3l2 = , 516aa

MSLEVVDLLYTVALLLLLYLGWRKQTYWTRAGVPYIPEIPIIGNFATIFLQRHSSFEYIEHIYHHARTRTSDFFGVNIFTRPALVLRSPELIKRLTCTDAQRFINRQMCTDPFHDAIGYFNLIMIREPLWKQLRGFLSPSVTSAKLKRMQPLIEQVGADMMASLDALPVLRPNVRETEFKELCARFTTDVIASTFFGMQANCLKDEQSEFRYYGRKIFDYGPGRGLTMASFFFLPELVPYLRLKLFPRDTEAFLKAIIEQEIARREQTGESRGDFIDSMIALKNNNATLGVNEKIPLKGDILVAQAATFYMASFETTSSVLSFALYELTKNPHVQERLREEIRDIIVKYGREIPYEAYANEMPYLGMVISETNRLYPVLAFIERQCTLPEGSTGYKLEPLHDYVIPNGMPIMIPIYAIHRDPKYFPNPTVFDPERFAKENLDQIQPCTYMPFGVGPRTCLGSHFGTLQIKIALLKLLSQYRIERSPSTPEVLTYRKNAFTLNSNEGLYAALVEDAM*

 

>CYP6AK1_Duplicate exon 1  Anopheles gambiae partial 2 aa diffs AAAB01008823.1

MSLEVVDILYTVALLLLLYLGWRKQTYWTRAGVPYIPEIPIIGNFATIFLQRHSSFEYIE

HIYHHARTRSSDFFGVNIFTR

 

>CYP6AK1 Aedes aegypti (yellow fever mosquito) 1.136_1 AAGE01171970, 69% to 6AK1 Anopheles (ortholog)

MPLVAWLAAIALICYLAWKRNNFWNRHGVPYVLEIPAVGNFSSVALQMHSMFD

YVARIYDHVRTRDADFFGINIFFRKALVIRNPDMVKKMLVADSRYFINRQMC

TDREGDHFGYYNLMMIKEPLWKDLRGYLSPSVTSSRLRRMFSLIDEIGNNMLAHLDGVQQKPTK

LRETEFKELCARFTTDVIASTFFGIQANCLSDEESEFRYYGR

KIFEYGPKRALNMAAFFFMPELVPYLGFKLFPRDTERFLKTIIEQEIARRETSGENRGDFIDSMIALKNNEATIGVEEKIHLKGDILVAQAATFYMASFETTSSVLSFTLYELTKN

PEIQQRLREEIHNCIKKYGRDLSYECLVNEMPYLGMVISEAARLYPVLPFIERQCSLPAGA

TGYKLDPFHNFVVPNKMPVLVPIYAIHRDPKYFPDPLRFDPDRFSKDNADNIVPCSYMPFGVGPRTCLGSHFGTLQVKVAITRLLSKYRI

LRSESSPETLTYRKNAFTLHSNEGLYADLELDELC*

 

>CPIJ016356 CYP6AK1 ortholog Culex pipiens 73% to CYP6AK1 Aedes

MALLMVLLVVTLVLLVYRGWCRHNYWNDHGVRYVLEIPVVGNFSLVALQIRSMFDYVEYLYWHRKTRGANFFGVNIFFRK

ALVIRNPALIRKMIAQDSTFFCNRQMCTDHNADPFGYYNLLMIKEPLWKDLRSHLSPSVTSFKLKRMLHLIDQIGQDMLS

YVETLPEKRPQVREIELKELCAQFTTDVIASTFFGIRSCCLSQEESEFRYYGRKIFEYGARRGVTMASFFFMPELVPYLK

FKLFPRDTEQFLRVIIQREMERREASGEKRGDFIDSLISLKSNDATIGVKEKIPLKDDILVAQAATFYMASFETTSSVLS

FTLYELTKNPSIQQRLREEICAAIGRNQGSPELPYECIVNELPYLGAVISEAARLYPVLPFLERQCSLPEGATGYKLEPF

HDFVIPNKMPVLIPIYAIHRDPKFFPDPLRFNPERFSKENLDKIVPCSYMPFGVGPRTCLGSHFGTLQVKVAIVRLLSRY

RLMCSESTPKTLTYRKNAFTLCSNEGLFANLVEDKLF.

 

>CPIJ016355 CYP6AK1-de1b Culex pipiens pseudogene 3kb upstream

45% to CYP6AK1 N-term

MIYASWDVFSSYFMLLLLCIVLFIAWFVSTGATRYWQCFEGLVPYIGGRPLVGNFLQPLL

MRQSMFELMEQLYEDGRVKGSKLFGIALLMQPALVLRDPEVIKQVLIKDAAFFCNRFMCT

DPASDPIGYYNLLMIKNPHWKQLRAFLTPSLSLAKIKKMYLLVDQVRSLIHAVDKGHE

 

>CYP6AL1 Aedes aegypti (yellow fever mosquito) 1.354_1 CYP6AL1 6I1.2

MLFLAFAIFVLFAIIQIVYHFRYWMRRGVPQLRPSFPFGDFGEF

FRQKHGIPMTYANIYARTRHLPYVGIYLSMRPVLFVNDPQMVKDILSRDFEHFHDRGL

HVNEETDPLSGNLFSLGGVKWKNMRAKLTPTFTSGCLKGMLAILIDKATVLQKQFAKE

IATHNTIEVKDLFARYTTDVIASVAYGIDNDSINNDHDLFRQMGIKVFQQDFKTSLRL

ALTFFIPKIKALLGFSLVAKDVEDFMINLVSKTIEHRERNGIQRKDMMQLMLQLRNSG

SVSINDQQWNLDSSATVKNLTINQVAAQVFVFFVAGYETSSTLMSFCVWELARNPEIQ

VKVHQEIDSVLSNYGGALTYEALADMEYLECCMEETLRKHPPVSFLNRECTKTYRIPE

TDVIIDKGTAVVVSLLGMHRDPQHFTQPTEFKPERFSSDEQSNESNKAYFPFGGGPRL

CIGMRLGMLQAKVALVTLLAKFEFSLGKEHVKDMELPLKANTLLLVPQDGIQLVVKKR.

 

>CYP6AL1 6I1.2 Aedes aegypti 50% to CYP6N1, 48% to 6Y1, 60% to 6I2.3

 QAFMFFVAGY ETSSTLMSFC VWELARNPEI QVKVHQEIDS VLSNYGGALT

 YEALADMEYL ECCMEETLRK HPPVSFLNRE CTKTYRIPET DVIIDKGTAV

 VVSLLGMHRD PQHFTQPTEF KPERFSSDEQ SNESNKAYFP FGGGPRLCIG

 LRLG

 

>CYP6AL2v1 Aedes aegypti 6T1.2 50% to CYP6P2, 97% to 6I2.3

 QVFVFFFAGF ETSSTTMSFC LYELAKHPEI QRRVQAEIDS VTALHDGKLT

 YDSINDMRYL ECCIDETLRK YPPVPVLNRE CTQDYKVPGM DFTIEKGTAI

 VLQIAGMQHD PQYYPDPMQF KPERFQDPEV KSKPYAPFGD GPRVCIGMRL

 G

 

>CYP6AL2v2 Aedes aegypti 6I2.3 56% to CYP6P2, 97% to 6T1.2

 QAFMFFVAGF ETSSTTMSFC LYELAKHPEI QRRVQAEIDS VTALHDGKLT

 YDSINDMRYL ECCIDETLRK YPPVPVLNRE CTQDYKVPGM DFTIEKGTAI

 VLQIAGMQHD PQYYPDPMQF KPERFQDPEV KSKPYAPFGD GPRVCIGLRL

 G

 

>CYP6AL3 Aedes aegypti (yellow fever mosquito) 1.415_1 AAGE01116725

MLLAFLALSAPLVTVLIWLQFRYWTRCGVPQLDPSFPFGNFSEFFCQKNGIPSTYANLYHRTKHLPFVGIYLSLRPALLINDPELVKNILTRDFEHFHDRGIHVDEETDPMSGHLFALGGVKWKNLRAKLTPTFSSGSLKEMFPLLVEKATVLQKRFLKEIATSEVVEVKELAACY

TSDVIASVAYGIDMDSINNRDDLFRRMGEKVLAHDLITSLRLALAFWFPKLKVMLGSKSIAPVIQEFMTELVRKTIEHREKEGVHRKDMMQLLLQLRNGVSLKRNGVQWTEDSAPKNAIKSLSIDEVTAQVMVFFVAGYETSSSTVSFCLFELARHQDIQAKVHQEIDTVLAEHEGNLTYASLASMKYLEQCLEETVRKYPPVAILNRECTKTYRIPETDVIVEKGTPIVVPLMGMHRDPQYFPQPNDFQPDRFEGGAQSKAYFGFGAGPRLCIGMRLGILQSKVAVVTLLRKFKFSLANPEDQHTELRMKPRSFILTTEGGIQLVVQQRHVCET*

 

>CYP6AM1 Hodotermopsis sjostedti AB194532

MLETLDRWLLQFAVLSTIILAALYVYFKISYSYWEKRGIPTLKFTAPFGNFTYSFLFGKNPEYEVTEMYKAFEGHRVGGLYRFDSPSLLIRDTDIMKDILVKDFGHFVTRGLKFDEVSEPLDGHLFSLSGAKWRNLRVKMTPIFTSGKLKTMFGTVVECGKDLQVALQKAANNEETVEIKDFLARYSTDVISSCAFGIQCNCLKKPNAEFRNWGRRIFEPHFRQRLTSILNMLYPSLVYTLKLSLIPKDVGNYFRKMVNETVEYRENNSVKKNDFMQMMIQLKNKTLGTAEENDMNFVEKETEELKSNASFDVTMNVIAAQAFVFYVAGFETSSTTMTFCLYELALNPDIQERLHAEIDTMLEKHGGNITYESIFEMEYLDKVVNETLRKYPPVVILTRECTKPIKLRRTDVTLEKGLQVLLPVLGLHHDPKYYPDPERFDPERFSEEEKKKRPHFSFLPFGEGPRMCIGMRFALMQTKVGLISLLSNYEVRVSEKTPVPLVFEKSALVLTAAGGMWIKIENRQERSN

 

>CYP6AN2 Bombyx mori BABH01029151.1, BABH01029152.1

MLLLALLLIFSIVIYLYTTRNHNYWAKRGVRHDPPVPFFGNHFRNVFGLK

SIIELSVELYNKYPNEKVVGYYRGTEPELIVRDLDIAKNILIGDFVYFHH

RGLGRNTDLEPLLRNLFHVDGDAWKLLRKRLTPAFTTAKLKAMFPLVINC

AEKMKSVAGEYAGRGGECDVRELMARFSTEFIGACGFGIQMDTINNECSL

FRELGRLIFTRQGLSLVAIGLWDLLPELRKYLRLPSSSVEATITEIYEKI

RDQRNGKPCGRNDFVDLLLELKQKGVIEGESIDRFNVDGTPVHLQLEMDT

KCIVAQMFVYFAAGFETSSSATSYTLHQLAFHQEIQKEIQCEIDE

VLSRHDNKLCYDAILE

MPLLTMAFKEALRMFPSLGNLHRVCTRSYTIPELGITIDPGVRIIIPAQAIQNDA

KYFDDPSEFRPKRFAKDSEIKKFSFLPFGAGPRNCIG ARLGEMQSLAGLA

AILHKFSVEPAPSTVRKLRVKHTQNVVQGVEGGLPLLIKERK

 

>CYP6AN5 Maduca sexta Contig_1007_FL sent to genbank

61% to CYP6AN2 Bombyx mori

MILIITFVLFLYALYVYSTKNHNYWKKRNIKHDPPIPLFGNHFVNQFGYKSITQVATELY

NRYPEEKVVGYYQGTTPLLLVRDLEIVRRILTVDFSHFYLRGLGRNPDVEPIFTNLFHTE

GDSWKLLRQRLTPTFTTAKLKAMFPLVVECAKKLQGVAEGVAKRNESCDVRELVARFTTE

FIGACGFGINMDTINNEKSMFRNLGKLITSSRSLGLIAKYMLWENFPYVRKFLYVGDRRI

EESIVEILQQIRKKRNYKPSGRNDFIDLLLELEAHGKITGESIEKRNSDGTPKLIEMDMD

MNCMVGQVFVFFAAGFETSSSASSYTLHQLAYNPDIQRQVQENIDEVLNKYNGELCYDAI

AEMKLLSMAFKEAMRMFPSLGVLSRVCARRYTIPELNITINPGVKILIPLEGIQNDEKYF

TNPKEFRPQRFSPDAMKEQQKFSYMPFGEGPRACIGARLGEMQSLAGLAAILHKFTVEPA

PSSRLEVQIDTTMNVIQKLEGGLYLTLKSRKSKEE

 

>CYP6AQ1 Apis mellifera AmGroup12.14 (315628-318450) honeybee 45% to 6K1, 42% to 6g2m 43% to 6G1ps new subfamily in CYP6

MNLLTPYWSLDILIVSSSLMIAVYLYASWKLKYWSRRGIMQITPSPLFGNFKKCILFQKSV

SEIIRELYGQNEGLPFMGFYIFYKPFFLVRDIELVKHILVKDFNTFANKHTSADSKNDRIG

YSNLFIIKNPAWKYLRGKLTSVFTSGKLKKMFDLMLIIG(1)

KNLEKHLELLNLDG

NGKEVELKDLCANFTTDLIGTTAFGVNLNSLKDPNSDFRENGRLVFDYNLKRAFEFFSIFFFPNLS

KYVSIKFFGKATDYFRNSFWSVINQRIESNVKRNDLIDCLIELREKHKNDESFEGFR(1)

FDGDDLVSQAAIFFTGGFETSSTTISFTLYELALNKDIQKTVRTEIHEALAQTDGKITYDM(0)

ITNLPYLDMVVSETLRKYPPLGFLDRVALHDYKIPNSDVTIDKDTPVIIPMIAFHYD

PKYFPNPEKYDPLRFSEEVKKTRPSYVYMPFGEGPHICIG(1)

MRLGLLQSKLGIIEILKDYEVSPCEKTKIPMVLDPKGLTTTALGGLYLNIRKITIAAG*

 

>CYP6AQ2 Philotrypesis sp. 5 YL-2008 EU661088

FFIAGFETSSTTMAYGLYELAKNPEVQTKLRNEILEALKETDGK

LTYEMVTTLPYLHMVLLESLRLHPILLWLDRLSGKNYTFPGTNIIVEKGVPVVIPVKS

LHYNSQYFPNPEKFIPERFSEENIGSIVPFSAGPRRAAR

 

>CYP6AQ3 Philotrypesis sp. 5 YL-2008 EU661089

FFIAGFETSSTTMAYGLYELAKNPEVQTKLRNEILEALKETDGK

LTYEMVTTLPYLHMVLLESLRLHPILLWLDRLSDKNYTFPGTNIIVEKGVPVVIPVKS

LHYNSQYFPNPEKFIPQRFSEENIGSIVPFTYLPFSAGP

 

>CYP6AQ4 Nasonia vitripennis (jewel wasp)

MALITSDWSLDAWIFISAVLLGLYLYFRRNLDYWKKRGVKYVEPTLFFGNTVP

CLLARKTPDVLIREIYEKGAGEQFIGFHVFNKPYLVVRDPELIKNVFIKDFNN

FTNKVLCGNHTDVMSSTNLFVASNPPWKSIRTKLSPIFTSGKLRKMYELMEEI

CDDLQVYLDKLDIDV GKPIEIKEICAKFTTDLIGTTAFGMRLNSLTDPNA

EFRKNGRRVFRSSFKRYLQLLALFFIPPLRPYTNAKFFDEKATDFLRTEFWNV

INERIKSGFKRDDLLDMLIEIKNNQDNGTDNTFR LEGDALVAQAAIFFTG

GFETSSTTMSFALYELARNPESQTKLRNEILNALETTGGKVTYEM MTTLP

YLHMVTLEALRLYPVIAWLDRIPETDYTFPGTNVTVEKGVPVVLPLRALQLSP

QYFPNPNQWDPERFSEENKKNIVPFTYFPFGEGPRSCIG IRLGYIQTKLG

ILNFISKYELTVSKESANLQPEPLNIITQAKGGIYLNLRKLTA*

 

>CYP6AQ5 Nasonia vitripennis (jewel wasp)

MAVITSNWSLDAWIFISAVLLGLYLYFARKFSYWKKRGVKYVEPTFLFGNAAP

CLIAAKKPDDLIREFYEEGAGEKVIGFYVFDKPYLVVRDPELIRHVFVKDFSN

FSNKLLCGKNTDVMGSTNLFQVMNPPWKSIRNKLSPFFTSGKLKKMYELMEEI

CTDLQVYLDKLEIDV GKPIEIKEICAKFTTDLIGTTAYGMRLNSLTDPNA

EFRKSGREMFRSSFMRYLQMLAIFFIPPLRPYINAKFFDVRPTEFLRKAFWHV

INERIATGIKRPDLLDMLIEIKNNQDNGTDDTFK LEGDALVAQAAIFFTG

GFETSSTTMSFALYELARNPETQTKLRNEILSALETTGGKVTYDM ITTLP

YLNMVTLEALRLYPVISWLDRLPEADYTFPGTNITVEKDVPVILPMRTLHLDP

QYFPNPDQWDPERFSEENKKNIVPFTYFPFGEGPRSCIG TRLGYIQTKLG

ILNFISKYEVTTLKETNVKIDKLNIFTQAEDGIYLNLRKLSA*

 

>CYP6AQ6P Nasonia vitripennis (jewel wasp)

MAVITSNWGLDLAISIFALMLSLLYLCIAKNSNYWKNRGVRDVKPNFIFGNVA

PCIFAKKTLDELIREVCDKGAGEKLIGFYVFDKPYLLIRDPELIRNVFIKDFS

NFSNKIMGGKHTDVMSQYYNLFLANNPPWKYISLKLAPIFTSGKLKKMYELMI

AICDDLQVHLDKLDIDV GKPVEIKEICAKFTTHLIGTTAFGMQFNSLKNP

EAEFRKYGREIYRSSFKRYLQMASEFLRKTFWRVIDRRIESGTKRADLLDLLI

EIKNNQEREANNQYK LEGDALLAQAAVFFTGGFETSSNTTSFALYELARN

PETQTKLRNEILDALETSGGKVTYEI LTTLPYLNMVTQETLRMYRILPWL

DRISEADYTFPGTNVTVEKGVPVILPMKTLHLDPQYFPDPDNIIPERFSEENK

KNIIPFTYFPFGEGPRSCIG

 

>CYP6AQ7 Nasonia vitripennis (jewel wasp)

MAVLTSDWCLEAAICASALLLGLCLHARRKHDYWRKRGVKYAEPRFLFGNVAA

CLLGKKSPHDLIRETYEKGAGEKVIGLYVFDKPYLILRDPELIKYVFIKDFGN

FSNKVLCGKHTDVMSAANLFLVNNPPWKYIRTKISPIFTSGKLKKMYELMMEI

CVDLQDHLDKFDIDE KVGKPLEIKEICSRFTTDLIGATAYGLQLNSLKDP

DAIFRKNGRQVFRSSFKRYLQLLALFFIPSLRPYTNAKFFDEKATEFLRNTFG

DVINRRMESGDKRADLVDMLIEIKKKQDRDPNAHYK LEGDALIAQAAVFF

TGGFETSSTTMSFALYALARHPEIQAKLRTEILNALETPGGQMSYEK LMS

LPYLNMVVNEALRLYPVLPWIDRIPETDYTFPGTNITVEKGVPLILPMRTLHL

DPDYFPDPDKFIPERFSEENKKNIVPCTFFPFGEGPRNCIG LRLGIIQSK

LGIVNFLSRYELSICKETDFKIDHMHVLTQAKGGICLNFRKLPA*

 

>CYP6AQ8 Nasonia vitripennis (jewel wasp)

MALLTHHWGLDGLILLSSLLVGIYLYFTRNFKYWQKRGIKQVPPTALFGNIGA

PLLGQKPFIKLLSDMYKAGEDEPYIGYYVLDKPFLLLRDPELIKYVLIKDFNN

FPNRVAASRKTDVVGSMNLFVVNNPEWKYIRQKLSPIFTSGRLKKMFDLILEV

DKDLDVHMNSLKLEG SGRDIEVKDICSKFTTDIIGLTAYGMKFNSLTDPD

AMIRKVGKDIFGRSYRRYLEFFAVLQVPTLVNVFGFEVFGKAATKFLRYIFWN

AINERIQSGAKRADLIDLLVGLKKEQESDSNQNSFK LEGDTLVAQAAVFF

TGGFETSSSTMSFGLYELAKNPTIQDKLRKEIRDTLDANNKKVTYDM IMS

SLPYLDMVISEVLRMYPILPYLDRNTEADYQLPGTKLVLKAGTPVVIPMQAMH

MDSRYFPKPEIFDPERFSPENKKNILPNTYFPFGDGPRICIG MRLGLMQT

KLGLIHLISKYEFSPCKDTLIPMEFDKYSVFTTSRNDIILNVRKLRD*

 

>CYP6AQ9 Nasonia vitripennis (jewel wasp)

MAFITHCWTLDILITLVCALMVAYVYLTKSHSYWKKRGVKSVPEPNIFGNFSD

CLFARKPLRDFLSNVYFVGEGEKFIGFYVFDKPFLILRDPEAIKNVLVRDFKN

FSNRCVAPNHSDYIGNVNIFSLRNPAWKVLRQKLSPVFTSSKLKNMLDLIVET

GVDLDTHLQNIISNE VKELCEKFTTDVIGSTMFGLKLNALNNPKAEFHNE

GKKHFQNSYGRYFSLLSMFFMPQLAKLFGITFFDPDVPNFFKRVIPEAMNERQ

KDGIKRNDLLDVFMEMKESFEDEKNDLHYY FQVNGLVATAIVFFTGGFEP

SASMMYLVLYELSKQSEIQDKLRKEILDALEETEGKITYDM MMNLPYLDM

VVSEGLRKYPLLHFLDREAEHDYTFPDTDVTIDKGTPIIIPMSAVHMDPKHFP

DPHVFDPQRFSPENKRKIAPFTYFPFGEGPRNCIG MRIGLAQSKIGLMQI

LSKYEVAPCKETPIPLEFDSYTLFTKSRHNMKLNVRRVRSI*

 

>CYP6AS1 Apis mellifera

MDYFQILCAISIVILTIYYYYSSKYTFWKKRGISGPKPIIFFGNFVDSIIQKRSTSEAVKK

WYDDYKHESVFGIFGGTTPLLVINDLDMIKDVLIRDFSLFVDRGFHIFPK

IEPLSEHLFLLEAERWRPMRMKLSPIFTSGKLKEMFFLIMESAGNLEKYLDEVIKKDEMVE

CRELAAKFMTDVIGSCAFGINTNSLLEEDSEFRRMGKKISTPNLKVMLGNICKEFFPPLYE

IVGSIFTLKDVNEFFINLVSDTMKYRKDNNIIRSDFINMLMQLKEHPEKMENI

ELTNTLLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRNMHEKNKGVLTYT

DVKEMKYLDKVFK

ETLRKYPILPMLFRQAMENYTFKDTKITIPKGMKLWVPVHGIHHDPNIYPEPEVFDPERFE

DDAFASRHPMSYLPFGDGPRNCI

GARFAHYQSKVGLITILRHHKVNVCEKTTIPFKADERSFLLTLKGGVHLKITKI*

 

>CYP6AS2 Apis mellifera

MDYFQILCAISIVILTIYYYYSLKYAFWKDRGISGPKPIIFFGNFGNSIIKKKSLSETVKK

WYDDYKHESVFGIFEGTIPVLVINDLDMIKDILIRDFSLFVDRGFHIFPK

IEPLTQHLFLLEAERWRPMRMKLSPIFTSGKLKEMFSLIVESAGNLEKYLDEVIKKNEMVE

CRDLAAKFTTDVIGSCAFGINTNSLLEEDSEFRRMGKKIFSPSLKLMIGNTCKVFFPSLYE

VIGNIFTMKDVDEFFINLVSDTMKYRKDNDIVRSDFINMLMQLKEHPEKMDNI

ELTDTLLTAQAVVFFIAGFETSSSTIAFGLYELAQNQEIQDKLREEIRKMHEKNKGILTYT

DIKEMKYLDKVFK

ETLRKYPILSTLSRKAMENYTFKGTKITIPKGTKVWVPVYGIQHDPNIYPKPEVFDPERFE

DDAFASRHPMSYLPFGDGPRNCI

GARFAHYQSKVGLITILRNHKVNVCEKTTIPFKADERSFLLALKGGVHLKITKI*

 

>CYP6AS2P1 Apis mellifera FRAGMENT GB19197-PA 209aa 3 exons gnl|Amel_2.0|GroupUn.5353 minus (2931-2710,2531-2286,2114-1950) 51% to D. melanogaster CYP6a17(AC020447) pseudogene fragment, similar to C-term of CYP6AS2 100%

(1)LTDILLTAQAVVFFVAGFETSSSTMAFSLYELAQNQEIQDKLREEIRKVHEKNKGVLT

YTDIKEMKYLDKVFK (1)

ETLRKYPILSTLSRKVMENYTFKGTKITIPKGTKIWVHGIQHDPNIYPEPEVFDPERFEDD

AFASRHPMSYLPFGDGPRNCI (1)

GLVLPHYQSKVGLITILRNHKXVNVCEKTTIPFKADERSFLLVPKGGIHLKIIKI*

 

>CYP6AS3 Apis mellifera

MDYFQLLCVIGALLFAIYYYLTLTFDTWKNRGIPGPKPTIFFGNFQEVILKKISLAEKTKQ

LYQEYKNELVFGIFQGRTPILVINDLEMIKDVLIRDFSVFPDRGIHVNPK

VEPIFQTLFSLKSKTWRPLRMKLSPVFTSGKLKDMFPLILDCAKNLEEFVEKVRNSGEPVD

CRDMAAKFTTDVIGSCAFGVCMNSLSPEGSEFRRMGEQLGKFSFKKLARDFTRLYMPFLFD

IIGGYLQSHEVNNFFINLIRDSIKYRQENNVYRPDFVNTLKELKEHPEKLENI

ELTDALLTSQALVFFLAGFETSSTTISNALYELAQNPEMQDKLRKEIKEVYENNGGALSYT

DVKEMKYLDKVFK

ETLRKYPVLAALSRQATENYTFKDTKIKISKGTRIWIPVYGIQHDPNIYPEPEVFDPERFE

DDAFASRHPMTYLPFGDGPRNCI

GARFAHYQSKVGLITILRNNKVEVCAKTLIPYKSEPRNILMIPKGGKVELRITKV*

 

>CYP6AS4 Apis mellifera

MLHHFHILTAFVAIFLALYYYLTSKFDFWKNRGVSGPRPVPFFGNAKDVLLRKIGIGSFIA

ELYKRYDNEAMFGIFIGRSPNLVLRDLDLIKDVLIKDFSIFDNRGLNIPER

AEPFSVNLFSVDATRWRPLRMRLSPVFTSGKLKEMFPLILECAEHLEQCLEDAVKRGGPVD

CFEIPARYTTDVIGSCAFGINMNALSDERSEFRKMGRNMFDQNMIKFTRNLLRDFFPRFYN

LLGFVLPYTESTVFMTKLIKGTIKYREENDVVRPDFVNLLMELKKHPEKLKNI

EITDTLLAAQASVFFAAGFETSSTTMAHALYEMALNPDIQDKLRNEMKEFHAKNNGNLKYE

DIKEMKYLDKVFR

ETLRKYPPGMLLRRKCNSNYTFHGTKVSIPAGTSVIIPLYAIQIDPKFYENPDVFDPERFN

EDAVAARHPMTYLPFGDGPRNCV

GARFAVYQTKVGLIKILQNFRVDVCEKTMIPYVKKINSITLAPRDGIFLKIEKITD*

 

>CYP6AS5 Apis mellifera

MASSFEILCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKDLILVKKSTAHFVK

DIYEKYKNEPMVGLYATRSPFLLLNDPELIKDILIRDFSKFANRGLGVFER

TEPLSPHLLNLEVERWRPLRSRLSPIFTSGKLKEMFYLIIECSLNLEMYLDKLIEKNEPIE

CRELTARFTTDVIGSCAFGIDMSSMTNENSEFRRMGREVFAVNFMNVMRMKLKQFMPRLYD

LLGYVMPDRTFAPFFTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENI

KLTDSLIAAQAFVFFLAGFETSSTTMSNALYELALNQDVQKKLREEINTFCPKNNKELKYD

DIKEMEYLDKVFK

ETLRMYPPASILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAIYPNPDSFDPERFD

KDAMASRHPMHYLPFGDGPRNCI

GARFAVYQTKVGLITILRNHKVEVCEKTVIPYEFDPGAFLLSPKDGIYLKITKI*

 

>CYP6AS7 Apis mellifera

MPSLEIIFGIILLFPAIYYYFTSTFDFWKVRGVPGPKPIPIFGNIKNVMLLKTSMCHYLKK

LCEEYKHEPMIGIFTRKTPILIIQDPDLIKDVLIRDFSKFANRGIPIHEK

AEPLSPHLFNLEVERWRPLRTRLSPVFTSGKLKEMFPLILDCAKHLEQYLDKLVLREEFIE

CRELTAKYTTDVIGSCAFGIEMNALSDEESEFRRIGRKVFSNSFGQILRFRFRQIFPRIYN

LLGFVLPPMEVTKFLTNIIVSTMKYRQENNIVRPDFVNMLIELKKHPDKLENI

KLTDTLLTAQAFVFFIAGFETSSSAISNALYELALNPEVQNKLRQEIKEYFNKHNELKYEY

IKNMIYLDLVFR

ETLRKYPPGPLILRKSITNYTFNNTKVSIPEESFVWIPLYAIHHDPKIYPNPDAFIPERFN

DDAIATRHPMHYLPFGDGPRNCI

GARFAVYQSKIGLITILWNYKVEVCDKTMIPYEINPAAFLLTPKGGIYLKFTKIKNNEEILN*

 

>CYP6AS8 Apis mellifera

MYISLEIFCGIVVALIALYYYLTVNNNFWKNRGIAGPEPVLGFGNMKKVLLGKESMSQFLT

KIYHEYKNEPIIGIFTTRTPQLIIKDPDLIKTILIKDFSKIMNRGLLPMVS

GEPISQHLFNIEAERWRPLRIHLTPVFTANKLRGMFSLILECSMHFVSYVDSLVKKGEPVN

VREVAARFTTDVVGSCGFGVEMNSLSEKESEFRRVGKSVFATNYARIIKHRIREFMPRLYN

YILYLWPTDEMAEKIIKLTRETLEYREKNNLFRPDFMNILLDLKKHPEKIGL

DVTNEFLAAQAFIFFVAGFETSSSTISNALYELALNPDVQDKLRKEIKEFAAKNDGEWRYE

TIKEMEYLGKVFQ

ETLRKYPSLPFLTRELIEDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFS

DDKIKQRHPMHFLPFGHGPRNCI

GARFAIYQTKIGLINILRNFKLDVCDKTLIPYKHHPRGLLLMPLTDLYLKITRLTN*

 

>CYP6AS9P PSEUDOGENE Apis mellifera

MFINLETLCGFVIVLIAFYYYLTINNNFWKNRGIPGPKPTIGFGNMWTVMFGKESFSQLLT

TIYNKYKDEPMIGIFFRRRPVLLLKDFDLIKDVLIKDFSKFANRGFLKTNP

KVPLTNHLFALEVKRWRPLRNHLXSPVFTSGKLKGTFAQILNCSNDLVTHIDTLSKMEDSI

NMREVAAKFTTDVIGSCVFGIKMNSLSEIENEFRRIGRNIFATNFTNILKIRLLQSTPFLH

SLLCKILPDEEMEMFMRITKETMEYREKNNLVRPDFMNILLELKKHPERIADI

ELTDDLLAAQAYIFFAAGFETSSTTISNALYELALNHDMQDKLREEIKEFEAKNDGEWRYE

TIKEMQYLGKIFG

GTLRKYPALSFLSRESIIDDYTFRDTKLTISKGTLVWIPVFPIHHDPNIYPDPEKFDPERF

TEDKIKERNLMHYFPFGHGPRNCI

GARFAIYQTKIGLIKILRNYKVDVCSKTLIPYKYDPFSFILVPLGGLYLKITRI*

 

>CYP6AS10 Apis mellifera

MAAFEILCGFIIFIFAFYYYLIKPQEYWKNRGVPGPKPIPIFGNFFRLTFARISIGDLMTK

FYKEYKHEPVFGLYMRNVRVLAINNPDLIKTVLIKDFSKFAHRGLALNEV

TEPLSQHLFVLEPKRWRPLRTKLSPIFTSGKLKDMFSLIIECSNTLENYVEHLISKNDRVE

VRDLAAKFTTDVIGSCGFGVDMNAMSDVQCKFRDIGREFFGPSFKQILKIRLRENLPRLYT

FLGYILPRDETTTFFTNVVLDMIKYRKTNDIYRPDFINALINIQNHPEKLDI

ELTEPLLVAQAFLFFVAGFETSSLTIATALYELAQNQDIQDKLRDEITEHHKLNNGEWQYE

NIKNMPYLDAVFK

ETLRKYVPLTVLMRQSLEDYTFESINLTIPKDTRIFIPIYAIHRDPDIYPNPEVFDINRFS

KEAEATRHPMHYLPFGDGPRNCI

GARFAIFQTKIGLIKILRTYKVDVCNETQIPFINEPRTFTLAPKHDLTLKITKIEN*

 

>CYP6AS11 Apis mellifera

MYINLEIFCAIVIAFIAFYYYLTINNNFWKHRGISGPKPVLGFGNMKKIILGEESMSQYLT

KLYHKYKNESMIGIFRLRTPALIIKDPDLIKIVLIKDFSKFMNRGLLPIIS

TEPISHHLFALEAERWHPLRKHLTSGFTSNKLKGMFCMIHECSKHLVNYLDILVRKEEPVN

VREVAARFTTDVVGSCGFGVEMNSLSEQESEFRRLGKSIFNTNVQKIIKDRIRELTPQVYN

FLLYILPLDGISPKILKLMKETIKYRKKYDIFRPDFMNIILELKKHPEKINI

DITNELLAAQIFIFFAAGFETSSTLISNALYELALNPNIQDKLREEIKKFESQNDEEWKYE

TIKKMDYLEKVIQ

ETLRKYPPVPFLNRELIDDYTFESNKVTIPKGLKIWIPTYAIHNDPDIYPDPDKFDPERFS

EDNIKQRHPMHFLPFGHGPRNCI

GIRFAEYQTKIGLINILRNFKLDVCDKTLIPYKLHPRGLILIPLTDLYLKITRLTN*

 

>CYP6AS11-de1b Apis mellifera (honeybee)

only 6 amino acid differences to 6AS11 in an 11 amino acid window

alternative exon 1

MYIGFEIIYGIVIVFIAFYYYLTINNNFWKHRGISGPKPVLGFGNMKKIILGEESMSQYLT

KLYHKYKNESMIGIFRLRTPALIIKDPDLIKIVLIKDFSKFMNRGLLPIIS(0)

 

>CYP6AS12 Apis mellifera

MAYIEILCGIIVSMLVFYYYFTSVFNFWKIRGIPGPKPKFLFGNIRDIILSRISTPTFIKN

IYDTYTNEPMVGLYMGRNPILLLKDPELIKDVLIRDFSKFADRGFNVHEK

VEPLSQHLFNLEPKRWRPLRSKLSPMFTSKKLKEMFGLILECGHHFEKYVDGLAARRQPVD

FCEVAAKYTTDVIGSCAFGINMNAMSSEGSEFREAGRKIFEPTWNSIIRLKFKITMPTLYD

LLGPLVPEREVTPFFIKVVTDAMKYRKERNVFRPDFIDTLMKLRDDPESLSDI

ELTDAFLTAQAYVFFAAGFETGASTISNTLYELAQNQGMQDRLREEIREHCDKYGGELMYE

NIKEMEYLDKVFK

ETLRKYPPGTLIPRRSVSEYTFKNTNVTIPKGTMIWIPAFPIHRDPNIYPNPDDFNPENFT

EDAINNRHPMNYLAFSNGPRNCI

GARFANYQVKIGLIMILRNYKVEVCEKTVIPYQFDPNLFLLGPKGGIYLRVTKVE*

 

>CYP6AS13 Apis mellifera

MDFFQIFCAICIMLLAIYYYYTSIYNYWKVRGIPGPEPTIIIGNFMEVFLKKISINDKLRF

LYNKYKNEPMFGIFEGSSPILVLNDLDLIKDVLIKDFSIFSNRGFRIFPK

AEPLGEHLFALETERWRPMRAKLSPIFTSGKLKEMFPLIIECSKNMEPYLDKIAERGKYIE

CRDLAAKFTTDVIGSCAFGIDMNSISDKDSEFRIIGRKLFTPTFKTIVRDVCRQFLPGLYD

VIGHKLQIEEVNEFLTNLIKDTINYRKENKIVRPDFVNTLIELKDHPEKLETI

KLTDSMIASQAFVFFVAGFETSSSTISHALYELAQNQEIQDKLREEIREVYEKHGELTYDV

IKNMKYLDKVLK

ETLRKYPIMAMLTREAQENYTFKGTKVTIEKGIKVWILPYGIQNDPDIFPNPDIFDPERFD

EEAVAARHPMSYLPFGDGPRNCI

GARFAQFQSKIGIITIVRNHKIDVCEQTKIPYESDPFQFLLALKGGINLKISKI*

 

>CYP6AS14 Apis mellifera

MYIGLEILCGIVITLIAFYCYLTINNNYWKNRGIPGPKPVPGFGNMKNVIFGKESVSQFLT

RMYNEYKDEPMIGVFSKRTPVLIVKDVDLIKTILIKEFPKFANRGLFPIFS

RDPLTHHLFNLEVERWKPLRTQFTPLFTSSKLKEMFSLILECSNHLESYMDTLIKKGEPID

MREVSARYTTDVVGSCAFGIDMNSLSEKESVFRRLGKLIFATNLRKILSIRIQDMLPWLYN

SFLYVLPRDEKTRIIMKLMTETMEYREENNVFRPDFINMLLNLKKHPEKIDI

ELTDDLLAAQIFIFFAAGFETSSSTISNALYELALNPDIQEKLRKEIKEFEARNNGEWRYE

IMKEMEYLEKVFQ

ETLRKYPSLPFLNRKLINDYTFESNNVTVSKDLKIWIPVYGIHHDPDIYPDPEKFDPERFS

KKEEIMKRHPMHFLPFGHGPRNCI

GARFAVYQTKIGLIKILRNFEVQVCNKTLIPYKVNPYTSLLIPITGLYLNVVKLEN*

 

>CYP6AS15 Apis mellifera

MNISLEILCGIIVALIVFYYYLIINNNFWKNRKISGPKPVIGFGNMLSIILGKESTSQFLT

RIYNEYKNEPMIGIFSKNNPALVIKNPDLIKTVLIKDFHKFANRGLFPVNS

REPLSQNLFGLEVERWRPLRIHFSPIFTTNKLKGLCSLILECSEQLEKYMDILIRKGEPLD

IREIAARFTTDVIGSCAFGIEMNSLSENESEFRRLGKGVFNTTFRRIVKTRIRNLMPWLYN

FFLRILPWDEITKKIVKLTTETIEYRNKNNIVRSDFINVLLNLKKHPEKIAEI

ELTNDLLSAQTFVFFGAGFETSSTTISNALYELALNHDIQYKLREEIKEFEKKNDGKWTYE

SIKEMQYLNKIFQ

ETLRKYPVVPFLNRELISDYTFENSKITIPKGLKIWIPVYGIHHDPDIYPNPEKFDPERFS

EDKIKERHSMHYLPFGHGPRNCI

GSRFGTYQTKIGLVKIIRKYKVEICDKTLIPYKFNSFANFLMPSTGLYLMITDVEN*

 

>CYP6AS16P PSEUDOGENE? Apis mellifera

MIANLEIFCGIIVILIAFYYYIRLEQFWKFXGIPGPEPLPGFGNVLMIVLGKEAPFQFLT

RVYNEFKNEALIGVFMKTYPALVVKDPDLIKDIMIKDFYKFPNRGFPKSDS

XNPLTQHLFLVEEEKWRPLRTQLSPVFSTGKLRGTFTQILDCSNHLVTYMDKLVEIGEPID

VREVTAKFTTDVIGSCVFGIKMNSLSGKESEFRRFGRQIFAMNFLKILRLRIKQFLPMLHY

LLVRILPPDEETKIMLKLTRDTFKFREAHNIVRPDFMNILMELKKHPEKVPSL

DLTDGLLAAQAFIFFAAGFETSSTTVANTLYELALNPDIQEKLRQEIKEFEANNDGEWKYE

TIQEMKYLDKTFK

ETLRKYPVLPYLSRRSIEDYTFEGTKVSIPKNTLICIPVYPIHHDSSIYPNPEKFDPERFS

EDEVKKRHSMHYFPFGHGPRNCI

GLRFAIYQSKIALIKILSNYKIEICDKTLIPYKYDPFSFISLPLTGIFLKITKLQN*

 

>CYP6AS17 Apis mellifera

MFDYFQILIAFVASFLALYYYLTSNFDFWKNRNVVAPKPIPFFGNTKDVVLKKIEISNFIA

ELYKKYENEAMFGIFFGGSPNLILRDLDLIKDVLIKDFSTFDERGFKISER

ADPLNANLFNMDVTRWRPLRIKLSPVFTSGKLKEMFPLILKCAERLEQCLEDAVKRGGPVD

CFEISARYTTDVIGSCAFGINMNALSDERSEFRRIGKRIFDLDKNILRSFLRQFFPRFYNL

LGFVIPYSETSKFVTKFISEMIKYREENNVVKADFVNLLMELKKHPEKLQNI

KITDNLLAAQAFVFFAAGFETSSTTMAHALYEMALNPNIQDKLRKEIKEFYANNNFTYEEV

KKMKYLDKVFK

ETLRKYPPGVFLKRKCNSNYTFKGTKVSIPAGTSVIIPVYSIQTDPKFYENPDVFDPERFN

EDAVAARHPMTYLPFGDGPRKCI

GIRFGVYQTKVGLIKMLKNFKVNVCEKTMIPYIKKINSFTLAPKDGIFLKIEKNN*

 

>CYP6AS18 Apis mellifera

MFDYFQILIAFVASFLALYYYLTSNFDFWKNRNVVAPKPIPFFGNTKDVVLKKIEISNFIA

ELYKKYENEAMFGIFFGGSPNLILRDLDLIKDVLIKDFSTFDERGFKISER

ADPLNANLFNLDVTRWRSLRIKLSPVFTSGKLKEIFPLILKCAERLEQCLEDAVKRGGSVD

CFEISARYTTDVIGSCAFGINMNALSDERSEFRRIGKRIFDLDKNILRSFLRQFFPRFYNL

LGFVIPYSETSKFVTKFISEMIKYREENNVVKADFVNLLMELKKHPEKLQNI

KITDNLLAAQAFVFFAAGFETSSTTMAHALYEMALNPNIQDKLRKEIKEFYANNNFTYEEV

KKMKYLDKVFK

ETLRKYPPGVFLKRKCNSNYTFKGTKVSIPAGTSVIIPVYSIQTDPKFYENPDVFDPERFN

EDAVAARHPMTYLPFGDGPRKCI

GIRFGVYQTKVGLIKMLKNFKVNVCEKTMIPYIKKINSFTLAPKDGIFLKVEKNN*

 

>CYP6AS19 old CYP6AR1 Apis mellifera AmGroupUn.19 (44801-47550)

MSWLMIETVGLIATVFFLLYYYSMSKLDYWRKRGVKGPKPLPFLGNFKDVLLAKESTMDCFERAYKEFKDEPMVGMYGSHEPLLILRDLDLIKDVLIKDFNKFAQRTQGAIRE(0)VEPLSEQLFRLDAERWRPLRLKLSSFFSSGKLKEMFHLFVECSDNFEKYLEKMVEKGGLVECRDAAAKFSTDVIGACAFSIHTNALTDENSQFRKMGKQALATNLQQFLNDRLREYPFLFKIFGRFFVDHEVTNFFANSIKDAMDYRIQNNVHLRDVIDILADIRENPTKCGLKE(1)ADNLFLTSQAVLFFLAGFENASLTISNALYELAWKPEIQEKARAEIVNVLQKYDGKITYDGLEEMKYLEACIFE(1)TLRMYPVLQWLSREAMETYTFTGTKVTIPKGQQVFLPIYAIQRDPDIYPNPDNFDPERFTDDKIKTRHSMTHLPFGDGPRHCSG(1)IRLAKKQLKVGLVTVLSKFKVEVCEKTRKIYQKDKKPLFLLQPVDGIHLKISKVSV*

 

>CYP6AS20 Philotrypesis pilosa CYP6AS20 EU660213

EMFYLLEECAEHLDSFLEEQVRRESVIECRDLAAKFTMDVIGVC

VFGLNMNAIAEEDSEFRKIARKIFSVSTLSFLQNQLRLVVPWFLDLLSPIFYDKQMNE

FFIGSITQTMEYRRRSNEKRNDFIDLLMAIKDDPSKVNDIELTDPFPTAQAFVFFLAG

FETSSTTMSNALYELALNKNIQDKLRAEITDVLEKNDNKLTYDNIKSMKYLDKIVKES

LRKYPPGSLLRRISLSPYTFSGTDVSIPKHTPVLIPVWAMHRDPEIFPNPEEFDPERF

NEENEKNRHPMHYLPFWAGP

 

>CYP6AS21 Philotrypesis sp. YL-2008 CYP6AS21 EU660214

EMFYLLTECADNLEHYLDGLVKRNPVIECRELSAKYTTDVIGVC

AFGLKANSMGDEDGEFRRIGRKIFAMPWPKFLKMRLKESMPWLFNICSPIFYDHEMNG

FFLNLMRETIDYRKKNNVRRNDFVDLLIDIQNDPSKIGDIELTHELLTAQAFVFFIAG

FETSSTTMSNALYELALNKNIQDKLRAEIIDVLEKNNNKLTYDNIKSMKYLDKVVKES

LRKYPPGSLLRRISLSPYTFSGTDVSIPKHTPVFIPVWAMHRDPEIYPNPEEFDPERF

NEENEKNRHPMHYLPFSAGP

 

>CYP6AS22 Philotrypesis sp. 1 YL-2008 EU660212

FFIAGFETSSTTMSNALYELALNKNIQDKLRAEITDALDKNDNK

LTYDSIKSMKYLDKVVKESLRKYPPGSLLRRLALSPYTFSGTDVSIPKNTSVLIPVWA

IHRDPEIYPNPEEFDPERFNEENEKTRHPMHYLPFSAGP

 

>CYP6AS23 Philotrypesis sp. 4 YL-2008 EU660209

FFAAGFETSSTTMSNALYELALNKNIQNKLRAEITDVLDKNDNK

LTYDSIKSMKYLDKVVKESLRKYPPGSILRRIALSDYTFSGTDVSIPKHTSVLIPVWA

MHRDPEIYPNPEEFDPERFNEENENNRHPMHYLPFTAGP

 

>CYP6AS24 Philotrypesis sp. 4 YL-2008 EU660210

FFAAGFETSSLTMSHAMYELALNPDIQDKLREEVNATYAANDGK

LSYNGINSMTYLDKIFKETLRKYPPASTIQRKAANDSIFTGTKIFIPKGTLIKIPIGA

LHYDPKYYLNPGKFDPERFDKNAAKSINQMSYLPFSAGP

 

>CYP6AS25 Philotrypesis sp. 5 YL-2008 EU660211

FFTAGFDTSSMSMGSAMWRLAMNPDMQDRLREEVCATYAENDGK

MTYDGIKSMTYLDKVVKEILRIHCPVMLMQRRSMSDHIFTGTKVFIPKGTMVMIPIGA

LHFDPQYYPDPYKFDPERFDKDAKRKINPMSFLPFCAGP

 

>CYP6AS26 Solenopsis invicta (Lausanne fire ant) EE143495.1

YARLRSTQMDITKFFTRIVVETMDYRDTHNVVRNDFIDKLRELKKHPEILGDIPLTDSLI

ASQAFVFFLAGFETSSTTMSNALYELALNRKIQDKLREEITETYLKHGENLTYENIKEMD

YLDKIFKETLRKYPPVAILMRRSMTSYTFEGTNVSIPKNQRVWIPAYAIQRDPNIYPKPD

VFDPERFTDEAVQSRHPMSYLPFGDGPRNCIGARFAVHQTKVGLIKILRNYKVETCEKN

 

>CYP6AS27 Nasonia vitripennis (jewel wasp)

MTLGFFEVAAGLVVLGLAVYYYFTSNMDFWSSRGVKGPKPVLLFGTTRDLVFG

RMSIAQHTTLTYEAFQGQPLVGLFTNQKPILMVRDPELIKDVLIKDFSVFSYR

GLPIASKAEPLSQHLFLLEPKRWRPLRQKLSPTFTSGKLKDMFYLLRECAEHL

GSFLEDFVEKNPVIECRELAGKFTTDVIGVCAFGLNMNAIAEDDSKFRKIARK

PFDSSTLSLMKNYLRFAAPWLMDLLSPIFYDRELNDFFIGTITQTMEYRKKSN

VKRNDFIDLLMAIKDDPSKLNDIE LTDTLLAAQAFVFFIAGFETSSSTIS

HTLYELAQNQPIQDKLREEIVEGLKSHNGELTYESVKSMKYLHKIFCE TL

RKYPPLSVLQRCSLEPYTFAGTKVTIPENTLLWIPAHAIQHDPENYPEPEKFD

PDRFEEENVKHRHPSLYLPFGDGPRNCIG ARFGIYQTKVGLIQILKSYKV

EVCAETCIPYVVDPKKFLLTPLDGIKLKFRKVVDK*

 

>CYP6AS28P Nasonia vitripennis (jewel wasp)

IKATRLYTTALLGLFEVAAGLVALGLAVYYYLTSNMDFWSSRGVKGPKPRPLF

GSTLDFAIGRMSLLSPVFHDRELNDFFIGTISQTMDYRKKNNVERNDFIDLLM

AIKDDPSKVGDIDT MTDTVIASQAFIFFLAGFETSSSTISHTLYELAQNQ

AIQDKLREEIVEELKIHNGEITYESVKGMKYLHKIFCE TLRKYTPLSVIQ

RNSLEPYTFSGTKVTIPKDTELWIPIYAIQHDPDIYP*PEKYDPERFDDENMK

QRHPSFYLPFGDGPRNCIC ARFGNYQTKLGIIQVLKNYKVEVCDQTRIPY

TIDPKQFLLAPIDGIELKFRKI*

 

>CYP6AS29 Nasonia vitripennis (jewel wasp)

MSGLFEVAAGLIALGLAVYYYLSSNLDFWSKLDVKGPKPVPLFGTTSDVLLGR

LSLFQYAAREYGRFRDEPLVGIFSYRKPILLLRDPDLIRNVLVKDFSVFSCRG

MKAATKAEPLAQHLVFLEPERWRPLRYKLSPAFTSGKLKEMFYLLKECAQHLD

RLLEDCVARDPVIECRELAGKFTTDAIGVCAFGLDMHAIDGEDNEFRKTSRKM

FSTSILNRIRIHLKITAPWLLDLLSPIFYDREMNDFFIDTVAQTMDYRKKNGV

KRHDFIDLLMDIRDNPSKVNDIE ITETLIASQAFVFFLAGFETSSTTISN

ALYEMALNPSIQDKLREEILEELKKHNGEMTYESIKGMKYLHKIFCE TLR

LYPPAGLLSRRSLEPYTFAGTKVTIPKNTSVVVPIFGIHHDPEIYPQPDKFDP

ERFDEEAVNHRHPSFYLPFGDGPRNCIG SRFGTYQAKVALVQILKSYKVE

VCDQTVIPYVIDPKTVILLAPRGGIKLKFKKIK*

 

>CYP6AS30 Nasonia vitripennis (jewel wasp)

MEFSAFELLTALALLFLAIYYYFTSTYDFWSSRHVEHPKPELFFGNFKKMMLG

KSSLGDYLYEQYQYYKNEPMFGLYARRTPVLVVTDPEYIKDVLIKDFSSFSDR

GMTIHEKVEPLSQHLFSLEPARWRPLRIKLSPTFTSGKLKEMFYLLAECGNSF

ETLIDNMVKKNPVIECRELTAKFTTEVIGICVFGLKAEAMADGDSEFRKIGRK

VFENSWMKFIKFRIRDAMPWLFNLLGPFFYDHELNGFFINLMKQTMEYRKKNN

VRRNDFVDLLMDIKDDPSKVGDIE MTDALITAQAFVFFIAGFETSSTTIS

NALYELALNPSVQEKLREEIIEELANDNGSLKYETIKGMKYLHKVFCE TL

RKYPPVTVMMRKSMQPYTFSGTKVTIPKGMRVWIPAYAIQRDPAIYPDPDTFD

PERFSEESIKQRHPSFYLPFGDGPRNCIG ARFANYQSKIGIIQVLRNYKV

QVCDKTCIPYVNDPRAFLLAPIGGINLKFTRL*

 

>CYP6AS31 Nasonia vitripennis (jewel wasp)

MGVGILEILAGIGLLFLACYYYFTSTFNYWQSRGIPGPKPAPIYGNLKDIMFG

KMSVGDFVKQEYDKFKDKRMFGIYAIRTPVLIVNDPELIKDILIRNFSSFANR

GVRLFEKVEPLSANLVNLEAKRWRPLRAKQITMFTFSKLKEMFYIVSECADNL

EKILAGMIEKNDVVECCEVSARYTTDVIGACVFGIDMKALDDENSQFRRVGRK

FIHADKWRAFKLRFKQIFPSLYNLLCPIMYDHEINDFFINTMIATMKHRKENN

VRRGDFVDLLNDLKDNPGKLDGIE LTDTLLTAQAFAFFFAGFDTSATTMS

HALYELALNKSIQNKLREEIKEDLAENNGKLLLESLKNMKYLDKVFNE TL

RKYPVTTILTRQAMESYTFDGTDLTIPKDTKVWIPVYGIHRDPKIYPNPDTFD

PERFDEEKVQERHPSYYLPFGAGPRNCLG ARFGNYQTKVGLITILKNYSV

DICDQTPIPYVSNRRRFLLGPAAGIRLKFTNLS*

 

>CYP6AS32 Nasonia vitripennis (jewel wasp)

MEVGTLEIIIGLSVLSFIFHYYLTYHFDFWKKQNVVGPKPIPFFGNVKEILFG

EIHAGLLMKRYYDQYKSEPMIGIYGNRTPSLILKDPSLIKDVMIRDFNVFPDR

GFYVNAKADPVNQNLANLEHARWRPLRTKLTPIFTSGKLKEMFYLLVECANSF

EKYVEKLIEKDEPVEVRELTSKFTIQAIGVCVLGLDTKALEENSQFRTYGRAL

FVPTIVNVGRILLQQLAPWIYESLGPFKTSEPVRFFAKSTKEIVEYRRKNKIR

RNDFVGLLMDLQDQPNTLSNID FSDEFLAGQILAFFAAGFETSSTTVSNA

LYELAFNQNIQDKLRNEIREEIERNNGQLTYDSIKRMKYLDKIYKE TLRK

YPPGSIIQRRSNAQYTFTGTKVTIPANTTLIIPVWAIHRDPDLYPDPDIFDPE

RFNEDNESSRHPMNYLPFGDGPHNCIG VRYSNYQTKVGLIAAINKFKVNV

CDKTCISYQVEPRAIFTAPVGGIYLKISKVL*

 

>CYP6AS33 Nasonia vitripennis (jewel wasp)

MELGVVEILIGMALLFLGFYYYLTSNFDFWKKRQVLGPKPIPIFGNFKDVILG

NINPALLVQKFYDEFKNEQFIGLFSRSSPSLMIKDPDLIRDVLIKDFNVFADR

AVASIPKNDPFSENLLNLEHERWRPLRNRLSPIFTSGKLKDMFYLMVDCAQNL

EEYVNELVKKDQPVECRELSAKFTTDSIGACAFGLNTNALHDENSEFRRFGRD

LFASTLKNKFRRLLRELFPKLYAISGQWLQNDATLFFIRSIKETTEYRKKNKV

RRNDFVDLLMDLQNQPEKLSTFE FTDSLLTAQALVFFIAGFETSSTTISN

ALYELAFHQDEQDKLREEIISELKKNENKLTYESIKSMKYLDKVVKE SLR

KYPPGSILRRTSLAPYTFYGSKVTIPKHTPVLIPVWAIHRDPEIYPNPGEFDP

ERFSEENEKSRHPMHYLPFGDGPHNCIG ARFAKYQTKIGIVAIINKFKVD

VCDKTCRTYFIENRSIIPTPVGGIHLKITKL*

 

>CYP6AS34 Nasonia vitripennis (jewel wasp)

MAFTLVNILLGVGSILVLLYYYVISGFDFWKKRHIPGPKPSLLFGNFKDVILA

KVHQANYLKHIYKSYSNEPVVGVFIWSMPVLVVKDLDLIKDILIKSFDNFADR

GIQIHEDIDPLSMNLVFLEPKKWRPLRQMLTPAFTSKKLKVMFYLINDCADHF

K DLDEPVECRELTAKFTTDVIGVCAFGLNINALSNEESEFRRMGRKMFDV

TWHNRLRHALRLLPHWLARFLKPIARDDKIIDFFVTTFMETMARKKNNIRKND

FVDLLMNVKDSLKQIDDEE MTDLFLTAQAFVFFAAGFETSSTTMSHAMYE

LALNQDIQDKLREEVNATFAENDAKLSYDSVRSMIYLDKVFKE SLRKYPA

ALTLFRKSMNDHSFPGTDISIPRGTCMLIPTYVIHHDPTYYPDPDKFDPERFD

KETANGRSRMTFLPFGDGPRNCIG ERFAQNQSKVGLAMIIRNFKLEVCER

TCKTYIKHEGSPLLAPLDGLYLKLRNI*

 

>CYP6AS35 Nasonia vitripennis (jewel wasp)

MAVGIVEVLLGMGTILLLLYYFMIMGFDFWEKRGIPGPRPIPLFGNFKDVILA

KMHQADYLKSIYENYPKEPAVGVFMWNRPVLVVKDLDMIKDVLIKSFSDFSDR

GIFVIHEDIDPLSKHLVFLEPKRWKPLRKKLTPAFSSGKLREMFYLINECATH

YDQYMQTIV DKKEPVDCRDLAAKFTTDVIGVCAFGLNMNALLNEESEFRK

MGRLIFADSWHNRARRLTRLLPHWSARFLKPIARDEKIIDFFVTTLRETMEYR

KKNNVRKHDIVDVLMDIKENPEQFNDEE ITELFLTAQAFVFFIAGFDTTS

NAMSHAMYELALNPDIQEKLRQEVNATYSENNGKFSYDSVRNMKYLDKVFKE

TLRKYPPAFTLSRKSMNNHSFSGTKITIPKGTSLMIPTYAIHHDPSYYPDP

DKFDPERFDEGNANNRIHMTFLPFGDGPRNCIG ERFANNQFKVGIAMTVR

KFKLAVCERTCKNYVKHARLSTLSPTDGLYLKFKSI*

 

>CYP6AS36P Nasonia vitripennis (jewel wasp)

MEVGAPEILALFGVLLSILHYYLTYNFDFWKKQNVLGAKPFFGKLREVLFGEI

HVGLLMKRYYDEYKTVPMIGFYGIRTPSLIMRDPELIKDVLIRDFNVFPDHGF

YVNPKADPVNQNVFTSGKLREMFYLLVDCADAFEKYVETLTERDEPVEVRELT

SKLLRYQAIGVCVLGLDTNALAEKSDFLQMVSRILLQSLAPRIYEMLGPLKTS

EPVKFFAKSTKKIVDFRRNNKIRRNDFVDLLMDLQDQPDKISNIE FSDDF

LAGQCLAFFAAGFEKSNALYEMAFDQSIQDKLRNEIREEMKKITGSLTYDSIK

RMKYLDK

TLRKYPPGSIVQRRSNASYTFTGTEVTTTADTTLIIPVWAIHH

DPDLYPNPEIFEPERFNEDNEGSRHPMNCLPFGNGPHNCIG ARYSNYQTK

VGIIALINKFKVNVCDKTXMRMEYRVEAPIGGIYLKI*

 

>CYP6AS37P Nasonia vitripennis (jewel wasp)

MEFGVVELLAGIGILFLACHYYLMYGFDFWKKRNVKGPKPVPIFGNIKDVVFG

KINLALLIKLYYDDYKGEPFVGIYRKSSAILILRNPDLIKDVLIKDFNVFPNR

DRIVPPKNDPFSQNIFELEYERWKSLRHKLTPVFTSGKLKDMFYLISECADHL

EKYVEKLADRGGPVECRELTAKYTTDVIGVCVFVLNTNSVSDTDSQFRKAGRD

LMASSFSNTLRGIWKEWLPRLYELLRPYVYNRAIDYFIGSLKETMEYGKKNNI

STRNDFLDLLMDLKDQPDSLSDFE FTNELLTSQAFIFFLAGFETSSATMS

NALYELALNQR*DIKLEIQIIHVYKLKYFILTAWNLIK TIRKYPPGSILQ

PCSVAPHTFAKLSVSIPKGTLVIIPVWAIHHDPEIFPNPELFDPERYTVENEK

NWHPMNYFPFGDGPHNCIG

 

>CYP6AT1 Phyllopertha diversa Cyp6Pd (antennae-rich 507aa Walter Leal scarab beetle (Coleoptera: Scarabeidae), AY605088.1

MLEFYFIDTAILSLITVYLLYKLFTRNFDYWKRKGIPYITPQLFFGNYYDILMFKKTIGHTLADMYNKISGPYFGIWVFNSPHFVAKDPELIKHILVKDFKYFQDRTIASNEEADEIAANILFIMKNPNWRSLRSKMTPIFSSGRIKCMIPFMNKVAEDLVSYLTKLSHQTDSIEAKEVCAKYATDVITSCAFGIEGHSFEKEDAAWRSVGRDMFEFTLSNGFRGTSYFFMPKLVDLFKIRFIPYNVSQFMIDAFLKTMSHRKIENSSRNDLIDILIKLQTEGDFDGYKFEGNRVIAQAAQFFLAGFETTSSTISYALYELCLNKPIQEKVVTEIKSALQQHGSVSYEAIQDMKYLHKVVQEILRKYPVLPFLDRKTTMDWKIPGTNITLEAGTPVYIPMFGLHYDPKYFPNPDVFDPERFTEETTNSRPCFSYIPFGGGPRNCIGERFGLIGTKVALVHILSRFEVECSNETPIPIEFEPKTFTLASKVGLPMRFVDVKRRASYAA

 

>CYP6AU1 Bombyx mori BAAB01129923.1 AADK01004964.1

MLTAYLLYVFASIVVLIYFYLNNKYKYWKNKNIAGPEPEFLFGNLKESFHRRKHIATVFK

EIYDQYPDEKVVGMFRMTSPTLIVRDLDIVKQIMIKDYAKFNERGIKFSKEGLGDNLFHA

DADAWKAVRSHLTPMFSSGKLKNMVRVLSQTGDRFVDHVTNEVRLRPEQELVSLFLKYNI

ATIMACSFSMETDINDMQVYEMLNVAVFENSYISELDMVFPGILRKTNRSIFGPTVNNFC

YEIVEFIKNERNGKPANRNDMMDMLLGVNCDKLKMKNGSEDFVEITEHVMAGQVFVFFAAG

YVNNTITLTFSLYHLAKDQSIQ

ERLMREIETVLENHNNVLTLEAINEMSYLEMIYLETLRMHPTTNTLQRSALEDYTIP

GTDIEIEKGTLVLIPPLAFHHDEKIYPEPEKFDPERFSVENHKSRHACAFLSFGIGPRTCIG

 

>CYP6AV1 Bombyx mori BAAB01020563.1 BAAB01140967.1

MLLLIIVIIILYLYTTRNHSYWAKRGVKHERPIPFFGNHLPNILLQRDNTDLGLQMYNAY

ENEKIVGYYIGNIPQLIIRDPEIIKHMLNIDFNSFSERGLNLNPKKESLLNNLFFVSG

DNWRRMRNIFSGAFTSVKLKAVFPLIVKCTDKLVKKTTMRHVSDEIKTYELMTGYTMEFIAS

CGFGVDVDTISESNMHFVDVARSFFDKTSLQTFMINLDEICSILKIIPGTFEVNSEFNSF

ILNITKKVLAERNFKPSERNDFVDHLLQMVYWNGNEKLTTEADLESDSWFVAAQVFLFLV

AGFETSAVATSVVLHQLAYNQNLQDEVRKEIDSALKKYDNKLCYEAVCEMSLLDMTLKES

LRIQPPAGFIRRRCIKEYKIPGTNIAIDPGVKILIPIKALNHDPKYFDCPSEFRPQRFSP

EAEQNIPKFVYMPFGSGPRTCP

GARLASLQSMAGLASLLHHFVVEPTPNTSRHYKIKRSAFLVQIIEGGIPLYFKPRTNK*

 

>CYP6AW1 Bombyx mori BAAB01195862.1 BAAB01153386.1 CK496233 EST

MWLSVLLVVILLFLILLLTVFHYTTKGRKYWLLRNVPYREPCPLFGNFGATFTMRRSYTK

MLQFFYDNYYNEKYVGIFQARRPTLMLIDLELVKNVLSKEFPNFSDRISVTTDTQREPL

LRNLANMSGAEWKAMRQIVTPTFSSAKMKAMFPLIAECAQTLKNSLLKESLAEVNVPDFMTRFTTD

VIGSCAFGVDPGSLKDPESPFLKMSQKMFKIDRSTVLKRYCRTFFPKLFKFLNLRTYSKD

VETFFTTIIKKVLDERRATGVQRHDFLQLMLNVQKTETSFVMTDTLIISNSFIFMLAGLE

SSSTTLSFCLYEWAKDKHIQDDLRTEMVDCLERYGGINYEAVCSMRWVN

QAVLETLRLHPPTPLTTRLGTSACTLNGTDLSVRVRDPVLIPLYCIQRDAQHFPNPDKFNLERFKETNPPG

FLAFGEGPRSCPGARFAQLTVAAALAALLSSFEIEPCSMTTSTIVYDPRSVMLKNKGGIW

LKFVPL

 

>6AX1 Nilaparvata lugens brown planthopper seq 1 40% to 6AM1 40% to 6AS1

AJ852422

MNAFGYEVSWFDIFFLVVSLVSIIYYFGINTFSHWEKKGIKFMKPVPFFGNT

LDLAIGRQHITTCHQVIYDYFADDAYGGWLANRSPLLMVKDPELIQQILVKDFVHFYDR

GTTVDMKLDPLNANLLNMTGQRWKALRQKLTPAFSSGKLKLMSPQFNECVDDLCGLIDEK

SNKKELIDVQESMSKLATDVIGSCAFGLQFNSLKNPESEFRRMGRDILRPSWRFKVRTFM

RVISDSLPSLLGVKAFDKSKEDFFINLVNDTMKYREDNKVERNDFIQILMNLKKIDENME

IDPNNESHVILDDKLLAANTFIFFIAGFETTATTLTFSMYELAVNQEIQDKLRQEVQTTF

EKYGAINYDSTKDMDYLDRVISETLRKY PIAGSLIRRCTKAWQVPGAKGKLEVGDRVVIP

VYPIHHDPKYYPDPQKFDPERFTEENKRSRPPCTYMPFG DGPRICIGARFALQELKTTLS

SILLHYKLTLNEKSKATLPLKMKPRRILMQSEQEIYINFTKIK*

 

>6AY1 Nilaparvata lugens brown planthopper seq 2 42% to 6M3

AJ852423.2

MIEIGLLIIVCLLIYHYCTATFRYWKQRSVPLVEPTALFGNY

YDVVSLKTSPAACHESIYRNFPNEKYVGMIQLRTPALLIRCPEMVKQILV

KDFNHFMDRGFHADEEREPITAHLVNLQGEKWRMLRQKISPVFTSGKLKAMFPLLETCSS

QLSNYIESALGEQDSSLLEMRDVMARFTTDVIGSVAFGLHFNSFTEKESDFQLMGRRVLD

SSQTSVITKAIRVFFPQLFHFLRLRTFPEEIATFFQTVIHDTIENRERNDVQRNDFIPLL

MQLRKKSPDYDGTEANDLEITESVIAAQAFVFFMAGYETSSTTLSFCLYELAKNLDVQEK

ACNEIKKVLNKHGKLSHEALMDLDYLEMILLETMRKYPPVSVLARVCTKPYTIPGTKISI

DPGTSVAIPVYSFHHDHKYFPDPETFDPERFSKENQEKSINYTYLPFGASPHVEEGTKRR

TGRSGIGLRHLLRLFRFRYVDSTLTADCTQHNDSRLSGFTGDDLDVEGL*

 

>CYP6AZ1 Mayetiola destructor HFP450-1: Hessian fly AY884043

MVFSVSSVLSIIALLIVLAISSLYIY

LKYVYSYWERHGVKSFAGKIPYGNFE

KTIKQKRSVGEVLTDLYRSTTEPFI

GFYGPLKPILLIRDPALVRQILIKD

FQYFANRGIYSDEKNDPLSAHLFSL

DGDKWKKLRYKVSPTFTSGKLKAMF

STLVRCGESLQKVVKSTVEKGEEIDM

RELVACFSTNIIASIAFGWDVDAIT

DSNTPFRKYGRQYFQKSLKNGVRNLA

KFVSPKLMHVLRLKAIDADIEEFFFD

MIRQTMALRENNNVVRKDFFQLLFQ

LRNMGSIQSDDDWETKTISDEEKDKN

LTINELAATAFIFYAAGFESSSSTV

SFCLYELAKNSEMQRIAQRKINAVL

ERHNGQYTFDAINEMKYLGCCVDET

LRKHSPIAMLNREVSQSYKVPGMGLT

LETGTAIMVPVYGIHHDEKYYPNPE

VFEPNRFSVENAKNKTFVEMPYLPF

GDGARNCIGMRLGLMVFKVCLAMLL

KEFNYSLGEQHIGKELEYSPTSFVMA

PIGTLKLKATYRH*

 

>CYP6BA1 Mayetiola destructor HFP450-2: Hessian fly AY884044

MFVLYLLILFGSVCYLWMKFVYSYW

SRTKFPYLKPNIPFGNVSEAAMGKKS

MGINLYELHKSSNEPIIGIYLLFRPA

LLVRDADLAKDMLTTDFANFYDRGI

YHNPEDPVASHMLMLPGQEWKQIRSK

LTPTFTSGKLKGMMPAILNIAEILK

QKLLPSSQKGEIVEMRDLLMRFSLDV

IGTVGFGLDVNTLDDPNHSFREIEK

CVNNGELINRIRLIGAFFCPKILEV

LHMSSLPKEFKEFMMNIVQKTMEFR

EKNQVQQKDFIQLLMELRKPGKLND

NDGTDTIPNDKHSKQDGLTIEQCAA

QVALFYLAGFDTTSSAVSFCLFELSR

QPDLMTRAQCEIDDIMNKYNNNITY

ECLNEMPFLDACVRESVRKYPVLPF

LNGMCTKDYKIPNMDLTITNETPIII

SLLGIMRDPKNFPHPEQFLPDRYDE

KDPKYNPTAFIPFGDGPRSCIGIRM

GKMVAKIALISLLHNYSFICTENRE

LEFDNHSVTLSIKGGINLKVINRQK

KKKKKKKK

 

>CYP6BB1v1 shaoming huang 1/7/05 salt marsh mosquito Ochlerotatus sollicitans

AY896792

MGLLTVLIATLLAAIIALLGYLKWIQNYWERRAIPAAKNTHILTGNMAGMGTKISLAIALQKIYREFRERGLPFGGFNNF

FAPTILAVDPEFVKLVLVKEFNVFHDHGFYTDAESDPLNSHLFNLDGAKWRVMRQKLSPTFTSGKMKMMFNTVQSVADEL

KKFVEANYHREDLEIRDLLQRFTTDVIGSVAFGIECNSFKDPDSKLREMAGKVFELSPKTLVKTFVGIQFKGLARWMKMK

LTDDEVEKFFMELVRTTVESREKSDVQRNDFMKLLLEIKNSGKLSDAPDSGGDGLTMNELAAQCFVFFAAGFETSSTAMN

FCLYELAINEDIQDRLREEINEVLGENGGQLTYDALMKMDYLDRVFNETLRKYPPLDNTFRTNSVDYTVPGTNYTIPAGT

FVQIPMYALQWDPEHFPAPERFDPDRFLPEVVKSRHPYAYVPFGEGPRICIGMRFGVMQAKIGLVTLLQNFKFRVNSRTP

IPMEFEPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v2 salt marsh mosquito Ochlerotatus sollicitans AY896793

only 4 aa diffs to CYP6BB1v1, 66% to CYP6BB1v2 XM_001847349

MGLLTVLIATLLAAIIALLGYLKWIQNYWERRAIPAAKNTHILT

GNMAGMGTKISLAIALQKIYREFRERGLAFGGFNNFFAPTILAVDPEFVKLVLVKEFN

VFHDHGFYTDAESDPLNSHLFNLDGAKWRVMRQKLSPTFTSGKMKMMFNTVQSVADEL

KKFVEENYHREDLEIRDLLQRFTTDVIGSVAFGIECNSFKDPDSKLREMAGKVFELSP

KTLVKTFVGIQFKGLARWMKMKLTDDEVEKFFMELVRTTVESREKSDVQRNDFMKLLL

EIKNSGKLSDAPDSGGDGLTMNELAAQCFVFFAAGFETSSTAMNFCLYELAINEDIQD

RLREEINEVLGENGGQLTYDALMKMDYLDRVFNETLRKYPPLDNTFRTNSVDYTVPGT

NCTIPAGTFVQIPMYALQWDPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPRIC

IGMRFGVMQAKIGLVTLLQNFKFRVNSRTPIPMEFEPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v3 salt marsh mosquito Ochlerotatus sollicitans AY896794

MGLLTVLIATLLAALIALLGYLKWIQNYWERRAIPAAKNTHILT

GNMAGMGTKISLAIALQKIYREFRERRLAFGGFNNFFAPTILAVDPEFVKLVLVKEFN

VFHDHGFYTDAESDPLNSHLFNLDGAKWRVMRQKLSPTFTSGKMKMMFNTVQSVADEL

KKFVEENYHREDLEIRDLLQRFTTDVIGSVAFGIECNSFKDPDSKLREMAGKVFELSP

KTLVKTFVGIQFKGLARWMKMKLTDDEVEKFFMELVRTTVESREKSDVQRNDFMKLLL

EIKNSGKLSDAPDSGGDGLTMNELAAQCFVFFAAGFETSSTAMNFCLYELAINEEIQD

RLREEINDVLGENGGQLTYDALMKMDYLDRVFNETLRKYPPLDNTFRTNSVDYTVPGT

NYTIPAGTFVQIPMYALQRDPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPRIC

IGMRFGVMQAKIGLVTLLQNFKFRVNSRTPIPMEFEPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v4 salt marsh mosquito Ochlerotatus sollicitans AY896795

MGLLTVLIATLLAAIVALLGYLKWIQNYWERRAIPAAKNTHILT

GNMAGMGTKISLAIALQKIYREFRERGLPFGGFNNFFAPTILAVDPEFVKLVLVKEFN

VFHDHGFYTDAESDPLNSHLFNLDGAKWRVMRQKLSPTFTSGKMKMMFNTVQSVADEL

KKFVEANYHREDLEIRDLLQRFTTDVIGSVAFGIECNSFKDPDSKLREMAGKVFDLSP

KTLVKTFVGIQFKGLARWMKMKLTDDEVEKFFMELVRTTVESREKSDVQRNDFMKLLL

EIKNSGKLSDAPDSGGDGLTMNELAAQCFVFFAAGFETSSTAMNFCLYELAINEDIQD

RLREEINEVLGENGGQLTYDALMKMDYLDRVFNETLRKYPPLDNTFRTNSVDYTVPGT

NYTIPAGTFVQIPMYALQRDPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPRIC

IGMRFGVMQAKIGLVTLLQNFKFRVNSRTPIPMEFEPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v5 salt marsh mosquito Ochlerotatus sollicitans AY896796

MGLLTVLIATLLAAIIALLGYLKWIQNYRERRAIPAAKNTHILT

GNMAGMGTKISLAIALQKIYREFRERGLPFGGFNNFFAPTILAVDPEFVKLVLVKEFN

VFHDHGFYTDAESDPLNSHLFNLDGAKWRVMRQKLSPTFTSGKMKMMFNTVQSVADEL

KKFVEANYHREDLEIRDLLQRFTTDVIGSVAFGIECNSFKDPDSKLREMAGKVFELSP

KTLVKTFVGIQFKGLARWMKMKLTDDEVEKFFMELVRTTVECREKSDVQRNDFMKLLL

EIKNSGKLSDAPDSGGDGLTMNELAAQCFVFFAAGFETSSTAMNFCLYELAINEDIQD

RLREEINDVLGENGDQLTYDALMKMDYLDRVFNETLRKYPPLDNTFRTNSVDYTVPGT

NYTIPAGTFVQIPMYALQWDPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPRIC

IGMRFGVMQAKVGLVTLLQNFKFRVNSRTPIPMEFGPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v6 salt marsh mosquito Ochlerotatus sollicitans DQ059299

AVDPEFVKLVLVKEFNVFHDHGFYTDAESDPLNSHLFNLDGAKW

RVMRQKLSPTFTSGKMKMMFNTVQSVADELKKFVEANYHREDLEIRDLLQRFTTDVIG

SVAFGIECNSFKDPDSKLREMAGKVFELSPKTLVKTFVGIQFKGLARWMKMKLTDDEV

EKFFMELVRTTVESREKSDVQRNDFMKLLLEIKNSGKLSDAPDSGGDGLTMNELAAQC

FVFFAAGFETSSTAMNFCLYELAINEDIQDRLREEINEVLGENGGQLTYDALMKMDYL

DRVFNETLRKYPPLDNTFRTNSVDYTVPGTNYTIPAGTFVQIPMYALQWDPEHFPAPE

RFDPDRFLPEVVKTRHPYAYVPFGEGPRICIGMRFGVMQAKIGLVTLLQNFKFRVNSR

TPIPMEFEPASVTLSPKNGMYLQIERVK

 

>CYP6BB1v7 salt marsh mosquito Ochlerotatus sollicitans DQ427072

ETLRKYPPLDNTFRTNSVDYTVPGTNYTIPAGTFVQIPMYALQW

DPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPSICI

 

>CYP6BB1v8 salt marsh mosquito Ochlerotatus sollicitans DQ427076

ETLSKYPPLDNTFRTNSVDYTVPGTNYTIPAGTFVQIPMYALQR

DPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPSICI

 

>CYP6BB1v9 salt marsh mosquito Ochlerotatus sollicitans DQ427083

ETLRKYPPLDNTFRTNSVDYTVPGTNYTIPAGTFVQIPMYALQR

DPEHFPAPERFDPDRFLPEVVKTRHPYAYVPFGEGPRICI

 

>CYP6BB2 Aedes aegypti 1.1327_1 AAGE01011017? CYP6Pae1, 54% to 6BB1, 53% to 6P4, 48% to 6P1

MDPVTVILTIFVGLTGLVYFFLRREQQKWPRLGVPFAKNPH

LLFGNVRGIFQKEHSCEILQRLYWEFKGRGLKLGGIMNFFQPAVLVIDPEISKSILVKD

FNKFHDRGIFVDPAGDPLSANLFSLEGAQWKAMRTKMSPTFTSGKMKYMFESVLNVAERLK

DYLAENCLKEDIELKNILQRFTMDVIGNVAFGV

ECNSIKNPSSEFRLMGLKANRFDGVRFLKFFIGGAYKNFAKKIKLKVVEDDVHKFFMSLV

HSTVHYREGNNVKRNDFLNLLMEIKNKGKFSDEPNSGGEGITMNEIAAQCFIFFTAGFET

SSTTINFCLYELANNPDIQDRLRNEIEDVVAKDGGELKYDTLLGMNYLDRVVS

ETLRKYSAVDNLFRISNSPYTPDGCNFTIPAGTLFQIPIHSMHHDPEYFPDPGRFDPDRF

LPEVAKSRHPYCYLPFGEGPRVCIGVRFGLMQTKIGLVTLLRDFRFGPRSETPDRLQFEA

KTFVLTPQTGIYLKIEPIGI*

 

>CYP6BB3 Culex quinquefasciatus XM_001847349

100% to CYP6BB3 Culex pipiens misnamed in Genbank entry CYP6BB1v2

66% to CYP6BB1 salt marsh mosquito Ochlerotatus sollicitans

MGLLSVVLLALAGAAAILFAFLKRQQHFWRSCGIPAARNPQLLA

GNVAGMASTEHMAITLQRLYREFKQRGLTFGGFNSFFAPTVLLVDPELVKHVMVKDFG

VFHDRGLYVDPEGDPLSGNLFNLEGHQWKVMRQKLSPTFTSGKMKLMFDTVASVAKEL

NQFVDDNCHREDLELREVLQRFTVDVIGNVAFGIDCNTMKNPDSEFRKMGNKAFALTT

TSVIKSFIGIQFRSLAKFMKMKITEDDVEEFFLELTRSTVQMREQNGSQRNDFMKLLL

EIRDQGTFSDAPNSAGEGLTMRELAAQCFVFFLAGFETSSSTMTFCLYELALNPDVQY

RLRKEIKEALNEGGGNLTYEALMKMDYLDRVVSETLRKHPPLDNTFRTNEVDYVIPGT

NYTIPASTFVQIPIYAIQRDPDNFPEPDKFDPDRFLPEAVKSRHPYAYIPFGEGPRIC

IGMRFGLMQAKLGLATLLANFQFSKSSRTSVPLVYDPPSITLGPKGGMYLRIERV

 

>CPIJ005953 CYP6BB3 Culex pipiens 99% to CYP6BB3 Culex_quinquefasciatus 2 aa diffs

MGLLSVVLLALAGAAAILFAFLKRQQHFWRSCGIPAARNPQLLAGNVAGMASTEHMAITLQRLYREFKQRGLTFGGFNSF

FAPTVLLVDPELVKHVMVKDFGVFHDRGLYVDPEGDPLSGNLFNLEGHQWKVMRQKLSPTFTSGKMKLMFDTVASVAKEL

NQFVDDNCHREDLELREVLQRFTVDVIGNVAFGIDCNTMKNPDSEFRKMGNKAFALTTTSVIKSFIGIQFRSLAKFMKMK

ITEDDVEEFFLELTRSTVQMREQNGSQRNDFMKLLLEIRDQGTFSDAPNSAGEGLTMRELAAQCFVFFLAGFETSSSTMT

FCLYELALNPDVQYRLRKEIKEALNEGGGNLTYEALMKMDYLDRVVSETLRKHPPLDNTFRTNEVDYVIPGTNYTIPAST

FVQIPIYAIQRDPDNFPEPDKFDPDRFLPEAVKSRHPYAYIPFGEGPRICIGMRFGLMQAKLGLATLLANFQFSKSSRTS

VPLVYDPPSITLGPKGGMYLRIERV.

 

>CPIJ005952 CYP6BB4 Culex pipiens 56% to CYP6BB2

MELVVSIFGFFIGLSVVVYCYLRRQQSHLHRAGLPVASKPHLVYGNVKGIAQTEHACKVA

QRLYQEFRERGLPLGGFMNFFIPSVLVTDPELVKCVLVRNFDVFHDRGLFADTESDPISG

SLFSLDGTHWRAMRQKLSPAFTSGKMKHMFGLMVDVAEQMRRFMDTNCHRADRLEMKDAL

QRYSIDVIGNVAFGVECNSMENPDSEFRRMGTKAFQFDTVQRLKFFFGGRYKALMKGLGL

KVFPGDVSGFFRKLTASTVEYREKSGVRRNDFINLMLEIRNKNGEEGLTMDELSAQCFIF

FTAGFETSSATMNFCLYELALNPFIQNRLRHEIEQVIGKDNDGFTYEKMLSMDYLDRVVK

ETLRKYPPAESLFRISAAPFAVPDTKYVIPANTFIQIPVYALHHDPHHYPHPDRFDPDRF

LEEAVQKRHPYSYLPFGEGPRNCVGMRFGLMQVKVGLVMLLRHFSFAPNAQTPLKIEFDP

EFVILAPTKGMYFDIEPVSRNKLVQA*

 

>CYP6BC1 Apis mellifera

MWNIIRELLEQFLLPGLFLGILYCFLTSTFDFWKNRGVPFRKPTVLFGNFAPMLLFRKSLP

EGIKEMYEWFKDERYFGAFRVRSPVLILRDPDLVKNICVKNFTSFSNRGIPVNSQ

DPLSAHLFNLEGKKWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFEKLIDISSETDRPYEI

RELAAKFTIDVIGTCAFGIQINALTDEESEFHRAAKKLSKPSYKATLWRMLRTAMPRLYKF

LGVQVIDPGVTKFFKDVVSQMIKQRGEYGIKRHDFMDLLIELKNKGTLDEFG

KLDENSIAAQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAIDSRNGNLTYD

AVQDMKYLDMVIA

ETLRKYPPASMLSRRCEYQYQIPNSKVELPAGIRVIIPIYGLHHDPDYYPSPAIFNPERFT

EENKRTRHPYAYLPFGEGPRNCI

GMRFALLQIKVGIISFLRNHRVETCQKTITPIKFSRRSLVTTSEKGFWLRIK*

 

>CYP6BC2 Nasonia vitripennis (jewel wasp)

MLSLIKDCLWEPLPIVLIMLGYALYAFLTSTFDYWLVRGVPYRKPTPLLGNFG

DLLLFRKSQPEGISEMYNWFGNERFFGVFRVRSPILIVRDPELIKCVCVKDFH

VFCNRGIPVNSTKDPLSGHLFNLEG KHWKSLRSKLTPAFSSGKLKNMFYL

LVECSDDLTRLVERRLEI FPDASIVEVRELAANFTIDVIGSCAFGIQINA

LSDEDSEFRKAARRLSKPSYKATLWRMLRTSMPKLYKLLGVQ VIDPSVTK

FFMDVVSQMVKERENKALKRHDFMDLLIELKNRGTLELDNG LDENTIAAQ

AFVFFVAGYETSSNTIAFCLYELAVNPEIQEKARRDIIDALDKRDSKLTYDAV

QDMKYLDMVILE TLRKYPPAPLLSRRCEYPYKLPGSDVELSKGMRVVIPI

YAIHHDPKHYPEPDKFRPERFGDEEKRARHPYTFLPFGEGPRNCIG TRFA

LLQTKVGVITFLRKYQVEVCEKTDIPIKFSRRSLVTASETGVSLNISRLSE*

 

>CYP6BD1 Apis mellifera

MAMQNSLFMPIIFSIAFFVIILILYLKYTRTYWLRRGVPTVPGHWLFGNIKKILDLKKPPA

YVISDIYQKCSENDDILGIYIFFKPFLLIKDPAIIKQILIKDFNYFPDRNFTIQSFYDEIG

NKSLFTLKNPQWKYLR

TKLSPIFSSAKVKKLFHLMVEAANSMNKYLDDEFSNDTKTKTIMIKDVTLKYTTNVISSVA

FGIQVNSFNPKTIQFYEE

AQKGLKTTFSRSMQLCISFFFPKLSPYLNTRMLGSSTNFFRKVFWNSMDNREITKTKREDL

IDSLMELKNAKQDKDF

KFEGDALLSQSAIFFIAGRETSISIICLTLYELAKHPEIQKRTREEINEKLKEHGMTYEGV

QSMKYLHQVVSEILRIYPPTPIIDRVAVADYK

IPGTDIVIEKGTSVFIVLTALHNDPKYHPDPLRFNPDRFSDENKENIKPFTYIPFGEGPRICI

GARIGQLQSIIGLITIIKNYEISFISKCKGDLDVRNIFITPINDFSLNLTKI*

 

>CYP6BD2 Nasonia vitripennis (jewel wasp)

MLDPSFLVNLVTVLAMLLTTFYLWARYKQSYWSRRGIPTAPNSHWLFGHFRDA

IFMRSAPPTLLGELHKSCPSDEPILGVYIMQKPFLLLRNAELIKQLLVKDSQY

FPNRYFASKRKSDVIGSQNLFSVDNPMWKYLRVKLSPAFTTGKQKRLFELMLE

SSQNMSKYLEANLPKDGTEIDMEMRRVSSKYTTDVISSLAFGIKTDSFTEPEA

EFYLRS RKLFEQSIINTLKLFYNFFFPKLNDIVGSSFLGAEEDYFRKIFW

ESMNQREKSGVSRGDAMDLLLELKNLKQSKEFR FEGDRLVAQSVILFAAG

LETSATTMSFTLLEIAKQPEIQRKVREEIRDKLNGKPLTYERISEMNYLHQVV

SETLRLYPPAPLLDRVAIDDYK IPGTDIVLEKGSVVYVALNGVHRDPDYH

SDPLTYDPDRFSEMRKKDMKPCTYMPFGDGPRICIG MRTGMLQTMVGLIT

LLSQYEVKLNPMYKNEISKRAIFLAPANGIHLYIKRSPIM*

 

>CYP6BD2-de4b Nasonia vitripennis (jewel wasp)

IPGIDITDERETVIYVALNRLYNGPDYYADPMTYDPDRLSKS*RRI*KFLATW

PFGSGQRVCIS

 

>CYP6BD3 Nasonia vitripennis (jewel wasp)

MNFDLLSVLSYIVLLALSAFTLFYMYAKQKQTYWSKRGVYSPPCHWFYGHFRD

AFLMKKSFPQAFGEMHNLVDSSIPVVGVYVMQKPFLLLRNPEVIKQVLIKDFN

VFCNRYFAAQRKTDVIGSENLFSIKYAQWKYIRSKLSPAFSSGKLKRYFQLML

ESAANTRNYLKSQIPDGEKVTIECRKLSNKYTTDVISSFSFGIKTNSYVEPEP

EFYLRS RKIFQLGLVRTLQILTTFFFPKISDYLMGSMLGDSNDFFRNAFW

ESMNERKESGIKRGDIIDFLVELSNEKQSQEFK FEGDHLVAQSAILLVAG

VETSAVTIGFTLLELAKHPEIQRRVREEIREKLCKDGQLAYEDVAVMTYLSQV

ISETLRLYPPAPLIDRLASEDYK LPGTDIVIEKGTAVYAALKAGLHEDPH

YHPNPTKFDPDRFSEERKNEIQPCTYMPFGEGPRVCVG MRIGQLETMVGL

ITILSEYEVSLNPQHITELNVRALFLAPADGIKLYFQRIKTCQ*

 

>CYP6BD4 Nasonia vitripennis (jewel wasp)

MTFECLNCITNAALLFVFIITILYLYCKYRLSYWNRHGVKSLPTHLFFGNFKD

TFTFKKPPGQVIQEIYEKAAFNEPYIGFYIFHEPKLLLRDLYLMKQLMVKDFD

VFPNRCFGGESQKDSVGLVNLLGIHQPRWKYLRQKLTPSVTGFKLRAMIPLIK

ECGAPLLKFVENAKSQSDGWKELELKDISSRYTTDVIASLAFGISTNSFDDND

VSFWEAG QKILSGAKRGIILIILFFLPGLIKFIENFMVGPAKYFRLIFWD

SMNTREKTGIKRGDMIDHFINLKNGEQISEYK FEGDNLLSQAVSFYVAGF

EASSTAIAFSLYELSLHREYEERLYKEIKDHLTGKELTIDLINEMTFLDQVVN

EALRMYPPLPIVDRVAVRDYK LPGSNVTIQKGTPIYISVTGTNRDPKYFE

KPNEFIPTRPRLETADLPSSSLAFGMGPRSCVG QRLGLIMTKMALITILS

EYTLANDKKNDKALLKPITVFTAAADGIHVKLKKRN*

 

>CYP6BD5 Nasonia vitripennis (jewel wasp)

MPGLLVSLALLGLVLLAFRFYARYKLDYWKRRGVEQLPQSNVVFGNFKDAVLF

QTAPGWHLGVLHKSAVNQDAPFLGFYIFHKPCLLLRDPEIIKQIMIRDFDNFS

DRHFAGSQQKDSIGMKNLFGLKNPAWKYLRSKISPTLARGKLKQMLPLMMQTG

KPMMEYLEAQGIDANNEKMIDAQELNYKYATDLIANVALGTPMDSFHRPNEEF

SKAV YQFFHGFKRMIALVTVFFVPELVELIGPSLLFNSKFVRKVFWNAVN

SREKNGEKRGDFIDSLIQLKNGEQNPVYK FEGENLLYQSGTFFSGFESSS

TTTAFTLMELAAHPEIQERARQDIERAIEEHGMTYEAFNDMKYLDQCLAEGVR

LHPPVSTIDRYTRQDYT IPGTDIVIEKGTAIYISLYGLQEDPRFFTRPSV

FDPERFADDRKVSDAFIPFGIGPRMCVG MKAGQLHAKVVLAMILREYTVT

QRPENKLVLDPRSTFTAAADGINLHFRKNIK*

 

>CYP6BD6 Contig_933_FL Manduca sexta sent to genbank

68% to CYP6BD5 Nasonia vitripennis (jewel wasp)

MEILTNALSQNGIIYFGLPVVCLLIYLYCCYKLNYWKRRGVPQLKDQNLLFGDFKDGILF

RTAPGYHLGEIYRRAPANAPYVGFYIFHKPCLLLKDPELIKQILTRDFDNFSNRHFAGPQ

QKDSIGMQNLFGLKNPAWRYLRKKISPTLSTRAKLRQMLPLMMETGEPMMGYLKEKVATN

NESKVIDAQDVNYKYTADLIANVALGTKTDSFTYPDSDYSKXLMNFFHSFKRMVALVTVF

FMPELVDMIGSPILFDSSFVREIFWKAVESREKDGKKRGDYIDSIISLKNGEQDPLYRFE

GDNLFYQSGTFFSGFESSSTVSAFTLMELAKNKAYQDRARADIKRAIDKYGWTIEAFNDM

KYLDQCIAEGVRLHPPVSTIDRYTHRDYKIPNTDVVIEKGTPIYISLYGLHGDHDHFDQP

EVYDPERFTDDRVVSEAYVPFGLGPRKCVGMRVGQLHVKVVISMILSEYEVYQKQAEVAK

LDTRSTFTAAADGIHMKFMKLEK

 

>CYP6BE1 Apis mellifera

MFLTTWLIPDIIAVASLITVGLYFYYKLYLFKFWHKKGIFYVKPSFPTGNIMPIINGKLSL

AEFFRDIYEHNKHHRLVGIYMLYKPYLIVNDPNLIRDILTKEFTNFHDRGIFYNEEVDPLS

GHLFQLPGKKWRNLRVKLTPTFTSGKIKQFFPILNEAGNILAKYLEEEARKGSTIDVKDIF

ARYSTDIIMSVAFGISCDSFKEPNNEFRYWGKKIFDPKPLWNALILFAPQILNFFSIS

YTEKSVTKFFTNMFKQTVKYRESNNIERKDFLNLLIQLMKNGYVDADDESLSNNVNAA

KNKLTMMEAAAQAYVFFLAGFETSSTTVTFCLYELAKNQDIQNKVREEIQTMIKKNGDLTY

NALNDMNYLHKVIS

ETLRKYPPVVILNRICTNDVKLSTTDFCIPKGTCIAIPVFGLHRDSNIFPNPEKFDPERFS

EENIKTRHPYVYLPFGEGPRICI

GLRFGLIQTKIAIINALLKNKFKFGPNTPSTLEFEKGSLILIGKGGIHLNIEPI*

 

>CYP6BF1v1 Plutella xylostella (L.) (diamondback moth) (error in name, was called 6BG2) AY971374

MPYLDVAVALLAAFIAFTLWTNRRWNYWKKQNVKYLTPIPFLGNVADVIFQRD

TFGAVTQRICQQFPDEAVVGMFYCSNPAALVQCPDMLKTVMVKDYAYCSSKEVSVHSHKE

PMTKNMFFTFGDKWKLIRQNLTPVYTSAKMKNMFPLVQDCCRIFQKVLDDEIGKGRGVEV

KSLIARYTMDCITSCAFGVDSGTMSKGEEGNPFTETGHLLFDERPIAGVKNVLRYGYPSF

FYSVGLELYSSKIYRFFRSVILDVINSRNGAKSSRNDMVDLISDWKKNKYITGDSIDNGI

DGGNKKVRIEVDDELLVSQCVLFFQAGFQPSALTSAYLLYELAKNQDIQERVLAEVDEYW

STRDEVQTDCVTALPFLAQCMEESLRMYPPVSVLMREIYKDYALPNGVHLKKGMMIHIPV

YHLHHNPKYFPEPEVFRPEPEVFRPERFSEEGRKNIVPYTYLPFGEGPRMCIGYRFARLE

IFSSLAVLLKKYRVELAPHMPRKLQFLTTSRVLTSVHGIHLRLVDRVN*

 

>CYP6BF1v2 Plutella xylostella DQ088989

MPYLDVAVALLAAFIAFTLWTNRRWNYWKKQNVKYLTPIPFLGN

VADVIFQRDTFGAVTQRICQQFPDEAVVGMFYCSNPAALVQCPDMLKTVMVKDYAYCS

SKEVSVHSHKEPMTKNMFFTFGDKWKLIRQNLTPVYTSAKMKNMFPLVQDCCRIFQKV

LDDEIGKGRVVEVKSLIARYTMDCITSCAFGVDSGTMSKGEEGNPFTETGHLLFDERP

IAGVKNVLRYGYPSFFYSVGLELYSSKIYRFFRSVILDVINSRNGAKSSRNDMVDLIS

DWKKNKYITGDSIDNGIDGGNKKVRIEVDDELLVSQCVLFFQAGFQPSALTSAYLLYE

LAKNQDIQERVLAEVDEYWSTRDEVQTDCVTALPFLAQCMEESLRMYPPVSVLMREIY

KDYTLPNGVHLKKGMMIHIPVYHLHHNPKYFPEPEVFRPERFSEEGRKSIVPYTYLPF

GDGPRMCIGYRFARLEIFSSLAVLLKKYRVELAPHMPRKLQFLTTSWVLTSIHGIHLR

LVDRVN

 

>CYP6BF1v3 Plutella xylostella DQ098153

MFYCSNPAALVQCPDMLKTIMVKDYAYCSSKEVSVHSHKEPMTK

NMFFTFGDKWKLIRQNLTPVYTSAKMKNMFPLVQDCCRIFQKVLDDEIGKGRVVEVKS

LIARYTMDCITSCAFGVDSGTMSKGEEGNPFTETGHLLFDERPIAGVKNVLRYGYPSF

FYSVGLELYSSKIYRFFRSVILDVINSRNGAKSSRNDMVDLISDWKKNKYITGDSIDN

GIDGGNKKVRIEVDDELLVSQCVLFFQAGFQPSALTSAYLLYELAKNQDIQERVLAEV

DEYWSTRDEVQTDCVTALPFLAQCMEESLRMYPPVSVLMREIYKDYTLPNGVHLKKGM

MIHIPVYHLHHNPKYFPEPEVFRPERFSEEGRKSIVPYTYLPFGDG

 

>CYP6BF1v4 Plutella xylostella (L.) (diamondback moth) AB236319

MPYLDVAVALLAAFIAFTLWTNRRWNYWKKQNVKYLTPIPFLGNVADVIFQRD

TFGAVTQRICQQFPDEAVVGMFYCSNPAALVQCPDMLKTVMVKDYAYCSSKEVSVHSHKE

PMTKNMFFTFGDKWKLIRQNLTPVYTSAKMKNMFPLVQDCCRIFQKVLDDEIGKGRGVEV

KSLIARYTMDCITSCAFGVDSGTMSKGEEGNPFTETGHLLFDERPIAGVKNVLRYGYPSF

FYSVGLELYSSKIYRFFRSVILDVINSRNGAKSSRNDMVDLISDWKKNKYITGDSIDNGI

DGGNKKVRIEVDDELLVSQCVLFFQAGFQPSALTSAYLLYELAKNQDIQERVLAEVDEYW

STRDEVQTDCVTALPFLAQCMEESLRMYPPVSVLMREIYKDYALPNGVHLKKGMMIHIPV

YHLHHNPKYFPEPEVFRPERFSEEGRKNIVPYTYLPFGEGPRMCIGYRFARLEIFSSLAV

LLKKYRVELAPHMPRKLQFLTTSRVLTSVHGIHLRLVDRVN*

 

>CYP6BG1 Plutella xylostella (L.) (diamondback moth)

Seq 1 of bautista 62% to 6AE1 69% to seq 2 58% to Li's seq CYP6BF1

1 aa diff to AB372008

DEVDSYLSTRSEVGYDCTTELPFLEQCIEETLRLYPVLPVVTREVVEDYKLPSGLTLEK 179

180 GLRVHIPMTHLHRNPKYFPDPDEYIPDRFSPENKKNIVPFTYFPFGEGPR

 

>CYP6BG1 Plutella xylostella (L.) (diamondback moth) AB372008

PVPVVQDPALLKLITTKDFYYFNGREVSEHTHKETLTRNLFFTY

GDKWKVLRQNLTPLFSSAKMKNMFPLIEKCTHDLEKLLDEQSKSNKSGVDIRSVISRF

TMDCIGACAFGINTGVMQKDSEVNPFRQIGDKIFEVSIIRGFLTAFRSIWPSLFYSLR

LSMFPPQIPAFFHSVLMTVFKERSLTASSRQDFVDMILALKKSNYITGDSVNNMKGGN

DKLQIKVDDEFLVAQCVLFFAAGFETSSTTSSFTLFELAKQPELQQRVIDEVDSYLST

RSEVGYDCTTELPFLEQCIEETLRLYPVLPVVTREVVEDYKLPSGLTLEKGLRVHIPM

THLHRNPKYFPDPPEYIPDRFSPENKKNIVPFTYFPFGEGPRICIGMRFAKMQMMAGL

VTLFKSYRVELAPDMPTEVSYSSTAMVTQFTTGIKLILVPRVKNAN

 

>CYP6BH1v1 Leptinotarsa decemlineata (Colorado potato beetle) DQ117461

CYP6(R1v1)|Sequence 1 ORF:67..1548 Frame +1 39% to 6N3 potato beetle

MNYLLELLIFLVTLSISVTIFVHYRYGYWKRRNVPYLKPIFPMGNNTSIFPKGISLGIISKYFYDEFTKM

GCKIGGVFFGIDPQLVIVDPDVAKDILTSDFGYFVARGVYKTSSDPTTVNLFTQDGFEWRTARAKSTSLF

TSAKMRKFLETMSKCADEMAASLEQNAIENSDVKMLEVMACFTTDVIGSAVLGLNCNSFKDPNAEFRNIG

RQLFDEFTLMDTIKIFLTISFPKLCEKIGVSNIQPEVSEFFCRTVKDLVKYREDNNLIRSDFLQMLIDMK

NSTNQLTMDEIIGQVFIFFSAGFETSSTTATLTLFELSQKPEIQNKLRGEIEECMEKNDNRITYDALMGM

PYMNAVVEETLRKWPSVTTLTRVCTKDYTFRDSGITIQKNTNVIIPVLGFHRDSNYHPKPMEFDPERFMN

KNSSYPGYLPFGEGPRMCIGMRFGQMQVKLGLLTILRKYQVYPSPKTSLPLEIDPDTFVLHTKQPIYLKL

KKL*

 

>CYP6BH1v2 Leptinotarsa decemlineata (Colorado potato beetle) DQ117462

MNYLLELLIFLVTLSISVTIFVHYRYGYWKRRNVPYLKPIFPMG

NNTSIFPKGISLGIISKYFYDEFTKMGCKIGGVFFGIDPQLVIVDPDVAKDILTSDFG

YFVARGVYKTSSDPTTVNLFTQDGFEWRTARAKSTSLFTSAKMRKFLETMSKCADEMA

ASLEQNAIENSDVKMLEVMACFTTDVIGSAVLGLNCNSFKDPNAEFRNIGRQLFDEFT

LMDTIKIFLTISFPKLCEKIGVSNIQPEVSEFFCRTVKDLVKYREDNNLIRSDFLQML

IDMKNSTNQLTMDEIIGQVFIFFSAGFETSSTTATLTLFELSQKPEIQNKLRGEIEEC

MEKNDNRITYDALMGMPYMNAVVEETLRKWPSVTTLTRVCTKDYTFRDSGITIQKNTN

VIIPVLGFHRDSNYHPKPMEFDPERFMNKNSSYPGYLPFGEGPRMCIGMRFGQMQVKL

GLLTILRKYQVYPSPKTSLPLEIDPDTFVLHTKQPIYLKLKKL

 

>CYP6BJ1v1 DQ117463

CYP6(R5)|Sequence 1 ORF:52..1584 Frame +1 46% to 6M1 potato beetle

MVFSTDNLLLDLFGVLVALSAVLFVYIKRSFQYWDRKGVPYLPPNIPWGNLQPPHSRDIPEGDDVANIYY

KAKAKGWKYIGIYVMTGSVFLPVDLELIKHITTKDFQHFVDRGTYVNEKDEPITAHLFSIGGKKWRNLRT

KFTPTFTSGKMRQMFETIANCGHILEKYIEHEVDHHEPLDIKNVLACYTTDIIGSCAFGLDCNSFKEPNS

PFTQFGQRVFRTDGIRNLKITFMGAFPNLSKMLRMRLTEKEVEDFYTKVVEDTVRYREKEGVTRPDFLQM

LIDIKNKTNEHTGDGTSLTMDEIVAQSFVFFIAGFETSSTTMTFALYQLATHPEIQEKVRSEINSVLEKH

NNQITYDALNELKYMGKVIDETLRMYPALPVVTRRCVEDYRIPDSDVIIEKGIEVFIPIKAIHYDPEYYE

NPEVFDPERFNEENIQGRHPYAHIPFGEGPRICIGLRFGVMQSKVGLVSILKNFRVTLSSKTKLPLKIDV

NSFIPTTEGGMWLNLERIGK*

 

>CYP6BJ1v2 Leptinotarsa decemlineata DQ631656

PRKCIGLRFGVMQSKVGLVSILKNFRVTLSSKTKLPLKIDVNSFIPTTEGGMWLNLERIGK

 

>CYP6BJ2 Leptinotarsa decemlineata DQ631655

GEGPRMCIGLRFGVMQSKVGLVSILKNFKVTLSGKTKLPLKIDVNSVIPTTEGGMWLSLERIGK

 

>CYP6BK1 Tribolium castaneum

MFSVLVFLIIVVVFLYYKWAFTYWHRRNIPYLEPSFPFGNLPNLFQRKENIGLTVEKFYNEMKRRKWKHG

GVYFLVSPVYCVIDLEYVKNIMNRDFEYFTNRSIYYNEKDDPLSAHLFAIGGQKWRNLRTKLTATFTSGK

MKAMFQTLLECETNLLKQIEDCNNPINIKEILSCFTTDVIGSVGFGLECKTFEEKNSPFRIYGKKVFKDS

VLRSLKRAFLTSNFPELARKLGILAFPSEITDFFLKVVADTVKYREENNRSRNDFLQLLIDLKNSGTLSL

EEIAAQCFLFFLAGFETSSTTMTFALYELAQHQDIQDKVREEIDAVLKKYGGKITYEAIHDMKYMNQVID

ETLRKYPAASIITRTCVKDYKIPDQDIVIEKGTSVIIPVLGIHHDEKFYPNPEKFDPERFTEENKAARHH

YAHLPFGEGPRICIGMRFGLVQSKVGLTSLLKNYIFKVNKKTIEPLKMQARSLILAAEGEIWLDVYKL

 

>CYP6BK3 Tribolium castaneum

MFVSNSLLGDLIALFVTLGVLLTFYFKWTYQYWTRRNVPQIDPHIPFGNISESIKGREIVGVTFKKIYQQ

LKSQGCRHGGIYIFTQPSYFPIDLDYIRNILTKDFQYFVDRPFYVNEKDPLQAHLLNLSGTRWRNMRSKL

TPTFTSGKMKLMFHIMAESQSDLLKRMDKEAESLEPINIKEVLACFTTNIIGSCAFGLDCKALEDENSPF

RQFGKKLFKISVLHRLKRTFAATFPDFAKFLRMSNSRKEIVKFIMDMVEGTIEYREKNNYSRNDFMQLLI

DMKNNKPKGDHDGKPLTLDEVASQAIVFFAAGFETSSTLMTFAFYELAKNPHIQDKLREEINLILAEHNN

EISYDAIQEMKYLSQVIDETLRLHPPAAQTSRKCIKDYKIPDQDITIEKGTSVTVSILGIHHDPDYYPDP

EKFDPERFTEENKSLRHNYAFLPFGEGPRNCIGMRFGLLQSKMGLVSLIKNYKFTVNEKTK

EPITYQPAHVVLAAQGEIWLNAQKV

 

>CYP6BK2 Tribolium castaneum

MLFSDSLTKDLFGCVLTFAILIIAYFKWSYQYWKRKNLPYLKPTFPFGNITGLLTRKETFGVIIQKVYQE

MKNCNWNHGGIYLTLNPAYCAIDLEYVKNIMTKDFQHFVDRGSYYNEKDDPLSAHLFAIGGQKWRNLRTK

LTPTFTSGKMKQMFQTLVDCESNLAKKIDMEYEKKHPIDIKEVLGCFTTDIIGSCAFGLDCKTFEHENSP

FRVYGKKLFKGSTLRNIKRSLLTQNFPDLAQKLGVLALPEDISNFFMKVVKDTVRYREKNGFTRSDFLQL

LINLKNSKVAEEEGYKHDGNTLTLEEIAAQSFVFFIAGFETSSTTMTFALYELAKNQEIQSQVREEIDAV

LKKHDGKITYDSIQDMKFMNQVIDETLRKYPPIPFVTRKCVNNYQIPGENIVIEKGTTVIIPILGIHYDK

DYYPNPEKFDPERFTEKNKNARHHYAHIPFGEGPRICIGARFGLMQTKVGLISLLRNYKFTVNNMTREPL

RMQVDSFVLAAEGEIWLDAHKL

 

>CYP6BK4 Tribolium castaneum

MLITTSLTGDLLAVFLTLVLIIVTYCKWSYQYWERKHLPYLEPQIPFGNVGDSIKGKTNFGITIKKIYEE

MKHNGWKHGGLYVFTEPNYMVLDLEYVKNIMTKDFQYFVDRSTYYNKKEDPLNAHLLNLGGTKWRNLRTK

LTPTFTSGKMKMMFQTLADCQTGLLKRMEKERLTRQPIDIKEVLACFTTEIIGSCAFGLNCKAFEDENSP

FRVYGRKVFATSKLQRLKRTIATIFPTLGYLFNISITPKDITNFYLNVVKDTVEYREKNNYNRNDFMQLL

IDLKNNKLEGGTSNGGFTLKEVAAQSFVFFLAGFETSSTLMTFALYELARHQEIQDIVREEINEVLRKHN

GNVTYDSINDMKYLSQVIDETLRLYPPASLVNRKCIKDYQVPDCDLVIEKGTTVLIPIMGIHYDKDYYPD

PEKFDPERFTEENKNARHNYAHIPFGEGPRICIGMRFGLMQTKVGLSCLLKHYKFTVNKRTQEPLKMQPS

PLILSAEGEIWLDAEKL

 

>CYP6BK5 Tribolium castaneum

IGDFFLKVVKDTVNYREKNNFTRKDFMQLLIDLK

NNKLVGEEGKSERGLTIEEVAAQSFVFFLAGFETSSTTMTFALYEMAKHQDIQAKVREEIDT

VLKKHDGKITYEAIQEMKYMGQVID

ETLRKYPPVPFLTRQCVKDYKIPNEDVTIEKGTTVIIPVLGIHYD

KDIYPDPEKFDPERFTEENKNARHNYSHIPFGEGPRICIGMRFGLMQSKVGLTSLLKKYKFTVNKKTQEP

IKFQVNPFILAAEGEIWLSAEKI*

 

>CYP6BK6 Tribolium castaneum

MFRFLDLVGVFIALFAILFAYFKWTYQYWSQKNVPFIQPTIPFGNSNLFRQKESGGIRMKNFYDEMKAQG

WKHGGLYSILKPSYMVIDLDYLKNIMTKDFDYFSDRGFYYNEKDDPLSAHLFAIGGEKWRNLRIKLTPTF

TSGKMKMMFQTLVDCAPGLVKQIDRKMESIDIKEVLGCFTTDIIGSCAFGLDFNTSNDNNSPFREYGRKA

FVPTKFDIVKIIFAMSFPRLAQLFRLTLTRKDVSEFFLKVVRETVEYREKNNYRRKDFIQLLIDLKGEDG

KTLTINEIAAQSFVFFIAGFETSSTTMAFVLYELSRRPDLQQKLRDEINTVLSRYEGSITYEATQEMKYM

DQVINEALRMYPPVPMLGRKCVKDYKIPDQDVIIEKGTSILIPVLGIHYDQEYYPDPKTFDPERFNEENR

KARHHYAHLPFGEGPRICIGMRFGLMQTKVGLATLLKNYKFKVGERTQEPLKFKVASFVLAAEGEIWLDA

EKL

 

>CYP6BK7 Tribolium castaneum

MFTFVGVAIALLATLFAYFKWTYKYWERRNLQYLEPKIPYGNGTGPFKRTENAGFRFKRQYEELKSRGWK

HGGLYSILNPIYLVADLDYIKNIMTKDFHYFTDRGIYYNEKNDPLSAHLFALGGPKWRHLRTKLSPTFTS

GKMKQMFQTLVDCVPQLLQQIDKNVPVDIKEVLGCFTTDIIGSCAFGLECKTFEDENSPFREYGRKFFQV

SNLKIAKFLFSGNFPNVARTLGVTITSKDVSDFFISVVEDTVKYREKHNLVRKDFMQLLIDLKNTEKEQM

LTIEELAAQCFVFFIAGFETSSTTMTFALFELAKRPDLQQQVRDEIETVLAKHGNITYDAIQDLKFMDQV

IDETLRMYPPVPVLTRKCVKDYKIPDQDVIIQKGTRVFIPVLGIHYDSDLYPNPSQFDPDRFSEEKKKSR

HGYAHLPFGEGPRICIGMRFGLMQTKVGLTALLKNYKFSVNSKTQTPLKMKPNSFILAAEGDVWLNAQKV

 

>CYP6BK8P Tribolium castaneum

MFFDSISLNVLSVFIALTAVIFAYYKWTYHYWERQKLPFLTPTIPYGNILSPLSKTENFA

ITCKHLYNKIKQREWKHGGIYAILAPIYFVVNLDYVKNIMTKDFQYLDRGFYHKEKVDP 

VSAHFFXXXXXX

QNKLTPTFTSGKMKMMFKTIADCEVNL*EKMLEEHE*KEPIDIKDILSCFTTDIIGSCAF

GLNCNSFKEENSAFRIYGRKVFTPTKTRVLRDTFSFNFPDLARRLNVRAFPKHIGDFFV 

NMVKDTVNYREKNNFIRKDFMQLLIDLKNNKL

EEGKSERGLTIEEVAAQSFVFFLAGFETFSTTMTFALYELAKHQDIQDKVREEIDAVL  

KKHDGK

AIQEMKYMGQVID 

EILRKYPPIPFLTRQCVKDYRIPEE

DVIIEKGTTVLIPVLAIHHDKDIYPNPEKFDPERFTEERKNARHNYAHIPFGEGPKICIG

TRFGLMQSKVGLTSLLKKYKFTVDN*TQEPIKFQVDSFILAAEGQVWLNAERV

 

>CYP6BK9 Tribolium castaneum

MMCILGVF

IALLAVILTSYYKWSFQYWERKNLPYLKPTIPYGNITSPFNRKENIAVTIQNIYEEMKTR 

GWRHGGIYTVTSPAYFLVNLDYVKNIMTKDFQHFVNRGFYHNENDDPVSAHLFAIGGSKW 

RFLRTKLTPTFTSGKMKMMF*TLADCEINLQEKMQDEFEKNQPIDIKEILACFTTDIIDS 

CVFGLDCNSFKEENLPFRQYGRKVFAATKFRVVRSTFAANFPDLARFLKVRTFPKDIGD  

FFLKVVKDTVNYREKNNFTRKDFMQLLIDLKNNKLVGEEGKSERGLTIEEVAAQSFV    

FFLAGFETSSTTMTFALYEMVKHQHIQAKVREEINTVLQKHDGKITYEAIQEMKYMGKVVD

ETLRKYPPVPFLTRQCVKDYKISDEDVIIEKGTTVIIPVLGIHYDKDIYPDPEKFDPERF 

TEENKNDRHNYAHVPFGEGPRICIGMRFGLMQSKVGLTSLLKKYIFTVNKKSKEPIKFQV 

NSLILAAQGEIWLNAERI*

 

>CYP6BK10 Tribolium castaneum

MSLLLSFLLRLGSVIISLIVVVLSVIKWKHQYWANRNIPFFPPSVPFGNLQNPRRKKHSIGYHIKNFYDQ

AKRKGWKHCGLYFFASPVYLVIDVNYVKHIMNTDFHHFVDRGMYSNEKIDPISAHLFALGGTRWKNLRNK

LSPTFTSSKMKMMFPTIVECVSLLLDAMTEKSEQIDIKELLGRFTTDIIGSCAFGLDCNTIKEENSPFRL

YGKKVFFSTKMRTFKLTFASSFPTLGRLLRIRQVSSDVSDFFRKIVKDTIEYRAQNQFSRPDFLQMLIDL

RRDGAEITLDEIIAQCFIFFLAGFETSSTTMTFTLYELAKNHQIQDKLRQEIMTILTKYHGEITYDAISE

MKYLDQVIEESLRKYPPLPFVTRTCVMDYKVPNTDLVIEKGRRVILPILALHHDPEFWPEPQNFDPERFN

DQNRNLRHQFSYIPFGEGPRFCIGKKFGLTQTKVGLVALIQNYKFSVNSRTLDPLKMAPNTFILSAAGGI

WLDSEKL

 

>CYP6BK11 Tribolium castaneum

MLLTNSICGDLVTIFLTLVTVLTLYFKWCHQYWEKLNLPSLPPSIPFGTSLGPKGHFGLRMKHIYDKMRQ

KGWKHGGIYLMQRPFYVVVDLDYVKNIMTKDFHHFSDRGIFHNEKADPLSAHLFNISGPKWRNLRSKLTP

TFTSGKMKLMFQTLLDCEVNLRKQVEQHYEAKKPIDIKEVLGCFTTDIIGSCAFGLDCNSFKEENSPFRV

YGRRVFDRSGFIRTLKRTFASNFPNLAKLVNIALVPRDISDFFINIVKDTVEYREKNKIVRNDFLQLLLD

LKTEESGNDGTALTFEEIAAQSFVFFIAGFETSSTTMAFALYELARHQDIQDQVRDEIESVLKKYDGKIT

YEAIQEMSFLGQVIDEALRMYPPGPLVPRRCVKDYKVPNTDVVIEKGVMVLIPILGIHYDEKYYPDPEKF

DPERFSEENKALRHSYAHIPFGEGPRICIGLRFGLMQSKVGLVSLLRNFKFTVNEKTQEPLKMKTNSLVL

AVEGEIWLNVHRL

 

>CYP6BK12 Tribolium castaneum

MPTLFDILGVSVALLVITYAYFKWRFQYWRQKNVPFLPPTVPFGNFNMLRQRDNGGILLKKFYDEMKSHG

WKHGGFYSLFQPGYLVIDLDYLKNIMTKDFDHFTDRGFYYNEKDDPLSAHLFALGGEKWRNLR TKITPTF

TSGKMKQ MFQILVDCTPDLIERIDSFCREKKPIDIKELLGCFTTDIIGSCAFGLQFNTSKDKNSPFREYG

RKAFTPTYFDIVKMTFAMAFPRLALALKLRMTRKDVSDFFLQLVRDTVKYRVENNYSRKDFIQLLIDLKS

LTIEEIAAQCFVFFIAGFETSSTTMTFVLYELSRRHDLQQKLRNEINTVLAKYDGHMTYEAIQDMKYMDQ

VINEALRMYPPVPLLSRKCVKDYKIPDQEIIIDKGTTVCIPIWGIHYDKDYYPEPEIFDPERFNEDNKKS

RHHYAHLPFGEGPRICIGLRFGLMQ TKVGLATLLQNYNFRVAGRTQEPLKYKVASFVLAAEGEIWLDAEK

L

 

>CYP6BK13 Tribolium castaneum

MFSCFLTNIIGIFVAFFAVIIAFYKWSFGYWKQKNVPYLPPKIPFGNLANPLRPAENMGVQVQHFYAQMR

AKKWKHGGLFFLANPTYMVVDLEYVKNILTKDFQHFVDRGVYYNEDVDPIGAHLFALGGTKWRNLRTKLT

PTFTSGKMKMMFQTLIDCESNLHKKIQAQKNKPIDIKDVLGCFTTDIIGSCAFGLDCNTFEDEDSPFRKY

GKKVFVATPLERLKIAIFMNFPKVGRFFKMRQVSKDISDFYSKVVKDTVEYREKHNYSRKDFMQLLIDLK

NDGNALTLDEITAQSFIFFLAGFETSSTTMTFALYELAKNSEVQEKVREEVLAVLGKHGGKITYEAIQDM

KYMNQVLNETLRKYPPVPFITRQCIKEYKIPDQEIIIETGTRVIIPILGIHYDPEYYPDPQKFDPERFSE

ENVNKRHHYAHLPFGEGPRICIGLRFGLMQSKVGLASLLSKYRFKLNERTKQPMKFQVKSFVLAAEGEVW

LDAESL

 

>CYP6BK14 Tribolium castaneum

MEMLFSAIILILALNYFYYKWKFTYWQCKKIPTLAPKIPFGDLPNPLKQAEATGVHIKRLYDQIKGKGWK

HAGLYFLARPVYMVVDLEYVKNILTKDFHHFVDRGFYFNEKDDPISAHVFAVGGQKWRNLRTKLTPTFTS

GKMKMMFQTLLECEANLLKRFEKEHKSAIDIKDILGCFTTDIIGSCGFGLDFNTFEDENSPFRKYGKKVF

ASNLTRRLQIFFFTHFPSMARALKVRHFSKDVADFFTKVVKDTVEFRERNNYKRKDFMQLLIDLKNCNSG

LTLNEITAQSLIFFLAGFETSSTTMTFALYELAKNEKIQERVRDEIFSILGEEKITYEALQKMKYLALVI

NETLRKYPPLSFLTRECVQDYKIPDQDVIIEKGTKVVISILGMHRDQEFYPDPETFDPGRFSEGNVVSRH

QYAYIPFGEGPRICMGLRFGMMQTKVGLVSLLRKFKFTVNGRTKEPIKFDVRGFILAAEGDIWLNAQKVC

 

>CYP6BK15P Tribolium castaneum

TEVTPSFTLGKIKQ

MFKILVDCTPDLIERIDSFCREKKPIDIKEVLGCFTTDIIGSCAIGLQFNTSKDKNSLFREYGRKAFTPT

YFDLIKMSFAMAFPRLALAFKLRMTRKDVSDFFLQLVRDTVKYRVENNYSRKDFIQLLIDLQNLTNEEIA

AQCFVFFIAGFETSSTTMTFVLYELSRRQDLQQKLRNEINTVLAKYDGHMTYEAIQDMKYMDQVINEALR

MYPPVPLLSRKCVKDYKIPDQEIIIDKGTTVCIPIWGIHYDKDYYPEPEIFDPERFNEDNKKSRHHYAHL

PFGEGPRICI

GLRFGLMQTKVGLATLLQNYNFWVAGRTQEPLKYKVASFILAAEGEIWLDAEKL*

 

>CYP6BK16P Tribolium castaneum

MGMFFTQSLLTDVTTLVVTLTVILVTYYKWSYTYWRRRGVPSLTPKIPWGNLSNPLNRKDTIGVDVKKMY

DSMRRQNWKHGGVFFMASPVYLVTDLEYVKDILTKNFQNFVDRGLYYNEKDDPISAHLFAIGGPKWRNLR

TKLTPTFTSGKMKAMFQTLLDCESNLQEKVAAELGKNQAIDIKDVFGCFTTDVIGSCAFGLDCNTFKEAD

SPFRKYGKKVFTNTPIRQLKSSFSNSFPKLAQQFGISVMPKDVSDFFTKVVKDTVEYRQKNNYTRKDFMQ

LLIDLKGEGKQDGKSLTMDEITAQSFLFFAAGFETSSTTVTFALYELAKHQDIQQKVREEIETVLAKFDG

KVTYEAIQEMHYMNQVLNVTIIK

 

>CYP6BK17 Tribolium castaneum

MSLLISFIVKLISVLVSLIAVTLTYIKWKHQYWSKRNIPFFPPTIPFGNLENPRRKKYSIGYHIKNFYDEAKRKGWKHCGLYFFASPVYLIVDVEYLKNVMSNDFQYFVDRGMYYNEKADPISAHLFALGGDRWKNLRSKLTPTFTPAKMKMMFPTLVECVSLLLDAMEKESVNIDIKELLGRFTTDIIGSCAFGLDCNTIKEENSPFRVYGKKVFNSTRMRTFKLSFASSFPNLGRLLRIKQVSSDVSDFFSKIVKDSIEYREKNNFVRPDFLQMLIDLRKKGAGLTLEEVTAQCFIFFLGGFETSSTTMTFTLYELAKNEEIQEKLREEILRILDKHEGKITYEGISEMKYLDQVIDESLRKYPPFPFVTRTCVMDYKVPNSDVIIQKGRRVVVPILALHLDKEYWPDPQKFDPERFSDDNKPLIQQYSYIPFGEGPRYCIGMRFGLTQTKVGLVALLRDYKFSVNPRTLDPLKMAVNSFILNAEGGIWLDSQKLLKNNHRKQ

 

>CYP6BL1 Tribolium castaneum

MLTSCLATLFITLLSIFAYFYKRFYFSYWERKKIPNLQQHVPRTKPHLGIQLQQLYKIMKEKKWKHGGFY

QQLSPVYVICDLNYVKNIMTRDFNYFPYRGLYYNETSDPLSAHIFNTSGAKWKRMRRKLDQIFTSSKLKT

IFPLLPNCGEKLAGKCEPVDIKKVLDDFISDVIELCVFGSECKVFKQLGRKILNRSRLRRLKGIIINNFP

KLAKILDIVLIPRDASTFFKKVVAEIVEERKKGQTGRNDFLQVLVEMEKKFEITIDEIAAQCFIFLIAGM

STSPTAMTFALYELARHQDIQEKVRQDIAKFGKVTYDSLQEMKYLGQVFDETLRMYPPAAYLNRKCERNY

EIPDGSGIIVEKGTIVAIPVLGIHYDRDYYPDPEKFDPEHFSEENKRLRPNFAFLPFGEGPRICIGMRFG

LMQSKLGLVSLLKRYKFTVSEKTREPLKMKPNSLVLSAEGEIWLDVTEIKI

 

>CYP6BM1 Tribolium castaneum

MAFISLTILAILLLLAVTLFYKWKFQYWKTRQVPFLPPKIPFGNIPNPFTLKEKPGIFIKQFYQEMKRNG

WKHGGFYFFACPVYMVVDPDYIKQVLIKDFQYFIDRGIYSNEKDDPISHNLFSANETKWKYLRTLLNPSF

TSKKIKAMFTILLACEKFLTQNVENNQVIDANHIFANFTIDVITTCAFGLDCNGNQNLALKHFGEKTINY

SKLKMFVLMLASIFPKLAKKFGCVIMHKNTQEFFVQFVADIIKFREENNYTRDDFMQFLIKLKNKSAKQV

FTLEEVASQCVLFFIAGFETSHATMSFALYELAKHQDIQQKVREEFWAVVDSQESEITYEAVQKLKYLDQ

VLNETLRKYPVVMYLTRRCIKDYKVPEDGAVIEKGTTVIIPTVALNYDENYYPNPKKFDPQRFSEENKKL

RHPCIHLPFGLGPRFCIGRRFALIQVKVGLVLLLKNYSFTVNPNTREPIKLKIHSFISAPEDKILLDVHK

L

 

>CYP6BN1 Tribolium castaneum

MNTTIEILTIIILTIFCFYKWKFSYWKSRKIPYLDPKFPFGNVSNPFFMKEKVGMTLARFYNDMKQRGWK

YGGFYFGVSPICLIVDPDLIKNIVTRDFEHFVDRGVYFNEKDDPLSGHLANLDGQKWKNMRRKLNPTFSA

SKTKNMFPIVKFCVENMMEKVKSCYENAHKCCNINEVFPAFSINVICSCAFGLQEENALFKAYADECVSW

TKYKYLVQILATFFDKTAKRMGITTVPRNAAKFFMKVVTDSVKYREENDYVRSDFMQLLIEMKKQNQLTI

EEIAAQCFVFFIAGFETSSATLTFALYELAKNQNLQNVARDEILANCPNEITYDSLADLKFLDQVVDETL

RKYPPLLYVTRQCVKNYKIPDEDVVIEKGTLVAIPISALHSDEEFYPKPETFEPERFSKTEKSLRHPYTF

LPFGEGPRMCIGKRFGLLEVKLALTCLLKNYKFSVNCKTKEPLAMRVDTVVLAPKDEIWLDLEKI

 

>CYP6BP1 Tribolium castaneum

MILLVLSVVLLVALRIFFFWRFQYWEKLQIPYLRPYCPFGCLPNPLINKEKGGIILKRLYRNVRDKGWKH

AGIFVFVTPVYLPTNLDYIKNILTKDFEHFDDRGLYYNEKDDPLSGHLINLGGPKGVTMRKKLNSLFTPS

SLKMMFQTLNTSIEDLLQQIHSRNTIDIHKLFTCFTIHVIASCTLGLECNIFKEEHLLFESYANKFLVWS

RGKWCLQLLAAMYIDTARKLKVRTVPKETEDFFVKIVTKNIKYREENDYFRQDMMQFFIEQKNANTMSIN

EIIAQCFIFFIAAYETSTTTLTFALYELAQNLDIQDRVRREITSVLLKHQKYSYEAIAEMKYLNQIVDET

MRKYPPFLYVVRRCTKDYTIPGEDVTIKKGIFALISILGIHHDEEIYPNPQKFDPDRFSKENKKMRHPYA

YLPFGEGPRICIGKRFALMQIKFGLAALLEKYKFTLNEKTKVPLEIRTDTLVVAPKGDVLLDIQKIN

 

>CYP6BP2P Tribolium castaneum

GSGYRGFYVFVTPVYLPTDLNYVKNILTNDFNYFNRRGIYYNEKDDPLGAHLINLSGKKK

HILRK

MIKAHKVAATFTIDIIFSCTLGLDCKTFKDKHSLLQYFLNKCLFWSKFRWFVQVLAAMN

GSVKQNKQNFFLEIVSILNIARK*LRE

NNYVRKDLQMLINQKKSNAFSVSEITAQCLPFFDAGFDTSAATLTFALT

EIAKNLEVQEIIRAEIGEINYEILLETRYLDQVID

KTLRKYPPVLFVPRRCCDDYRTP

SSIVIEKGTFVLISIFGI

HHDQESAKFDPERFCRENKKLRHPYAYIPFGEGPRS*IG

KRFGLMQIKFFVASISKNYKLTKNPRTPEPLTIEVDRMVLLP*NDIFLDLVKVD

 

>CYP6BQ1 Tribolium castaneum

MNYTFLA

LFVTFLLGVISYLKWKLRYWDKKGLPTIPPKLPFGNLTDVIFGRKSFGEQFVEFYQILKAKGYRHGGIYF

GASPLYVPTDPEIVKHIMLVDFAHFSSHGGYVDEESDPLSGHLFNLDDIKWRNLRVKLTPTFTSGKMKMM

FQTLAEVSYNLKNVLDESVINKTPVDARDVLSRFGVDVISSVAFGLECDSLKDPNVSFRKYGKKAVDFDI

WVRIKLFMQVLLPHCVLRAIGHKFTKTEVEEFFMKSIRDVVEYREKNNIFRKDFMHLLIQLKNLGTVTDD

GQILDETSGSKEVGLTMNQVAAQAFVFFMAGYETSSSTITFALYELAMNPPLQDKLRDEINTILAKHDNK

LTYAAMMEMTYMEKVIQETLRKYPPLPIIMRLCTKDYVVPGTDIEIKKGVGVMIPVLGLQTDPEYFPDPD

VFDPDRFSEEKKKERPGFTWLPFGDGPRICIGMRFGMLQSKVALTTFIRNYRVKLNEKTKIPLKIDKGSF

TTRAEGGVWLNLEKLN

 

>CYP6BQ2 Tribolium castaneum

MLLVNGSLTYDLVAILVTVLAGLVVYYKWAFTYWKKRGLEYLEPSIPFGNCASLFKAKYNFGEQFAEFYK

QFREKNLRHGGVFMFARPFYIPVDPAIMKDIMQKDFQHFVDRGFYVNEEIDPLSGHLFSLEGNKWKNLRA

KLTATFTSGKMKMMFETMSRCAEELDNYVNEASKRKETIDIKETLARFTTDIISSCAFGLESNCLKNPDT

KFRYYGKRTFQNTTWENLKNLIQFMTPMYLLNLVKFKTTKQDVEDYMLNLVKKTVDYREKNNVYRKDFLH

LLLQLKNKGKITDDETFLDNNNKSKEVALTINELAAQVFVFFAAGYETSSTAMTFTLYELCLNQKIQDKM

REEIKTVLAKHNNKISYEALMEMTYMEQALNETLRKYPPVPFLNRKCTKAYDVAGTNLHLDEGTMVVLPI

LGLQHDPEYYPDPSKYDPDRFSEENKNSRPPFTWMPFGEGPRICIGLRFGMLQAKVGLATLLENYKVTLS

QKTKTPLEMDCKTFITTTKEGIWLDFTRLN

 

>CYP6BQ3P Tribolium castaneum

NFHHFMNHGNYFDSENDPLTGHLFNLEDNK*KNLRVKLTPTFILGKIK

MMFQTLADCASGPNTIMDEAAKNQTSLDIKDILARFTTDVIGSVAFGLECNSLKDPDVEFRKFGKRIFQI

DVLDRIKILLQLIFPRNVLQTMKMKTTKSEVKAFFMKAIRDTVNYREKNNIYRKDFMHLLIQLTNRGVVT

DDGNITSDQSKTDKALSLNELAAQVFVFFIDRFETSLTTMI

YEIASNPQVQEKL*EEIVTTLSKYNGELSYNAIMEMTYME

LRKYPPLPLLTRQCTKDY

DPEYHP

RFNPERFSEENKKKRPNFT*ILFGE

GLRFEILQSKVGLTTLLRNLKLL*TKKNKVPLEMDKKAFVSSAEGG

VWIDVEKL

 

>CYP6BQ4 Tribolium castaneum

MLLVNGSLTYDLVAILATVLAGLVVYYKWAFTYWKRRGLEYLEPSIPFGNCASLLKLKYSFGEQFAEFYK

QFREKNLRHGGVFMFARPFYIPVDPAIMKDIMQKDFQHFVDRGFYVNEEHDPLSGHLFSLEGNKWKNLRA

KLTATFTSGKMKMMFETMSKCAEELDNYVNEAAKREETIDIKETLARFTTDIISSCAFGLESNCLKNPDT

QFRYYGKRTFQNTTWENFKDVIQFITPTYLLDLVKFKITKPDVEDYMLNLVKKTVDYREKNNVYRKDFLH

LLLQLKNKGKITDDETFLDHNNKSKEVALTINELAAQVFVFFAAGYETSSTAMTFTLYELCLNQKIQDKL

REEIKTVLAKHNNKISYEAIMEMTYMDQALNETLRKYPPVPVLNRKCTKAYDVAGTNLHLDEGTMVVLPI

LGLQHDPEYYPDPSKYDPDRFSEENKNSRPPFTWMPFGEGPRICIGLRFGMLQAKVGLATLLGNYKVTLS

QKTQTPLEMDCKAFITTTKEGIWLDFTRLN

 

>CYP6BQ5 Tribolium castaneum

MNTLLHNFVYDFVALFATVLIGVLLYYKWKFTYWAKVGLPTLAPTFPFGDAKEVMLGRLTFGEQFLEFYK

KFRANGFKHGGVYFCLQQFYVPVDPEIIKHIMQKDFHHFMNHGNYFDSENDPLSGHLFNLEDNKWKNMRV

KLTPTFTSGKIK MMFQTLADCASGLNTIMDEAAKNQTSLDIKDILARFTTDVIGSVAFGLECNSLKDPDA

EFRKFGKRIFQIDVLDRIKILLQLIFPRNVLQTMKMKTTKSEVEEFFMKAIRDTVNYREKNNVYRKDFMH

LLIQLKNRGAVTDD GNITSDQSKTDK

ALSLNELAAQAFVFFIAGFETSSTTMT FALYEIASNPQVQEKLREEIVTTLSKYNG

ELNYNAMMEMTYMEKVIFETLRKYPPLPLLTRQCTKDYLIPNTTIRLKKGDMVGIAAQALHYDPEYHPDP

EKFDPERFSEENKSKRPDFTWIPFGEGPRLCIGLRFGMLQSKVGLTTLLRNYKIALNKKTKVPLEMDKKA

FVSSPEGGVWLDVEKLE

 

>CYP6BQ6 Tribolium castaneum

MTFMTESLIFDIVTIISTIVVLTIAFWKWKLSYWDRVGLPTLSPILFFGDTKDVLLGRLTFGEQFQELYK

KLKAKGLKHGGVYLGTRPFYLPTDPEIIKHIWQKDFQHFVNHGNYFDEEADPLSGHLFNLEDAKWKNMRV

KLTPTFTSRKMKMMFQTLADCTHGLKDIMDEGASSGSPVDIKEILGRFTTDIIGSVAFGLECNSLKDPNT

LFRMYGKKIFELSTGRRLHLFLQFILPERVLHAMKFKVTPSDVETFFMKVIRDTVGYREKNNVYRKDFLH

MLIQLKNRGTVTDDEKITEDNGKTGEKALTMNELAAQSFVFFAAGFETSSTTVTFALLELALNQDIQQKL

REEINTCLAKSNGELTYQAIMEMTYMDKVLQETLRKYPPVPFLTRRCTKDYTIPETSIKLRKGDHVGISV

VGIQNDPEYYPDPEKFVPERFNEENKNSRHPFTWMPFGEGPRICIGLRFGMLQSKVGLAALLKNYKITLN

SKTKMPIEMEKSSFITSVNGGVWLNVEKLS

 

>CYP6BQ7 Tribolium castaneum

MLFSDSLIVDLVTIIST IVVVSIAYCKWKLSYWNNTGLPTLSPVFPFGDTKELLLGQKSFGEQFQDLYKE

IRAKGWKHAGVYLAIQPFYLPVDPKIIKHIWQVDFQHFVNHGNYINEEVDPLSGHLFNLEDAKWKEMRVK

LTPTFTSGKMKMMFQTLADCTHGLKTIMNECATSGTPIEIKDVLGRFTTDIIGSAAFGLECNSLKDPDST

FRKYGKKVFELQGWERIKVLAQFALPHSFLRAIKFKQTQSDVEKFFMKVVRDTADYREKNKIYRKDFMHL

LLQLKNRGKVSDDEKVTQENGKTGEKALTMNEVAAQAFVFFLAGFETSSTLMTFTLYELATNPDIQGKLR

EEINTVLAKHDGQMTYEAMMEMTYMEKVLNETLRKHPPIPFLFRRCTKDYTIPETSVKLRKGDDVGISIV

GIHNDPEYYPNPEKFIPERFNEENKNARPPFTWIPFGEGPRICIGLRFGMLQSKVGLTALLKNYKISLSS

KTKMPLEMEKSGLVTTVEGGMWLNVEKIN

 

>CYP6BQ8 Tribolium castaneum

MLLNNFTLNILAVFITVLVGVIVYFKWHLSYWDRLGVPSLSPVLFFGDTKNLILSKCTIGEQFRVFYNKF

KSKGYKHGGIFFGPIPFYIAIDPEIIKHILQKDFQHFMNHGYYINEEDDPLTGHLLNLENVKWKNMRAKL

TPTFTSGKMKIMFQTLADCTTGLKKVMDDSALNHTPVDIKDIFGRFTTDIIGSVAFGIECNSLENPDAEF

RKYGKKVFEIDFFGRIKTLCTFAIPHPILRLFRFKFYNSDVATFFMDAIRETVNYREKNNIYRKDFMHLL

LQLKNRGLVTDDEKITGDKDIVTEALTMNELAAQAFVFFLAGFETSSTAMTWALYELAINPDVQQKLRAE

INDVLRKHNKLTYEAMMDMTYMEKVICETLRKYPPIPVLTRKCTKDYTIPNTSIQLQRGVSVSVPVLALH

TDPEYYPNPEKFDPDRFNDENVKARPGFTWLPFGEGPRICIGLRFGLLQSKVGLTAVLKHYRIKLNHKTQ

LPVTLNPRSFITSAKGGVWLDVEKID

 

>CYP6BQ9P Tribolium castaneum

MTLITNNLMFDLIAILATVLVCVIAYLKWHLTYWNRLGVPSLNPVLFFGDATDYLFGKCGVG

EQFAKFYGKFKSKGYKHGGVFLGPKCYYVPVDPDLVKHIMQKDFQHFMNHGFYINEEVDP

LTGNLFSLEDAKWRNMRVKLTPTFTSGKMKMMFQTLADCTRGLKEIMDNLALNHAPADIK

EILGRFTTDIIGSVAFGIECNSLKNPDAEFRKYGRKIVETGFIDRIKVFLVLSIPHALLR

FLRFKFTNTEVETFFMGAIQDTVNYREKNSVYRKDFMHLLLQLKNRGLVADDEKITDDKG

NIKENDFITINQLAAQAFVFFLGGFETSSTTMSWAL*ELATNQDIQEKLRKEINDVLSRH

NNKLSYDAMMEMTYMDK VIRHNNKLSYDAMMEMTYMDK VIN 

ETLRKYPPLPIIPRVCNKDYTI

PNTSTKLSRGTSVAIPVLAIHTDPEYYPNPEKFDPEHFSEENIKSRPGFTWLPFGDGPRICI

GMRFGMMQSKVGLATILKNYKIKLNNKTEFPIKVDPKNFITTAKGGVWLDVEKLD*

 

>CYP6BQ10 Tribolium castaneum

MTLITNNITLDLVAIIATFLVGIIVYFKWQLSYWDRLGVPSLNPTLVFGDFKNYIFAKCSLGEQFKELYD

QFKSKGYKHGGVFVGPKPFYVPIDPEIVQHIMQKDFHHFMNHGNYFDENADPLSGHLFNLEDSKWKNMRV

KLTPTFTSGKIKMMFQTLADCTRGLDEIMYNSALNHAPADIKDILGRFTTDIIGSIAFGIECNSLKNPDA

EFRKYGRRVFEVGIIDRIKIICILALPDSVLRLLKLKFTKSDVENFFMNAIRDTVNYREKNNIYRKDFMH

LLLQLKNRGSVTDDEKVTDDKDNVKEKALTLNELSAQAFVFFLAGFETSSTTMTWALYELATNQDVQEKL

RNEINNVLSRHDNKLTYEAMMEMTYMEKVIHETLRKYPPLPILTRKCNKDYTIPNTCIKLRRGTTVAIPV

LGLHTDPEYYSNPEKFDPEHFSEENVKSRPGFTWLPFGDGPRICIGLRFGMLQSKVGLTAILKNYKVTLS

NKTKFPVTLDPKSFITTAKDGIWLDVKKLD

 

>CY6BQ11 Tribolium castaneum

MSLITDNLTFDLVAILATILVGIIVYFKWQLSYWDRLGVPSLNPVLFFGDIKDFILAKCTLGEQFKEFYG

KFKSKGYKHGGIFLGPKPFYVPIDPELVKHIMQKDFQHFVNHGNYFDEDADPLSGHLFNLEDAKWKNMRI

KLTPTFTSGKIKMMFQTLADCTRGLKEIMDHSALNHAPADIKDILGRFTTDIIGSVAFGIECNSLKDPDA

EFRKYGRKVFEVGFIDRLKTICILSLPHPVLRFFKLKFTKSDVEKFFMSAIRDTVNYREKNNIYRKDFMH

LLLQLKNRGFVADDGKVTDEKENVKEKALTLNELSAQAFVFFLAGFETSSTTMTWALYELATNQDVQEKL

RNEINNVLSRHDNKLTYEAMMEMTYMEKVIHETLRKYPPLPILTRKCNKDYTIPNTSIKLSRGTAVGIPV

LALHTDPEYYSNPEKFDPEHFSEENVKTRPGFTWLPFGDGPRVCIGLRFGMLQSKVGLTALLKNYKIKLS

KKTELPIKLDPKSFITTAKGGIWLDVEKLD

 

>CYP6BQ12 Tribolium castaneum

MAIFTSSIFIDIITIITTVLALTIAFFKWKLTFWEKLGVPTLNPVLFFGDAKNILLGKRQVGVEFIDYYK

QFKPRGLKHGGVYLGPRPFWVITDPGLIKHILQIDFPHFINHGTYADEENDPLSAHLFSLEGTKWKNMRT

KMTPTFTSGKMKMMFQTLVDCTPGLKDIMDEHASKKKAVNIKNILERFTTDIIGSVGFGIECNSLKDPDS

LFPKYGKKVFDLTPAEQLKQSLLFFLPNPVLKAMKFRITNKDVEDFFMKTVRETVLYREKNNIYRKDFMH

LLLQLKNRGTVTDDEKIIDHSNQKQEPALTMNELTAQAFVFFLAGFETSSTTMTFALYELATNPDIQEKL

RNEICTVLEKHNNELTYNAIAEMTYMDQVLHETLRKYPPLPILQRQCNKDYIVPETNIRIPKGVDVAITI

LALHRDPEFYPNPEVFDPERFNEENKNARTPFTWLPFGDGPRVCIGLRFGMMQSKVGLTALLKDYRVTLN

KKTKVPLEMSKNSFIIAAEGGIWLDIEKINT

 

>CYP6BQ13 Tribolium castaneum

MAILTYSWLLDIFGILTALIAVFIAWAQWSHTYWSRRNLIAPKTTFFLGNSKGIVTQKQSFGDFTVEMYE

YIRKHNKPHGGFYLTLMPNYMPVDPEIIKHIMLNDFDHFVDRGIYYNEEVDPLSAHLFSLDGAKWRNLRI

KLTPTFTSGKMKMMFDTLVKCSDQLLVEMNQTAGKAPVDAKNILARFTTDIIGSCAFGIECNSLKNPNDE

FTQYLKLFFVEGFWQNLNGIITFVAPELAKKLNMKVVNPVLSNFFMKVVEDTVNMRERNNIYRKDFMHLL

LQLKNRGELVDDDSILQNNTDAENKEVTLTLNELAAQAFVFFLAGYETSSTTMTFCLYELASNPEIQDKL

RAEINEVLQKHGKLTYDAIMEMRYMDKVVNETLRKYPPLPGLNRVCNKEYKVPGTDFVIEKGTKIWIPVL

GLHRDPEYFPNPEKFDPERFTEENKRQRHPYTYLPFGEGPRICIGLRFGMMQTKVGLSVLLKNYKFSINS

KTKLPLQLDPKSFIMSTEGGIWLDYTRV

 

>CYP6BQ14P Tribolium castaneum

ISLGTTAYLVVLELGIALLVIVISYLKWRMTYWQKLGVPTLNPAMLFGDTKKMFLGECTF

GEQFLDIYNKFKARGVKHGGVYLGIKPFYLPLEPELVKHIMQNDFEHFVNHGLYMDKEND

PLSGHLFNLEDEKWKNMRNKLTPTFTSGKLKMMFQTLANCTVGLQTIMDDADTNHTPLDI

KDILGRFTTDIIGSVAFGLECNSLKDPDALFRKYGRKVFEMDIWERLKMFTQFVLSHRVL

RAIKFKV*KNDVERFFMKVIKDTVEYREKNNVSRKDFMHLLLQLKNRGSVTDDDKVTDDH

GKAQEKALTLNELSAQAFVFFIAGFETSSTTMTFALFELSTNPHIQDKLREEINQVLEKY

DDKLTYDAMMELTYMEKVIN 

ETLRKYPPAPVLFRRCNKDYKVPNTSIIIQKGIDVAIPVLGLHTDP

DYYPNPEDFDPERFSEDNKNKRPGFTWLPFGEGPRVCI 

GLRFGVLQTKVGLTALLKNYRVKLSPKTKMPLKMDKT

LLTSAEGGIWLDMEKLN

 

>CYP6BR1 Tribolium castaneum

MNIPSPYFEILGTVLALLVAIIFYYHHAFQFWARKNIPFIPPRFPLGNTNVVLPRGLTIGLLSKTFYDYF

KQRGHKIGGVFLVTEPNLMILDPDYIKNILLKDFHHFVDRGFYFNEKTDPISANLFTIDGDQWRNLRTKL

TPTFTSSKMKIMFQTVKNCCNNMLEAIASNTDLDKDLKEFLGRYTVDVVGSCAFGIECNSFKHPDAEFRK

MGLRAFHFSFLRSIRAFFIAYLPKLSRQMGLPSNNKDIREFFYKVVMETIQKREETQIKRNDFLQILMDL

RKTEILSLDEVAAQVFLFFTAGFETSSSTMAMCLYEIAKEPEYQEKLRQEICEITNGEITYENLFEMKYL

DQVFSETLRKYPPGQTLNRRCVKDYTLPGTSTIIEKGTPILISAIGVHRDPEYYPDPEKFDPERFSEENK

KLRHPFVYLPFGDGPRNCIGMRFGTMQSKLGIASVVKNFKVSVSPITKRVELDPNTFLLNTIDKIYFRVE

KIVK

 

>CYP6BR2 Tribolium castaneum

MGLFLEDFWTEVFFLLTTLAILVLSYFHNAYKYWEKRGVPTIKPTFPLGNGDTLLPEGFSVGMLSRKFYE

ELKKRGEKFGGVYLVTQPNLVLVDPEYVKDILATDFQYFVDRGFYFNEKTDPLSAHLFALDGTSWRNLRI

KLSPTFSSGKMKMMFKTVLECCGYMRDYIEDILDKDLDIKEIFSRYTTDVIGSCAFGIECNSFKYPDAEF

RKMGKKVFSFGLWRSICSFCIIYFPNLSYHLGVPTNEKDVQNFFRGIVAESVNTRKEQNIKRNDFLQLLI

DLKDHSALSLNEMAAQVFLFFAAGFESSSTTMTFVLYELAKHPDIQQELRNEIRKTLDKHQGQLTYEAVM

EMKYLQQVIDETLRLYPPLATLNRRCIKDYTLRNTGIKIEKGTSVIIPSLGLHMDPELYPDPEIFNPDNF

SEENKKKRPSFVHLPFGDGPRNCIGLRFALMQSKCGIATVVNNFRFSLSPATKPLRLNPNSFVLNTYDKI

YLRAERLAM

 

>CYP6BR3 Tribolium castaneum

MSVFTEFWPQILVFLALFLLVLVNYFNYCYRYWSKKGVATIKPRFPLGNTNIILPQGLSIGILSKQFYDE

FKAKGHKFGGVYLVTEPNLLIVDPEYVKDIMSKDFQHFVDRGFYYNKEKDVLSAHLFAIDGSDWRNLRIK

LTPTFTSGKMKMMFEAVVQCSKHMIENLDKNLGSDIEIKEVLGRFTTDVIGTCAFGIECNSFKYPDAEFR

MMGKKIFEYDLWKSVKAFFAVNVPKVALQLGLTSTPDDVIDFFTRIVADAVKMRESNNIRRNDFLQILID

LKNTTSLTLDEMSAQVFLFFVAGFETSSTTMTFALYELARNEKMQEKLRFEICQVLDKTGGQITYESLIE

MKYLQQVID 

ETLRMYPPLPTLNRRCTKDYVLRDTNIIIEKDTPILISALGLHMDPEFFPKPEKFDPERFT

EEKKKERHPFVHLPFGDGPRNCI  

GLRFGVMQSKIGIITIIKNFKLTVSSNMKPVQFNPYVFLLNINDKVLLQVGKL*

 

>CYP6BS1 Tribolium castaneum

MESALMEAGIIFLTIVSFVYLYFKHAYTYWKARNVPQLSPTFPFGDMASVIFRRHNMGDKIKEIYDETKA

RGHKYVGLYFFSRKAFLPIDPVLIKKILAPDFQHFHDRGIYYDEENDPISAHLFSLAGPKWKNLRARLTP

AYSPGKLKFMFDTVLACGEEMADILKEIAKREGKVEIKEILARYSTDVIGCCAFGIDCNSMRNPTAEFRL

MGRRAFTQTIGDVLKMIVIRSFPRLAKLLGFGVFSPTVTGFFQRVVNETIRYREENNVTRNDFMQLLIQL

KNKGKLEGDGEEKDGAPAVGTSLTLDEAAAQAFIFFLAGFETTSTTISFALFEMARNESIRTKARTEINK

VLGKHGGKLTYEATMEMEYLDTVISETLRKYPPAPVFLRKCTKTYRVPDTDVIIEEGLSVLIPAYGLHRD

PEYFPDPETFDPDRFNEDNRSKIWDYTYIPFGDGPRICIGMRFAMIQIKIALALILKSFEFPLSEKTILP

MKMENSGIILAPIGGIWLNLIPLE

 

>CYP6BT1 Tribolium castaneum

MLLLAESLITLVLLLIAYYKFSFQYWKRQNVPFIQPSIPWGNYPSALKRQDNFGELVVRMYHQMKKQGHK

YFGIYLFFQPCFVPTDPKFIKLILAKDFQHFNFRNFYYNEKDDPISAHLLSLNGEKWKRLRSKLTPTFTA

GKIKMVFKIFVECGKIIEHTLEHHAQNRTSFDVKEMFSSYSTDVIVNCAFGVEVDRLKKTEFKNYSQKAL

DFNTRRCIVMYLGAVFPKLCRKLGFRQIAKSAGDFFINIVRNTVEFREKTNTIRNDFLQLLINLKNDESD

DWGQFSIEEVAAQCFIFFLAGFETSATTMSFALYEIAANPHVYEQIMDEMRRVLDKYNGEMCHDAIKEMT

YLGQVVDETLRIHSPAYAVSRTCTQDYHVPETNIVLKKGFQVLIPIRGIHSDPEFYPEPEKFKPERFHPD

NRQNIEPYSYLPFGEGPRICIG

 

>CYP6BU1 Leptinotarsa decemlineata DQ631653

PFFAGPRNCIAARYGLLQTKVGISAVIKNFKVTLNKKTKTPIRYVTSGRIPEIEGGVWLDVTKIQ

 

>CYP6BW1 Dendroctonus ponderosae (mountain pine beetle, bark beetle)

EZ116081.1, EZ115472

MAFGLAYVVIGVISFIIYVKWRQSYWKRKGVPSSDADFLLGDNTKIFTNQESLG

EISVNRYNKFKAQGKKHAGFYNFLQPVYFPLDTDIIKHIMQQDANYFASHATYNNPDDVL

SKHLFALEGERWKDLRAKLTPAFTSGKLKMMFETLTNKTVGLENAVAKMVDKKEAFVLKE

FLCNFTTDVIASCGFGIESDCLGDPNDAFRRAGKKIFEPRPFKLALLSLFNWDFLAKLGY

KHFPNELTVFFTNVVTSTIRHRENNQIFRKDFMHLLLQLKNQGVLSDDDKVTGSGNGKGI

ISESDIIAQCFVFFIAGFETSSSTMTFTMLELAQHQDIQDKLRKEILEVLAKHDGKITYE

AVMEMPYLDKVISEALRKFPPLPVIPRRCTKTYKVPGTDLVLERGTDVQIPVWAIQNDPE

YYENPEVFDPERFSEENKAARPEYAFFPFGAGPRVCIGLRL

 

>CYP6BW2 Dendroctonus ponderosae

EZ116007.1

MVVAILVIGVITFLIYVKWRQTYWTRRGLPTAKTEFFFGDMRKAITGVEPLAVRTKNRYNEIKALGVKHAGFYMFWRQIYFPVDLQIIKNIMQQDADYFQSHGGYYHSDDVLSTHLFTLENQRWKELRAKLTPAFTSGKIKMMFETLTEKTELLIDAVGKLADETEGFAIKNVCGNFTTDVIASCGFGIECDSLNEPDNAFRNFGKKLLVPNLLRFAL

 

>CYP6BW3 Dendroctonus ponderosae EZ116080

MALSLAYVVIGVISFIIYVKWRQSYWKRKGVPSSDADFLLGDNTKIFTNKESLGEISVKR

YKKFKAQGQKHAGFYNFLQPVYFPIDTDIIKHIMQQDANYFASHATYSNPDDVLSKHLFA

LEGERWKDLRAKLTPAFTSGKLKMMFETLTNKTVGLENAVAKMVDKKEAFVLKEFLCNFT

TDVIASCGFGIESDCLGDPNDAFRRAGKK

 

>CYP6BX1 Dendroctonus ponderosae

EZ115691.1

SASYLIYFLIVFVGLLGYLFRKAKKTYNYWTEHGVPSENNTHLLYGNLKESILLKKSD

AEVYGEFYQKFKKRGLKHGGVYFYSRPTWILVDLDLIKTVLISDFQYFAAHNPMYLNTIF

FNNLFHMQGEQWKDMRRKLAPTFTSGKMKMMFNILLEKTHGLADLVADMASTGEATEIKE

LVARFTTDVIGSCGFGIECDSLNDVNSTFFQHGQNIFKKLTPKAAPKFYKLILLSLGLMK

RFNINLDETEAFFRKLVEDTVKYREENKIVRKDFLHLMIQIKNNGTITDILNDSDIFIKS

RDEAGLSMEEMVGECLLFFMAGFETSSTTLSFVFLELSRNQSIQEKLRKEIHTVLEKYNG

TLSYDSLQEMTYCECVINETLRKYPPVASLPRMCTKDYAVPGSDALIEKNTMVVIPLLAL

HNDPDYFPEPEKFIPERFSAKNEK &

IPFIYMPFGE

 

>CYP6BY1 Aedes aegypti 1.7_1 AAGE01026936

MSALLIILALTPLFLFIIYVKQKYAYWARRNVPFLKPHFPYGNFEALDRKSIADVAREAYEEMKNRGPFYGAYFFLQPLITITDPDLIKMVLIKDFNTFPDRGLYFNERDDPLSAHMFAIEGNKWRSLRQRLSPTFTSGKMKMMFPTLAAVGDQFSAFLDEEIGSGKVVEVKDFMAKFTTDIIGSCAFGIECNSFKDPHGRFRQFGKMVFETPVHGSLVRFALKSFPEISRRLRIKALHEEASKFFYGVVEDTVKYREKNGVERKDFLSLLIDMKKDGVDFTMDEIAANSFIFFGAGFETSSSNQTFCLYELARNPECQDKARQSVLDALRNHGGMTYDAACDMQYLDQCINETLRLYPSVPVLERRAFQDYKIPGHDVVIPKGMKINIPAYAIQRDERFYPDPDVFNPDRFHQKEVAKRHICTFIPFGEGPRICIGLRFGMMQSRVGLATILSKFRISICSETANPLEYSSKTSVLIPKEGLWLRVDPL*

 

>CPIJ003361 CYP6BY2 Culex pipiens 59% to CYP6BY1

MAALVVALLITVFTFAIWFVKRKYSYWSRQNVPHVEPSIPYGNFKELGQVSIFELSSRFY

NQMKTCGRYFGLYFFLEPILVVTDLDLIKTIMIKDFAHFPDRGQYYNARDDPLSAHLFNI

EGNAWRSLRARLTPTFTSGKMKMMFPTLKVVADRFAEFLTRSVESGDADMEVKDCFQRFT

IDVIGSCAFGIECNSFSDPDSRFRKVGNQIFSNPRNSTAVRLFLKTFPDLGRMLRIKSLN

SEATEFFYKTVQDTVGYRKANGVERNDFLNLLLELEKKGVDLSMDEIAAQAFLFFIGGFE

TSSSTQTFCMYELSLHPDIQEKARQCVLEGIQKHGGLTYEAVSDMPYLDQCINETLRKYP

TLPILERKTFKDYHIPDSNVVIQKGTRIQIPVYALQRDERYHPEPDRFDPGRFTADEMAT

RHVSTFLPFGEGPRVCIGQRLGMMQSRVGLATVLSNFKVSTCAKSQVPLQISSKSAVLQP

QQGVWVRVEPLK

 

>CPIJ003375 CYP6BY3 Culex pipiens 67% to CYP6BY1 (-) strand

MSLVLVVLLVTVLLLCIGYVKHKYSYWARQNAPFIEPQFPYGNFKDSNKTSIADLSIQQYNAMKDCGSFFGLYFFLQPLL

MITDLDLIKTIFIKDFNYFPDRGIYHNERDEPLSGHLFSIEGNKWRSLRTRLTPTFTSGKMKMMFPTLKAVGDNFAEYLT

NMVGSGAEIEVKDGVARFTTDVIGSCAFGIECNTFLEPKSQFREFGIQVFDDPLHSGMVRMFLRLFPELGRKLRIKVFRE

EAAKFFHKLVADTIAYRETNSVERNDFMSLLIAMKNKGDLTLDETAAQSFIFFLAGFETSSSNQTYCLYELAFKPEYQEK

ARACVLKAMEKHGGLTYEAVNDMQYLDQCINETLRLYPSVPVLERKTFQDYRIPNSDVIIPKGMKVQIPVFAIQRDEQYY

PNPTVFNPDRFHPDEMAKRHMCTFLSFGEGPRICIGLRFGMLQSRVGLATVLSKYRISPCSRTAIPLEFSVKSGVLQPKE

GLWLKVEPL.

 

>CPIJ003376 CYP6BY4 Culex pipiens 62% to CYP6BY1 (-) strand

MFLITLLITLFFLSITFIKYKFSYWSRQNVPYIEPNFPYGNFKDSGRISIADISAQQYNEMKSRGQFFGMFFFLQPMVMI

TNLDLIKTILIKDFNYFPDRGVYHNLRDDPLSGHLFSIEGNKWRSLRTRLTPTFTSGKMRMMFPTLKAVGDNFGEFLESA

VGGGIEMELKDVVQRFTTDVIGSCAFGIECNTFVDGNSQIRSVSRLIFDSPKHSGKKRLFLKLFPEIGNKLRIKQLNENA

TEFFQKLVGDTIAYRVKNSTDRNDFISLLIGLMNNGDLTLDEAAAQSLIFFLAGLETSSSNQTFCLYELALNQGYQQKAR

ECIHEAMEKHGGLTYEAVSDMQYLDQCINETFRLYPAVPVLERKTFQNYQIPGTKVIIPKGMKVHIPVYGIQRDEQYYPN

PTVFNPDRFYPDAVAKRHMCAFLPFGEGPRICIGLRFGMLQSRVGLATVLSRFRIMPCSQTTIPLEYSTKSTVLQAKGGL

WLKVEPL.

 

>CPIJ003377 CYP6BY5 Culex pipiens 61% to CYP6BY1 (-) strand

MYIELLILVVTLLVLGVFFLRQKYTYWKRQNVPFIEPKFPYGNFQEANQISTADISSKQY

RSMKTSGRFFGMYFFFEPLVMLTDLDLIKTMLVKDFNFFPDRGMYFNEKDDPLSAHMFAI

EGKKWRSLRTRLTPTFSSGKMKMMFPILKAVGDTYSDYVAKIIGSGAELEVKDAVARFTT

DVIGNCAFGIDCNSFAEPNNEFREFGVKIINEPISAGIMRIFWKLFPELGNLLGIKALNV

SATTFFRRLVADTIDYRQKSMVDRKDFMSMLVELKNKGDLTLDEAAAQSLVFFVAGFETS

SSNQAYCLYELALNPDCQEKARESVLKAIEKHGGLNYEAVNDMLYLDQCINESLRLYPSV

PVLERKTFQSYKIPDSDVTIPKGMKIHIPVFAIQRDEQYYPEPLKFNPDRFHPSEVAKRH

SSTFLPFGDGQRACIGLRFGMLQSRMGLAAMLSKFRFSISERTVVPLEYSVQAPILQPKS

DLVLKVEPL*

 

>CPIJ003378 CYP6BY6 Culex pipiens 59% to CYP6BY1 (+) strand

MYVELIILIVSLLILSSIAVWRKITFWSRQNVPFIKPQFPAGNFHEADQLSVADISVKQYNAMKDRGRFFGLYFFLQPLL

MITDLDLIKTMLIKDFNSFPSRGVYYNARDDPLSAHIFSIEGEKWRSLRTRLSPTFTSGKLKIMFPTLKAVGDSFGEYLT

KIAGVGSEIGVKDAFARFTTDVIGSCAFGIECNSFVEPNNEFREFGHKIVNEQLHAGTMRIFWKLFPVLGNLLRVKTLDS

NATQFFHKLVADTIDYRQKHSINRKDFMSSLIELKNKGELTLDEVAAQSLVFFVAGFETSSANQTYCLYELARNVECQEK

ARESVLKAIETHGGLTYEAVNDMQYLDQCINETLRLYPAVPVLERKSSQNYKIPDTDVTIPKGTKIHIPVFAIHRDPQLY

PEPLKFNPDRFLPEEAAKRHPNSFLTFGDGPRACIGFRFAILQSKVGLATMLSKFRISTSAKTAVPLEYTHKSPFLQPKK

ELVLKIESL.

 

>CPIJ003389 CYP6BY7 Culex pipiens 66% to CYP6BY1

MAVALIVLLVCVLLLCIGYVKYQYSYWSRRNVPFIKPRFPYGNFADANRKSIADVAIEQYNQMKNKGRFFGLYFFLQPLV

MITDLDLIKTIFITDFTYFPDRGVYHNFKDDPLSAHLFSLEGNKWRSLRARLTPTFTLGKMKMMFPTLKAVGDNLSEYLS

TAVGSGTELELKDYMVRFTMDVVGNCAFGIECNSFLEPNSEFRMCGKEFFDSPRHSTMMRLFLRLFPELGQKLRIKWLND

HAAGFFYKLVRDTIDYRQKNSVERNDFMSLLIAMKNKGELSMDETAAQSFIFFLAGFETSSSNQTYCLYELAKNPEYQDK

ARECVLKALQKHGGLTYEAVSNMQYLDQCINETFRLYPSVPVLERKAFRDYKIPGTDVIIPKGMKVHVPSFAIHRDEQHY

PDPLRFNPDRFHPEEVAKRHLCTFLSFGEGPRICIGKRFGMLQSRVGLANVLSKFRIFPCSKTAIPLEYSTRSSVLQPKG

GLWLRLEPL.

 

>CYP6BZ1 Aedes aegypti (yellow fever mosquito) 1.702_2 AAGE01408667 50% to 6P2

MAILELYLAIGVTLVLATAGCVFLFLDKKRSFWKDRNFPCTGRAKMIYGDYKNMNQTEHMQYINQRIYNEFKARKLPIGG

TVLFLVPSTVVVDPDLIKAMLVKDFNFFHDRGVYNNPEVDPLTGHLFSLEGQAWRQLRAKLSPTFTSGKMKMMFSTILSV

ADDLKEFLLEKTESGPTELEMKNVLAGFTTDVIGSCAFGIECNSLRATHCRFREVSRKIFEQSVGQMLWMIVLMLFKGVA

TKLKLKATPAEVENFFTNMVQETIDHRERNNVQRSDFMNILIQMKNSTNLEEKLTLNEITAQSFIFFVAGFETSSTTMVN

CLFELAMNPDIQEKLRAEIFKVCGEGDLTYESVSSVEYLNMVIDETLRKHPVVDSLLRTSTQPYNIPNTDLKIPKGTFVF

IPVHALHHDPEYYPDPDRFDPERFNAENRASRHPFVYLPFGEGPRNCIGMRFGLMQTRVGLITVLRNFRVRPSSNTPERL

VVNPKSGIPAPLGGIPLLIERI.

 

>CPIJ005956 CYP6BZ2 Culex pipiens 100% to CYP6BZ2 Culex_quinquefasciatus, 64% to 6BZ1

MDGLQSIFLAIFVTLFLGLATSAWLFLDRRRNYWKTRNFPCSSNPVLFFGDYKDTNKTEH

MSKTNQRLYQDFKARQLPVGGSILFVIQSAIVIDPELIKAILVKDFSTFHDRGVYNNPEV

DPLSGHLFALEGQPWRQLRMKLSPTFTSGKMKMMFETILGVANELRSYLGEKVGSEGSAE

VMMKDLLVGFTTDVIGSCAFGLECNSLRSEKCRVREIALQVFQQSKLQVLKMMFMMIFKG

IATTFKMRSLPAAVEKFFIELVHDTVRQREKNNVQRNDFMNLLIQLKNSEDPDARITMDE

MAAQSFVFFLAGSETSSTAMVNCMYELAMNQDIQDKLRNEITRVCGKGKLTYEAVNSVEY

LNMVIDETLRKHPSVDFLMRTSNSDFPVPNSDLTIPKGTFLIVPTYALQHDPDHYPDPDR

FDPERFNETNCASRHPFVYLPFGEGPRNCIGMRFGLMQIRVGLITMLREFRVLPGVNTPV

PLELDVTSNMPMPKGGVPLLVERI

 

>CYP6BZ2 Culex_quinquefasciatus_32

50% to 6P4 Anoph., 64% to 6BZ1 Aedes

MDGLQSIFLAIFVTLFLGLATSAWLFLDRRRNYWKTRNFPCSSNPVLFFGDYKDTNKTEH

MSKTNQRLYQDFKARQLPVGGSILFVIQSAIVIDPELIKAILVKDFSTFHDRGVYNNPEV

DPLSGHLFALEGQPWRQLRMKLSPTFTSGKMKMMFETILGVANELRSYLGEKVGSEGSAE

VMMKDLLVGFTTDVIGSCAFGLECNSLRSEKCRVREIALQVFQQSKLQVLKMMFMMIFKG

IATTFKMRSLPAAVEKFFIELVHDTVRQREKNNVQRNDFMNLLIQLKNSEDPDARITMDE

MAAQSFVFFLAGSETSSTAMVNCMYELAMNQDIQDKLRNEITRVCGKGKLTYEAVNSVEY

LNMVIDETLRKHPSVDFLMRTSNSDFPVPNSDLTIPKGTFLIVPTYALQHDPDHYPDPDR

FDPERFNETNCASRHPFVYLPFGEGPRNCIGMRFGLMQIRVGLITMLREFRVLPGVNTPV

PLELDVTSNMPMPKGGVPLLVERI*

 

>CYP6CA1 Aedes aegypti 1.1219_3 AAGE01005840 no introns

MLLCLLILGSIATFYLFLHHHYSYWKRRGISQLKPSFAFGDFGPVIRGRANFVHHLQGIYERTKRDYSLLGLYVLFRPAL

LVNDFVVARDILSRDFQHFGDRGIYVDEKRDPFSGHLFALDGERWRHVRHKVAPAFTPLKLKDVFQTQLIGGVVLQDHLK

HFAESGQSVDVADLFLRYSVDMIASVAFGVEIDSVNCPEEQFYRVAHSSVESNVKNLLRWTGGFLIPKVLKYTGTR LVDQ

HVQDFFMHVVQQTVEYREKTGFTRRDVLQSLLKIMNAESQNVSIDFTITDLTVTAFTFLLAGMETSSSTATFCLYEIVNN

QEIQRRLQKEIDESLQEHDGLITYDSVVAMKYLDHCVNEAMRKFPALAYLHRICTEDYLVPSTRTIIKKGTLVLIPIYAL

QRDQEFFPHPDLFLPDRFNDPEAIRQAPFFPFGEGPRSCIGQRMGKMNVKIALVHLLSRYNFTLANPVDQGREAPIDPLH

FTISPQGSFNMNVTHRKCSSPSSHSKSLTNHSVSLAH.

 

>CYP6CB1 Aedes aegypti 1.48_4 AAGE01206812

MLLPILLVVLVVYLFQKWTYSHWKRRGVPQLNPAFPFGNVADTFKQRTSYSNRLAELHHQAVRDGHRFVGIYTLLQPILL

VTDVELVKRMLTVDFEHFVDRGAHVNEKRDPLSGHLFSLTGAKWRRMRLKLTPAFTTAKLKAMFPTMMACGRTLSAVIDD

HVGRALAIRDLMTRFTMDVIASVGFGLECNSMRNPDELFRQMGGRFFSKSWKTSVRMLLAFVAPKVNRYLQVKLNDDDVE

EYMLNLVRDTIAKREGGGEVRKDFIQLLVQLRNQVEVKDGGSWEMNKVDQNKTLTVEEMAAQSFVFLNAGYETTSSTVTF

CLFELCRNKDLIGKVQEEIDRVMDGGREISYEALAEMTYLESCIDETLRKYPISPVLFRVCTKPYKIPETDVVIEKDTLV

QISLVGLQRDTRYYEDPMKFDPDRYGERKSETMPHYSFGDGPRVCIGLRMGKVMAKMALVELLSRYDFELESPAADSGEI

ELDPSLLMLQAKHDVKLIPRLRTK*

 

>CYP6CB2 Aedes aegypti 1.1337_1 AAGE01003592

MFLVILLITLSLYLYQKWIYTYWKRRGVPQLNPSFPFGDVADTFKQRKSYANRLAELHHQSASDSHRFVGIYTLFQPILLVTDVELVRRMLTVDFEHFTDRGAHVNEKRDPLSGHLFSLAGAKWRWMLQKLAPAFTSAKVKSMFPTMMTCGRTLSAVVGDHLGRALPIRALMTRFTMDVIASVGFGLDCNSMRNPDEPFHKMGSKFFSKSWKTSVRMLLAFVAPKVNRFLQLKLNDDDVEEYMLNLVRDTIAKREHGGEVRNDFIQLLVQLRNQVEVEDGGSWEINKVEPNKALTVQEIAAQSFVFLNAGYETTSSTITFCLFELCRNRDLLGKLQEEIDEVVDGGREASYEAITEMTYLEACVEETLRKYPISPVLFRVCTKPYRIPDTDFVIEKGTLVQISLVGLNRDPRYYEAPLKFDPDRYGERKAETMVHYSFGDGPRGCIGLRMGKVMVKMALVELLSNYDFEMESPTGENELDPSLLMLQPKHDVILIPKFM*

 

>CYP6CC1v1 Aedes aegypti 1.1327_5 AAGE01083421b 17 diffs, new gene or allele?

MISGTVCIVLVLANVAFLVLFVRGVLQSRQVYWVRRRIPFVAWPHLLFGNVRRLWRHEHSSTIGQRLYRDLKARRLAAGGFNLLVSPSILVADPDLAEEVLVGNVRRFPDRGLHVDAEVDPLSETLFALSGNSWQDKRNQLTPVFSEETLKPVFRMIASFADELRKEISKNLDRRLQDVQEWVSRYVTQVMGKSVFGMRCRMMQDPNTDFRRYGRISTELSWLLLLKNWIGVTMPWIARKVGLRITDATVEKFYVDLCRSNVLVRESYKVKENDILQLFMRLREARQLTMEELTTACYSFVKHGMEPCTSVMTFCLYELAKNVSIQKRLRDEISHYLEDTDGQLTYDVIMSMNYLDQVVNETMRKYPPVDFIYRRSSQSRDNIPQGTLFVIPVYAFHHDPDHFPAPEKFDPERFTAKQARTRHPYCYLPFGAGPRECLGARFGLLVVKAGLVTLLRRFRFAMPEELVHEKLQFKPNASVLSPVEGSVRLRVEAI.

 

>CYP6CC1v2 Aedes aegypti AAGE01083421a

MISGTVCILLVLANVAFLVLFVR

GVLQSRQVYWVRRRIPFVAWPHLLFGNVRRLWRHEHSSTIGQRLYRDLKARRLAAGGFNL

LVSPSILVADPDLAEEVLVGNVRRFPDRGL HVDAEVDPLSETLFALRGNRWKDKRNR

LAPVFSEETLKPV FRMVASFADELRKEISINLDRRLQDVQEWVSRYVTQVMGKSVFGM 202

203 RCRMMQDPNTDFRRYGRISTELSWLLLLKNWIGVTMPWMARKVGLRITDATVEKFYVDLC 382

383 RSNVLVRESYKVKENDILQLFMRLREARQLTME 481

482 ELTTACYSFVKHGMEPCTSVMTFCLYELAKNLSIQKRLRDEISHNLEDTDGQ 637

638 LTYDVIMSMNYLDQVVN (1) 688

745 ETMRKYPPVDFIYRRSSQSRDNIPQGTLFVIPVYAFHHDPDHFPAPENF 897

898 DPERFTAKQARTRHPYCYLRFGAGPRECLGAR

    FGLLVVKAGLVTLLRRFRFAMPEELVHEKLQFKPNASVLSPVEGSVRLRVETI*

 

>CPIJ005954 CYP6CC2 Culex pipiens 100% to CYP6CC2 Culex_quinquefasciatus

MFATLPAVALLVVALFGLYIRRILHLRRAHWLSRRIPFVGWPHILFGNVRGIWSVEHSST

MQQQIYQELKERRLAAGGFNVFFSPSIMVVDPELIKQILVTDANVFDDRGLYRDKLCDPL

NYTLFGSTGEVWQGLHENAMRLLTAESVKGMFGLVAGVADELRLQILKTIDRQRLDIHDL

AVRYSTHVIGTSVFGIRCRTIQVGCTEFREMGRRANEFTRLVLFKQWLGVSFPRFARILG

LKMIDSPVEEFFIGLCTATVLHRESYGVEKDDFLQSYIHLRRDKRLSMEELTAQCYSFVK

NGLETCSSVMTFCLYELASAPAIQDRLRNEINHSLEDTDGQLTYEVINSMTYLDQVINET

LRKYPPVDYLMRRSKTTYNHIPDGTLFIVPTYALHHDPDHYPEPEKFDPERFAPSAVRKR

HPYSFLPFGAGPRNCIGVRFGTMLVKTGIVTMVRSFRFTRRGGDDGLRFKPSSLVLSPAE

GSMGCVDVKRI

 

>CYP6CC2 Culex_quinquefasciatus_35

53% to CYP6CC1 Aedes,  44% to 6AD1 Anoph.

MFATLPAVALLVVALFGLYIRRILHLRRAHWLSRRIPFVGWPHILFGNVRGIWSVEHSST

MQQQIYQELKERRLAAGGFNVFFSPSIMVVDPELIKQILVTDANVFDDRGLYRDKLCDPL

NYTLFGSTGEVWQGLHENAMRLLTAESVKGMFGLVAGVADELRLQILKTIDRQRLDIHDL

AVRYSTHVIGTSVFGIRCRTIQVGCTEFREMGRRANEFTRLVLFKQWLGVSFPRFARILG

LKMIDSPVEEFFIGLCTATVLHRESYGVEKDDFLQSYIHLRRDKRLSMEELTAQCYSFVK

NGLETCSSVMTFCLYELASAPAIQDRLRNEINHSLEDTDGQLTYEVINSMTYLDQVINET

LRKYPPVDYLMRRSKTTYNHIPDGTLFIVPTYALHHDPDHYPEPEKFDPERFAPSAVRKR

HPYSFLPFGAGPRNCIGVRFGTMLVKTGIVTMVRSFRFTRRGGDDGLRFKPSSLVLSPAE

GSMGCVDVKRI*

 

>CYP6CD1 Aedes aegypti 1.138_1 AAGE01126587

MILTTVFLIGLLYKNPVAFFLVIVAGLLVRELIKYHFRHWERCNVPGPKPSLIFGNIASNIFLRQHFAEMIDGWYNKFPN

APFIGFYKIFKPSVMIRDPEMIKNVLVRDQACFSANDFAFDEKLDPLLAHNPFMVSGERWKKSRQLLTPIFTGSKMKQLF

PIMDEISSQFVDFVGRQCGREVEAKSISAAYTTQNVAGCAFSLDADCFNNPNSEWRVMGKKIFQPTLLAGIKFMLMLFVP

SVTWFIPVPFLPKEVDRWMRKLVSTLLQERKNKQPERDDQLQSLLKTKSAELTEEQIAGHSLAFFSEGFETSSTTMGFAI

LHLAENPDVQEKLFQEIQNTLGKNDIPLTFDLVQKIEYLDWVLQESLRITPPAAGLQKLCTQNYCLKYKVDGKEVGTWIM

PGTTVLIPIVAVHMDPKYYPEPEKFRPERFSPEEKAKRTDPVYYPFGEGPRMCLGMRFAQIQIKMALLKLVQQFRVRTSP

NYKPWQYNRNTFLTEAKDGLQVVFERRS.

 

>CPIJ018494 CYP6CD2 Culex pipiens 63% to CYP6CD1

MIVTATFLLGLAYTKPMVFALVVFVGFLILALLKYNFRHWQRENVPGPKPSLLTGNLGPT

LTMKKHIGQLCEEWYKKFPSEPFIGYFKVFKPAVMLRDPDLIKSVLVKDFGSFAANDFPL

DEKVDPLLAHNPFMVTGERWKTSRQLLTPIFTVSKMKQLFPMMEQVSKQFVEYVGRHGGQ

RRGGKISAAFTTQNVAGCAFSLDAECFDNPKSEWREMGKKVFQPTFLAGIKFTLMMFLPV

VTHVLPVPFVPTEVNEWMRNMVSKLLSERRAKPVQREDQLQSLLNLKTKTELTEEMIAGH

SLAFFTEGFETSSTTLGFLIYNLAANPGVQQKLYEEIKAAMEANNDTLSYDVMQQIDYLD

WTLQESLRINPPLASMTKLCTKNYSLKREINGQLVGTWIKAGTPVLIPLLAIHMDAKYYP

EPQKFRPERFSPEEKVARGNQMVYFPFGEGPRMCMGMRFAQTQVKVALLQLVLNFRMTVS

PNHKPFALDTRTLLVQAKDGLTVRFERR

 

>CPIJ017609 CYP6CD3 Culex pipiens 56% to CYP6CD1

MILTVTLLCALSYAAPRLGLLVTVAGFACRALLNLHFQHWRRRNVPGPEPSVLTGNLGPT

FSQTKHLAELCDEWYHEYPGEPFVGFYKVFTPGVMIRAPDLVKAVLVRDYASFSANDFPV

DAEADPLLIYNPFVVDGDRWRKSRQLLSPLYTASRMRQLFPAMERICDQLVEYVGGHVGR

DLEAKAVSATFTTQNVARCAFSVDADCFRNPDSEWRVMGRKVFQPSLLAGIKYMLVLFLP

FLTNVLSVSITPKEVNEWMINLVSGLLKERKNSKKETEDQLQTLLNTKSKIELNEELIAG

QALSFFTEGFETSSAALGFLIYSLAANPHVQDKLYDEIEQALKSYDNTVSYAMVQKLDYL

DWTLQESLRIKPPLGVMQKQATKDYILKREINGQLEGIWIRAGTPVLIPLLSIQNDPSYF

PNPDEFRPERFDPREKTTDPGRMVYFPLGEGPRMCVGMRFAQTQIKLALVRLMLNFRIVV

SPNHKPFRMDAGKFPVESRDGLLVRFEKRE

 

>CYP6CE1 psocid, Liposcelis bostrychophila Jiang Hongbo 1/31/07

EF421245.1

MAILTSCWCIDLGIILIGAFIGIYNFYQKKFKHWKKYNIPHSKPKFPFGDLISITTMGEN

FVLTLDRIYKSFEKEKVGGIWAFFHPILIVRDVEVIKDILVKEFMSFHDRGVPVDEKNDP

LSAHLFSISGSKWRNLRAKLTPTFTSGKMKMMFPILVESGREMISILEPNAINKDIVEMK

DILARFTTDVIASCAFGIDSNSLKNPDTEFRKMGRKIVEPSFANILRNFSFMAMPTLVKI

FKIKLIPEYLANFFMGSVRETMDYREQNNVKRNDFMQLLIQLKNKGKLDDVDEIKEKTDD

GNEIKELEVEENRSDQKFSFEEAAAQAFIFFVAGFETSSTTMVLALYELALQPEIQEKVR

NEIKTVLGKHNGKITYEAAFGMDYLGNVIDETLRKYPVAGVIIRQCNKDYKIPDSDMVIP

KGTSTHIPIYSLHYDSKYFPNPEKFDPDRFTEEVKSQRPRYAYLPFGEGPRHCIGMRFGL

MQTRVGLIELLLNYKFEICEKSPVPLKFSSMSFTPKEGMHLRLSKVN

 

>CYP6CE1v2 psocid, Liposcelis bostrychophila EU266572

1 aa diff to CYP6CE1, DDVP resistant strain

MAILTSCWCIDLGIILIGAFIGIYSFYQKKFKHWKKYNIPHSKP

KFPFGDLISITTMGENFVLTLDRIYKSFEKEKVGGIWAFFHPILIVRDVEVIKDILVK

EFMSFHDRGVPVDEKNDPLSAHLFSISGSKWRNLRAKLTPTFTSGKMKMMFPILVESG

REMISILEPNAINKDIVEMKDILARFTTDVIASCAFGIDSNSLKNPDTEFRKMGRKIV

EPSFANILRNFSFMAMPTLVKIFKIKLIPEYLANFFMGSVRETMDYREQNNVKRNDFM

QLLIQLKNKGKLDDVDEIKEKTDDGNEIKELEVEENRSDQKFSFEEAAAQAFIFFVAG

FETSSTTMVLALYELALQPEIQEKVRNEIKTVLGKHNGKITYEAAFGMDYLGNVIDET

LRKYPVAGVIIRQCNKDYKIPDSDMVIPKGTSTHIPIYSLHYDSKYFPNPEKFDPDRF

TEEVKSQRPRYAYLPFGEGPRHCIGMRFGLMQTRVGLIELLLNYKFEICEKSPVPLKF

SSMSFTPKEGMHLRLSKVN

 

>CYP6CE1v3 psocid, Liposcelis bostrychophila EU266573

6 aa diffs to CYP6CE1, phosphine resistant strain

MAILTSCWCIDLGIILIGAFIGTYRFYQKKFKHWDKYNIPHSKP

NSPFGDLISITTMGENFVLTLDRIYKSFEKEKVGGIWAFFHPILIVRDVEVIKDILVK

EFMSFHDRGVPVDEKNDPLSAHLFSIEGSKWRNLRAKLTPTFTSGKMKMMFPILVESG

REMISILEPNAINKDIVEMKDILARFTTDVIASCAFGIDSNSLKNPDTEFRKMGRKIV

EPSFANILRNFSFMAMPTLVKIFKIKLIPEYLANFFMGSVRETMDYREQNNVKRNDFM

QLLIQLKNKGKLDDVDEIKEKTDDGNEIKELEVEENRSDQKFSFEEAAAQAFIFFVAG

FETSSTTMVLALYELALQPEIQEKVRNEIKTVLGKHNGKITYEAAFGMDYLGNVIDET

LRKYPVAGVIIRQCNKDYKIPDSDMVIPKGTSTHIPIYSLHYDSKYFPNPEKFDPDRF

TEEVKSQRPRYAYLPFGEGPRHCIGMRFGLMQTRVGLIELLLNYKFEICEKSPVPLKF

SSMSFTPKEGMHLRLSKVN

 

>CYP6CE2 Liposcelis bostrychophila EF421246

MALLTSCWCTDFALLFIGAFIGVYYFYQKKFKHWDKYKIPHTTP

KFPFGDIGLTTINENIVISLDRIYKSFPKEKVVGLWSFFQPILIARDAGVIKDILVKD

FMNFHDRGIPVDEENDPLSAHLFSLGGSKWRNLRAKLSPTFTSGKMKMMFPILVQTGN

EMPKILEPKAANKETVEMKDILSRFTTDIIASCAFGIDSNSLKDPNVEFRTMGKKITE

PTLGNVLRNLVFLVPKMAKALKIRIFPADMSDFFLNLVRETIDYREKNNVKRNDFMQL

LIQLKNKGTLDDVDEIKAKLDNVESNEEEKKTVQTFSVEEAAAQAFLFFIAGFETSST

TMIFALYELALHPEIQEKLRNEIKKDLAKNNGEITYEAVFGNEYLGNVVDETLRKYPV

AGLLLRECNKDYKVPNSDMVIPKGTSIQVPIYSLHYDPKYFPDPQRFDPDRFKEEVKS

QRHRYAYLPFGEGPRNCIGMRFGLMQTRVGLVQLILNYKFEICEKSPVPLKFSNVSLT

PKEGMHLRVSKLN

 

>CYP6CF1 Pediculus humanus humanus Ph6-3 516aa 4 exons 1103172107895 plus (167174-168074,168342-168560,168639-168890,168965-169140) similar to  Tc6BQ13,  40% to 6N5 Ag

MDAIAVNSWWFIYFGTFIGTLLALMYYYVTSNNDFWDKLNVPYIKPEFVYGNMKEIAKCVKSQNEAVWEFYQYFKKLGHKYGGIFQLRDPVMIICHPQLVKDVLVKNFPHFHDRHIAHDEHFDPLSAHLIALEGSKWKYIRSKLNPAFSTSKLKGMFQSMTNICNELIKNLNGAAEEGKMLDARDFLGRYTVDIIGNVAFGIDVNAMKEDSEFLHMGQKFFEPTQFERVGQIIANTNYWMYKIFKLRMVSKKVTDFFINVVNNTMTYRRENNVERNDFLHFLMKINETKGTDLKDMDEMKE(1)LTEGVIAAQAFVFFVAGYETSSSAMSACLFELAHHPEIQEKLYEEVTQVLKTNDDVTYDSVQQLTYTEQVLEE(1)TLRLYPPVGILLRKCTQPYEIPETSIILPKGCQLFIPVYAFHHDPEYFPDPEEFNPERFSSENRKNIPPYAYMPFGHGPRVCIG(1)FRLAMMEMKLTLALIIKNFKILKCEKTKPFKMCPSSFFLVPKDGFWIKVIKRNENLLI*

 

>CYP6CG1 Pediculus humanus humanus Ph6-6 534aa 6 exons 1103172108300 plus (16013-16406,16506-16858,16934-17153,17250-17456,17542-17796,17937-18109) similar to  Tc6BQ8, 

44% to 6CE1 psocid, Liposcelis bostrychophila, 55% to Ph6-9i

MSTFEIVAQTTTLFFTLQYSFLPISIILATFYYFHFKFIGSKYWKNKNIFHLKPNFLIGNIWKVNFLKSFASELNEIYYKYKNEKLIGFWMFTKPVLLVTDLNLIKNILIKDFEYFHDHGLPVDFNVDHLAG(1)HLFNLSGSKWKNLRIKLTPTFTSGKMKQMFRLMNECGRQLQQHVRSNLNKSLEVHDLFSRYGTDVISSCAFGIETNSMTNPNSDFRIYGKKIFESNFSRKISRTIFLTFPKFAYFFG(0)FRLISKDVSDFFTNAVKETMEYREKNKIIRNDFLHLLMQLKNNGKIDDGEQHLNGGGETTTTTTNGISTKDSIE(1)AAAQAFVFFFAGFETTSSALTSAMYELALNPGVQKKLQFEIDDVREKHDGEITYESLTEMQYLNSVVQE(1)TLRKYPPIFGLTRHCTKDYTVPDMDGVTIPKNSRLFIPIQAIQNDPDYFVDPDKFDPDRQTPEERQKRNYLTSLHFGEGPRYCIG(1)NRFAINQIKIGIVSLLSRFEVFETEKTPKIIKYKLDSVILEPKNGLHLGFRERTANI*

 

>CYP6CG2 Pediculus humanus humanus Ph6-9i 396aa 5 exons 1103172107451 plus (3-144,290-648,795-996,1103-1333,1460-1711) similar to  Tc6BQ2,  incomplete, missing N-term and last exon on C-term, upstream from Ph6-10i 51% to 6BQ10 Tc

54% to 6CE1 psocid, Liposcelis bostrychophila, 91% to 6CG3

N-term from EST seq CB887363.1 Pediculus humanus corporis

CYP6CG2 C-term Ph6-4f 93aa 2 exons 1103172108418 plus (44-162,238-398),  last two exons on C-term, upstream from Ph6-5f 52% to  Tc6BK5, 56% to 6AM1 Hodotermopsis sjostedti, 48% to 6CG1 C-term only

exact match to CYP6CG2 for 39 amino acids, probable C-term seq. (also 100% to CYP6CG3 C-term 27 amino acids)

green seq above

28  MSYFLFELFFAIFLGILAYYAYFKLYISKYWKNHNVFHVEPIFIVGNTYNASITKNLWEI  207

208 INDFYFKWKEK

240 KMIGIWI

FSFPILIPADLTIIKNILIKDFDYFQDHGPLPNINREPLTG(1)

HLFNLTGAKWRNLRVKLTPTFTSGKMKNMFPLMVECGNLLKNYMEDHIGQENSIEVKEVLCRFTTDIISSCA

FGIESNSLKNPDSEFRKYGKKVFDAEGIRRFIVVFFNLLPELFDILR(0)

LRIIQKDVSDFFLNAVQETIEYRQKNNIKRNDFLQLLIQLINNGKLDDVDNIKEGGEDINEKNTQSSD(1)

DMKFGLNEAAAQAFVFFLAGFETSSTTMTFALYELARNEDVQEKLIDEIDRILIKYDNKITYEGISEMHYLDWVIRE(1)

TLRKYPPLPILTRICNKDYKVPDTDVVIKKGTNVFIPAYGIQRDP

(2)SKIYPDPEKFDPMRHAPEEKSKRENISALYFGEGPRICIG(1)

NRFGFFQVKVGLLTLLSSYRVSPCEKTPSQLKFNVGSLVLTVEGGMHLNFKKR*

 

>CYP6CG3 Pediculus humanus humanus Ph6-10i 339aa 4 exons 1103172107451 plus (1833-2198,2306-2507,2597-2827,2941-3156) similar to  Tc6BQ2,  incomplete, missing N-term and last exon on C-term, downstream from Ph6-9i, upstream from Ph6-11

53% to 6CE1 psocid, Liposcelis bostrychophila, 91% to 6CG2

CYP6CG3 N-term Ph6-5f 112aa 1 exon 1103172108418 plus (922-1255) similar to  Tc6BK5,  only first exon on C-term, dowstream from Ph6-4f 38% to CYP6AS13, 90% to louse EST CB887363, 48% to 6CG1 N-term only

probably = N-term of CYP6CG3 Note: YS (red) probably in the intron

MSYFWFELFFAIFLGILAYYAYFKLYISKYWKNHNVFHAEPIFIVGNTYNASITKNLWEVINDFYFKWKEKKLIGIWSFSSPVLVPTDLTIIKNILIKDFDHFQNHGPLPNIDR

XXXX (1?)

YS (1) GNLFNLTGAKWRNLRVKLTPTFTSGKMKNMFPLMVECGNLLKNYMEDHIGQENSFEVKEVLCRFTTDIISSCAFGIESNSLKNPDSEFRKYGKKFFTSDGSRKFLIVFFNFLPKLFNLLR(0)

FRIIQKDVSDFFLNAVQETIEYREKNKIKRNDFLQLLIQLINNGKLDDVDNNKEGGEDVNEKNIQSSD(1)

DMKFGLNEAAAQAFVFFLAGFETSSTTMTFALYELARNEDVQEKLIDEIDRILIKYDNKITYEGISEMHYFDWVIHE(1)

TLRKYPPVPILIRLCNKDYKVPDTDVVIEKGTTVFIPAYGIQRDPKIYPDPEKFDPMRHAPEEKSKRENISA

 

>CYP6CG4 Pediculus humanus humanus Ph6-7 395aa 5 exons 1103172108239 plus (259-617,715-901,1084-1311,1383-1634,1708-1868) similar to  Tc6BQ2,  missing first exon on N-term, upstream from Ph6-8

53% to 6CE1 psocid, Liposcelis bostrychophila, 54% to 6CG1

(1)HLVNLKGSKWRNLRVKLTPTFTSGKMKNMFPIMIECGYQMQNYLSKYARTGEIIEFKEIFSRFTTDIISSCAFGIETNSINNPESEFRNYGRKIFEPSFFFVIRFILTSFFPKVRDFFG(0)LRSIQKDVSDFFINVVKETMDYRERNNVKRNDFMDLLIQLKNKGKLDDVDIDDKYKKDLVSEE(1)QTFSLNEAAAQAFVFFAAGFETSSTTLSFAFYELAINPEIQKKLQNEIDEVLNENDNKLTYQSIIDMKYLEQVIME(1)TLRKYPPLTLLGRMCTTDYEIPEMGVKLEKGTRVIISLLGLQRDPDHFPNPDLFDPNRFSQEEISKRDHFTSMPFGEGPRNCIG(1)NRFGLLQTKIGIVSVLSKFSIKPSEKTPIPMIFSKKSFILTPAAGMFLKIVER*

 

>CYP6CH1 Pediculus humanus humanus Ph6-8 497aa 6 exons 1103172108239 plus (8055-8358,8443-8801,8885-9050,9157-9387,9469-9720,9805-9983) similar to  Tc6BQ2,  downstream from Ph6-7

39% to 6CE1 psocid, Liposcelis bostrychophila, 40% to 6BK4 Tc, 60% to 6CH2

MCVIGFYKNQFNYWKNKNVKMTNPWFPMGDIFQAGFYKNFGIVLKEIYDKFPGERLNGCWFFYRPFLMIRDPELIKIIFVKDFEYFKERGVYLNKKIDPLGA(1)NLFFLKGKKWRNYRTKLTCNFSTGKMKKMYQIMLEKSLELRENLEKFSDCGQTINVKYFAERYTNDVASCCLLGFQGKCIQDPNSILPIMGNKIFEPSWKTLIKNSISFLVPDIGIIFR(0)VRVTPDDVTSYFTQTLENVIKMRENENNNNDNKGYNDVIQMFINWKNENHLFSNDN(1)DFSFTIEDAIAQAFIFWVGAFEFTSLTIQFALYELSINTQIQDKARKEINEICEKFDGILTYEALSHLEYLTRVVNE(1)TLRKYPPVPLLLRKCVKEYRVPDSNVVIEKGTPIIISVLGLHMDPKYYPEPEKFDPERFTDEEKIKRHKYTYLPFGEGLHQCLG(1)LRFSLIQIKICLANLLTKYKFDVASQTPKKLKFCPKLILYTVENGIPLRIKKLQDHQRT*

 

>CYP6CH2 Pediculus humanus humanus Ph6-11 511aa 6 exons 1103172107451 plus (4921-5248,5330-5688,5759-5954,6047-6277,6374-6625,6707-6873) similar to  Tc6BQ2,  GC-donor on 3rd intron, downstream from Ph6-10i

45% to 6CE1 psocid, Liposcelis bostrychophila, 60% to 6CH1

MYVGLFTLIALFGFYKKNFNYWKNKNVKMTNPWFPLGDISRAGFYKNIGIVMKEIYDKFPGEKFNGCWVFYRPHLMIRDPELIKTIFVKDFNYFRDRGLYFNEKTDPLSA(1)NLFFMGGNKWRSLRTKLTSNFSSGKMKKMFENMHEKSLELQKSVKDFAEKDKIIEPKYFTVRYTHDVAATCLLGFQAKCLTNNDSILPYVGHKVFEDTWTNIIKIAVSVFVPDIGTLFR(0)IKITPKDVTNFFFNTVKDVMEFRESQNKDGGFNDFMQTLVKLKKEGYTEYEDVKDCCNENITTTVE(1)KCLFSTEDALAQAFIFWMGAFESSASTMQFALYEMSLNNLIQEKARQEVKSVLKKFNGQLTYESLPYMEYLGRVVDE(1)TLRKYPPVSVLTRVCLKKYKIPESDVVIEKGTPLIITVLGLHMDPNYYPNPEKFDPERFTEEEKRKRHHYAYIPFGGGLHQCMG(1)QRYGLMQIKIGLANLLVNYKFDISFKTPQRAKICRKNVLYTVRNGIPLKISKLED*

 

>CYP6CJ1 Pediculus humanus humanus Ph345 519aa 5 exons 1103172108318 plus (455289-455679,455762-456298,456379-456591,456680-456934,457024-457184) similar to  Tc345A2, 

47% to CYP6K1 Blatella germanica, new CYP6 subfamily, 45% to 6CG2

MDYYYVTLLIIIISALTWFIYALANRNCNYWKNRNVPYVSPVPFFGNLKSLLFLEKNVGEFLGDLYNSEKLPDHGFYGIYLTNNDPALIIRDPELIRNICIKDFQHFSNRNATSDEKNDPLGYNNLFTLTG(1)SKWKFIRTKLTPTFTSGKMKQMFTLVKETSDELIRYLNENSKEKNYTIMETKRILAKFTVDVISTCAFGIKSNCLRDEKSTFGFFSDMIFETTVKRAYEWRAFFFVHWMIKGLGGVFLRKESTEYFRKVFDETMKERESQKIFRNDFVDNLIKLKNEQEEKLKKEENGKKTFDKDEIFG(1)DLLLAQSVAFFTAGFETTSTTMTYSLYELALNPEVQEKLREEILRSMEKHDGCLTYDGIMEMNYLSMVVSE(1)TLRKYPPLPFLDRICTMDYKIPGTDVVVKKGTPIYIPLFNGLHYDSKYYPEPEKYIPERFTEENKKTRHPYSYLPFGEGPRTCIG(1)ARFGSMVSKIGLCAILSNFKVETCSKTAVPLEQNHRSLLFCTKDGCFLKYTKL*

 

>CYP6CK1 Philotrypesis sp1 (Hymenoptera: Chalcidoidea: Agaonidae) non-pollinating fig wasp, EU661087

FFIAGFDTTSSVIIHTLYELSLNPDEQEKVHQEIDELLELHEGFNYENISQLEYLKMSLY

GKYRLLCAKIGVTLHLTTKNFYILEAMRKHSSAPFLARVCVKDCALPNSDYVVPKGMNVI

IPVTGLNYDPDIFPDPEKFDPTRFSKDNIAARHPFAYLPFRAGP

 

>CYP6CK2P Nasonia vitripennis (jewel wasp)

MFETVGSVLNSKLFWISAIIFVFYSYFKLIIYSYWKRHATPHDKPTVPFGNVG

MDLITKKC AKMKSSYDKYKKHPFHGLYMFHNPTLMVNDPEVTKYVLVKEF

AHFHDRGMYFNDKIDPISGHLFFMTGDR*RALRIKLSPSLTSGKLKNMYPFVQ

EIADEMVNIANENLEKTDVLEIKELVAR YTTDTIFSLAFGFNANHLRNPD

SEFRHYGDLSIKNVPVINAMAAFTPYILEFFKILFTNAKATAFFIKLFKDMVV

QRKMEKKDFLNLLIELMDHGQIRDQEGENGTDEPGITQPFPTYYILKS ET

SSSIVTHTL*ELALNPDEQEKLHQEIDELLQRDGGFNYENLMHLEYLEMAFYE

TIRKHPSVPFLNRICAKDCKLPNSDFVVPEGMPILISISGLHRDSNIYPD

PDKFDPTRFSKENIAARHPYAYLAFGKAPKICIG KRLGIMMSMVALATLL

SKFKFSVCDRTPIPNRYSLNSILQMPRDGIHLGMEKRKK*

 

>CYP6CK3 Nasonia vitripennis (jewel wasp)

MELLLLFALLLFVLYFYLKYVVYDVWRRAGIPHDRPSIPLGTLPLDYIRRKAT

LG SILTNSYKRYKRFPLHGVYVIYKPVLVITDPKIIQLVLVKDCNIFLDR

GFYADPEKDLISLSLARVNGERWRILRRQLSSSFAPKKIKFMFLMVKEFCERL

IEIYEDELRESDVVRIDELTSR FTIDCAFATLFGFNCNLLKNPDNDFYKY

GKQSNEQGVIYSIISFFLPELAALCRIPKVRRDTNSFFERFFENMIDCQKKKN

MAENNLLGAMMQLMKV DENTKLTTQEAAAQLVTFFAPSQGMPAFVIIHCL

YELSLNPEVQERLYKEIYETACRSEELTYRTLSELSYLNLVLQE TLRKHT

PLPVLNRIAIEDFSIPDSDIVIRKNTRIAISTHGLHHDPDIYPDPEKFDPTRF

TPENKAKRHSSTYLPFGTGPRFCIG KQQGILIPKLALFYLLLNYKFSVCD

NTPANLEYLPEHLILILKNEIYLRIEKRKELDHVHQPDFR*

 

>CYP6CK4 Nasonia vitripennis (jewel wasp)

MEPLSAILYTKTFWITSLFLTIYLYLKYVVYNVWANRGVPHDPPSIPLGNIPV

KYFQGKTTHG AIVKESYDRYKTNPFYGMYMLYMPILVVKDPELIQLILVK

HFNSFYNRGTLYNESKDPLSTGLVRLYDEKWKRLRVKLSPTFTSGKLKLMYPL

VKEICDELLRVYEDVLDKSDVVEIKDITNR FTIDCISSIAFGFNCDSLHQ

PDNEFLKYGKISNDLGRVFLIFSFFVPRLVSLFPIPEKRKKVSEFFYDLFEKM

VSHRRKDKTVRNDFLNMLMQLMDHGKVEEDDDAPSKSNSLTKI TDADKIT

MVEAVGQSMFFFAAGQETTASAITYCLYELSFNQDIQEELYNEISQVAHSPEG

LTYEKLFSMPYLDMVFRE TLRKHPGAPMLNRQASEDFVVPGSHFVIKKGT

RIVIPIKALHADPDIYPDPDKFDPTRFTSENKAKRHAFTYIPFGEGPRHCIG

KRLGILKPKIALFYLLLNYKFSVCDKTPIPLRYMTDYFVQVPAGQVYLKVE

KRNGTLSDKASRPWNSAN*

 

>CYP6CK5 Nasonia vitripennis (jewel wasp)

MDFYEDLVYSKLFWATTVLFGVYLYLKYIMYNCWSRNGVPHDSPSIPLGNVPF

SYFTENVPHG EIIKSSYEKYKNHRYHGLYILNEPILVVNDPELIRLILVK

NFTNFCNRGTYYNESTDPLSCALPRLVDDKWKRLRAKLSPTFTSGSLKKMYPM

FKEICDKLVKTFDTALDESDVLEMKDIASR FTMDCISSIVLGFNVNSLQN

PEHEFRKYGKIVNDFGKVFVLLSFYVPDMIDFYSFIPKKRKKVHAFFVYLFQK

TVAYRRAKKIVRNDFLNMLMQLMDRGYVENEFEASSTNV SDDDRLSMTEA

VAQSVIFFAAGQETTSSALCCCLYELALHQDVQKKLQWEIDQAFASPEGLTYE

KIFEMPYLDMVLCE TLRKHPGAPVLNRISLADLNVPDSKFRIPKGMRLVI

PVNGIHSDPNVYPDPDRFDPSRFTPENRAKRHPLVYLPFGEGPRHCIG KR

LGVLKPKIALCYLLKNYSFFSCDKTQPRLSYMSNSFVQVPAGGVYLRVERRRQ

ERTEASP*

 

>CYP6CK6 Nasonia vitripennis (jewel wasp)

MLEFTYSQLFWITAVFAAVYAYLKYYLYNYWNRYNVPNETPSIPLGNVPLDFL

RGKIHYG GFIDSIYKKFKHYRFCGIYVFHKPILCINDPELIKLILVKDFD

LFPDRGWFYDGKIDPMSSHLFLLPGEKWKRLRVKFAPIFTSGKLRQMYPFLVE

ISKHMIKTCDAELKTTDTVDVNDILAR FTTDVISSIVYGLDSKSLDDPKS

EFRTKGVKALSFGSFNLLVALFAPEMMSWATVPLYQENVSEFFLNIFKEAVNY

RRKEKIQKKDFLDLIMQLIDSGKVDDENKILQTNGKNSE HFDKLTIEEAA

ANAFVFFLGGYETSSSTTSFCLYELAQNPEVQEKLQAEIDEVVRSLTGLTYES

IAEMEYLDMVLSE TLRKYPSGATLNRIAKEDYPLPNTDFVIKKGMRIIIP

LSGIQNNPEYYPDPEKFDPLRFTKEKVAARNKYVNIPFGDGGRICIG KRF

AVMQVKIVLTAMLYNYQFSISQKTQVPPKYETRNFTQIARNGVHLRVERR*

 

>CYP6CK7 Nasonia vitripennis (jewel wasp)

MLEFTYSKLFWITVVLAAVYAYLKYYLYNYWNRYNVPNETPSIPLGNVSIDYL

RGKIHFA GFIDSIYNKFKHHRFYGVYVFQRPILCINDPELIKLILVKDFD

LFADRGWFYDGKVDPMSSHLFLLPSEKWKRLRIKFSPIFTSGKLRRMYPYLVE

ISKHMIKTCDAELKTTDIVDVNDMLAR YTTDIISSIVYGLDSKSLDNPKS

EFQTKGEKALNFGRFNLLMAMFAPEMMSWATVPLFQENVSKFFLNIFIEAVTY

RRKEKIQKKDFLDLIMQLIDYGKVEDDDQIMQTNGKNSE HFNKLTIEEAA

ANAFVFFLGGYETSSSTTSFCLYELAQNPEIQEKLQAEIDEVVKSPTGLTYES

IAEMEYLDMVLSE TLRKHPSLPILNRIAKEDYPLPTTDFVIKKDMRIMIS

LSGIQNNPEYYPDPEKFDPLRFTKEKAVARNKYINIPFGDGERMCIG KRF

AVMQVKIALAAMLHNYQFSISEKTQVPPQYETMNFTQTVRNGVKLRVKRRDLE

KILRKRS*

 

>CYP6CK8 Nasonia vitripennis (jewel wasp)

MLLNIWQILCIKTLWISIAIAGVYLYLKFVLFNYWSRKKVPHVPPNIVLGNIN

KNFLLDKITIG ELVRQHYDKFRKEKYFGIYIFHNPILVINDLELIRLILV

KDFPYFYDRGIHSNVDVDPMSFNLFRLPGERWKNLRTKLTPIFTSGKLKQLYP

LLYEVSHEFVDICDKILEVTDVIDMKDLVER FITDCISNVAFGFNCNSLK

DPNNEFRNNGKSGTDLGKYSATLSIFGSNILNFLRLRVFSSNVNKFFIRIFED

VVNHRVKSKIVRNDFINLLMDLTDHKQGSDKAPIVNKSDPAE MKNRKLNM

LEAAAQVFVFFIAGFETTSTTVTYCLHELAKYPEVQEKLQEEIDEVANSPEGF

NYDNIMNMKYLDMTFNE TLRKHPPVPFVNRLCTKDYQIPGTDLRIPKGMR

LAISVSGLQRDPDIYPEPEKFEPLRFSKENLAQRSAYCFLPFGEGPRICIG

KRIALMQGKLALATLLSKYTFSICDETPVPLEYSNRTFLTVAEKDLYLKLTK

R*

 

>CYP6CK9P Nasonia vitripennis (jewel wasp)

MLEYLSSKLFLLAAVLTAVYFYLKLCVYNYWKKCNVPHEAPSIPLGNIPVPLF

TGKKALG NLFWDWYNKFSQHPFYGVYLFNRPVLMVNDPELINLVLVKEFQ

RFIDRGWFTNEKVDKLTCNLFLMPGKPWKRLRSKLSPTFTPGKLRQIFPLMSD

VSEQMIKTCETELKLTDELNIIEIVGR YATDVISSQGFISSSLKNPDNDF

RRLGMRGLAFGRFKMLLVVFFPGLLSNVSIPINPKEVREFFTRIFAETVDYRR

REKVTRKDFMNLLMQLVDKGMLLDDEQKPEGDKEA DSDRISMVEATAQAY

LLFIAGFETTTSVVSYCLLEMALNPDIQEKLQQEIDEVAERNGFTHNALMEME

YLNMVFLE TERKYPGVVFLNRLCGSDLSDYVIPKGMPVVISTLGVHYDPK

HFPNPHKFDPTRFSKENSVDRSPYVNLAFGEGPRNCIG KRFGTLQSKLAI

ARLLHNYKFYISQNTVLPVKFTSESFFVSPDHKLTLRFEHRRK*

 

 

>CYP6CK10 Nasonia vitripennis (jewel wasp)

MDSIAPILHTKLFLVTALITVIYMYFKFVIYGYWKRRGIPHAPPIIPVGNAFP

LISGKVSIG NLMRQKYNEGKKYPVYGIYMFHKPILLINDPNVIQLILIKE

FNKFCNRGLYFNDKVDTLSLNLFFLPGERWRQLRTKLTPTFTSGKLKQMYPLL

LEIGDNLIRVCDQIIKKDNIVEFKDLIGR YTTDSISSIAFGVDCQSLDNG

SSEFQKHGIMVFDLPPSKIASAVFAPIILDIFRIPVFNNTITQFFVKTFNDVL

EERRRNKITRKDFLNSLMQLLDKGSLDEDKDLKQKDNNNSANA LGKISLS

EAIGQAFIFYLAGFETTSSTITYCLYELALNPEIQEKVQAEIDEFSKRDGGIT

YEIMSNDMKYLHMVFLE TLRKHPSIPFLNRECIEDCDIPNTNFRIEKGTK

LLICMNAMHRDPDIFPDPEKFDPFRFTKENIASRQPYTYLPFGDGPRACIG

IRFGMLQTKIALIGLLSNYNFSVCEKTSIPVMYARRSFTQTPEYGIYLKTEK

RNKSTFLYKNRQ*

 

>CYP6CK11 Nasonia vitripennis (jewel wasp)

MDSITPILHKKLFWAFTLIIVIYAYFKFVIYDYWKRRGIPHDTPIIPVGNAFP

LISGSIG NFIKQKYNKSKKYPVYGIYIFHMPLLLINDPNVIQLILIKEFN

KFRDRGLYFNEKVNPLSVHLFLLPGERWRQLRAKLTPTFTSSKLKHMYPLLLK

IGDNLIRVCDQIIKKDNIVEFKDLIGR YTTDSISSIAFGVDCQSLDNGSS

EFQKHGSMAFDLPPIKNTLGTFVPKLLDIFRVPLYNKAMTQFFTKTFKDVLEE

RRRNKIARKDFLDLLMQLLDKGSLDEDKDLKQGDNSANG SALGKISLSEA

IGQAFIFYLAGFETTSSTITYCLYELALNSEIQEKVQAEIDEFSKRDGGITYE

IMSNDMKYLHMVFLE TLRKHPSIPFLNRECIEDCDIPNTNFRIEKGTKLL

ICMNAMHRDPDIFPDPEKFDPLRFTKENIASRQPYTYLPFGDGPRACIG I

RFGMLQTKIALIGLLSNYNFSVCEKTSIPVMYARRSFTQTPEYGIYLKTEKRN

KSTFLYKNNKGQ*

 

>CYP6CK11-de3b6b Nasonia vitripennis (jewel wasp)

GYTNDSTSSIAFGVDCQSLEMALAGFKSTLWFLIYLLLKMLVFAPIILDILRI

PIFSKAVTQLFTKTLTDVLEERQRNKITRKDFLLMQFIALIGLLSNYTVPVCE

KISIPVSYAKNFFVQTPVNGIYLRVEKRNKTIFLHKNNNGQ*

 

>CYP6CK12 Nasonia vitripennis (jewel wasp)

MESLAPMLHTKLFWLAAVVTLIWVHFKFVIYTYWKRKGIPHDEPVVPFGSTLP

IFLGKSSMG NLVKQKYQKSKKYPLYGIYMFHQPMLLINDPDLVRIILIKE

FNKFRDRGLYLNEKVDPLSGHLFLLPGERWRKLRAKLTPTFTSGKLKQMFPLL

VEIGDELIKVCEKIIQTDSVIEFKDLNAR YTVDSISSIAFGFNCKSLDNP

NNEFKRYGSMVFDQSPIRNALGVFAPVVLDTLRIPLIRRVIIDFFSQTFKDMV

DHRHSNKIVRKDFINLLMQLMDKGVLEEDEKSQKSNDHTKAG LIDNEKIS

MVEAQAQAFVFFLGGFETTSSTITYCLYELALNPHIQEKLQAEIDEHLAKPGG

MTYDRIVNELEYLHMVFSE TLRKHPSVPILNRLCIEDCDLPNTNFRIKKG

TGVMISVSGMQRDPNIYPDPDKFDPLRFTKENIASRSPYVYLPFGDGPRVCIG

TRFGILQSKIALIALLAKYKFSVCDKTSIPINYSKRSFTQSPEGGVYLRM

EKRIK*

 

>CYP6CK13 Nasonia vitripennis (jewel wasp)

MFDLAQWIFCLKLFWFTLVTYILYLAYLKFIAFNYWKRKGIPHEEPVLIFGNL

LKSSRGLISIGK EDVRRNYEIFCEYPIHGIYMFSNPILMVNDPELIRVVL

VKEFARFRDRGLYFDDKVDPLTSNLFFLSGEKWRKLISKLTPTFTSGKLKQIY

PLLQEIGDELAKVVEKSMTRSDIIEVKDLSAR YTTDSIASIAFGVNCDSL

NHPDSEFRKYGDMIVKKRSNIQLTFGMFSPSVPSLTKAVFNFFIKAFSDMVEY

RKREKIVRNDFLHLLIQLIEKGQVDDTEGEKFENIVRISTF YAQAFVFFL

AGFETSFGTTIAYALYELAINPDIQEKVDEEIDELLNSVDGCSYNNCINKMKY

LDMVVYE TLRKHPTSPFLNRVCVEECDFPEVNYRVPKGMRIIIPASGIMK

NPRYFPNPEKFDPERFSSKNGVSRSPYVYLPFGQGPRSCIG VRLGMIQTK

IALISLLSKFKLSPCEKTSIPLKYSPRSIVQVPADGIYLNSTE*

 

>CYP6CL1 Nasonia vitripennis (jewel wasp)

MIIESFFCVVCILTISLAISFYYFLTWNFDFWKKRNVKGPEPVPFFGNYKDNI

FGKIHSTELTKRFYDEFANEKMVGIYVYGSPVLILRDLDLIRDVLIKDFAAFS

DRGIRVHDRVEPLSQHFFNLPVSTWRPLRKSLTPAFSCTRMKGMFELMAQVAE

LFVSFLEQNTEREESLECCALVAKFATEVIGECGFGSKMGEFEDKVSEFREVS

KTRIKSNLWNFVRRNLRQFWPSIYKYCSMFCNKKLLRYYVNMINSVNLTRSKE

GIKRKDYVEILLHLKNNPEQIQNLE LSDSILAAQSYVFFTAGSDTTALII

SNLFYELAVNESIQDRLREEIQDQKLSYHGLKSMEYLDKVWKE TLRKYPL

RNIQRASNQIYTFSKTNVTIPANTQIIIPNYAIHYDSQYYHEPEVFNPERFDG

RGNFSHPMIYLPFGKGPRDCIG SQFAVHISKILIVKVLENFKVEISSESL

TREENDPRQVLLSPKGGIRLKFKRL*

 

>CYP6CM1 Bemisia tabaci GQ214539

MELLEIVKSAMDTHSVLLFLSVMVYLLYVYRDKFHYWSKRGVPC

QSPAQSIVRTFRLVLRMDSFTDNFYRVYKAFDGHPYVGSLELTKPILVVRDPELARIV

LVKSFSSFSGRLKSPDTTLDPLSNHLFTLNGEKWRQVRHKTATAFSTAKLKNMFHSLK

DCAREMDAYMERAIGDKGDVEFDAFKVMSNYTLEVIGACAMGIKCDSIHDEETEFKRL

SRDFFRFDARRMIFTLLDLLHPKLPVLLKWKAVRPEVENFFREAIKEAASLKESEAAA

RTDFLQILIDFQKSEKASKTDAGNDTELVFTDNIIGGVIGSFFSAGYEPTAAALTFCL

YELARHPQVQAKLHEGILAVKEKLGDDIEYENLKEFKYANQVIDETLRLYPASGILVR

TCTEPFKLPDSDVVIEKGTKVFVSSYGLQTDPRYFPEPEKFDPERFSEENKEKILPGT

YLTFGDGPRLCIAMRLALMDVKMMMVRLVSKYEIHTTPKTPKKITFDTNSFTVQPAEK

VWLRFRRRASTP

 

>CYP6CN1 Plutella xylostella EU189053

KHVMIKDFDLFVGRGVEFEKQGLGQNLFHADGDTWRVLRTKFSP

IFTSGKLKQMMYLLNERADKFIERLDSAVAVSQEQEVYFTVQKFTISSISSVAFGLEL

DLSELDTPGNVFDRMNRLIFTTNYAQDLDFAFPGLLKTLSMSLFPKPVKDFFYGMVRR

VMEERNGEPSGRNDFMDLLLEMKEKKIHGVKKHEGDKERSVVIDEDVMAAQAFVFYVA

GYETSASTTAFLLRLLALHPDIQQRVYEEIQRVTTSLPGPLTYESLKQMTYLKQVIDE

TLRMFPLVDPLQRVLSTGGYRVPGTDVTLDEGSLVLVPVRGLHYDPKYY

 

>CPIJ012640 CYP6CP1 Culex pipiens 42% to CYP6F1

MLLVIFFVVSLLTLAYRAFRYRLTYWKRHGIPQLQPAIPFGD ()

LGPVFRQNRFYGELLEDLYLQSKHLPLVGIYVTFRPVL

VAVDPELIKAILVRDAECFGDRGLNADEDRDPMAANIFHIQGDRAKDLRSRLYSTFSAAKMRGYFIQLSSTAFSLVGALE

RSAGSVVEVQDVMSRYTADGTAAVLFGLEADSINDEHDMFREVARRAVAVDAFNLMRIAFYFLTPKFKNWLGIKFVDSVV

ESFMISMVRKISEHREREKSDQDLIQMLLDLRSSDLALKDE

MLDLRSSDLALKDEMVAAHALFFIIGSYEASTTTTSLCLYELAKNVDIQQKAQ

QEIDSVISKEEGELTVENMTDMRYVDWCINETYRKYPTLPILFRRCTKDYLVSEHNITIPSGSTVVIPLLGLANDPEFFP

NPEAFLPERFENRPDYGLPFYPFGAGPRSCIAKRLGHLQTKVALVMLLAKFDIALANPDEGSVQFHPKFFITKAVGGLNI

VFTKRDQ

 

>CPIJ016847 CYP6CQ1 Culex pipiens (no introns)

47% to CYP6M11, 84% to CPIJ019701

MFQYWDIVGTLACLALNLYLFRKHAYWTSRSVPFRQPGFLYGNTKAMGRTEQVGKFFQSFYTDLKGLNPLVGMYHYLRPI

ALITDLGFVKRILEVDFECFQGRGSYCDEKVDSLSGRLYNLVGDRWNKIHNIIAPMFGGNNLKTMFSMLLTSGKHLRDQL

GDKVEAGKEIEIKNWLKQYIPDLMAKSYLGVDIQLKTISRQEKFKGFLMNYMSKLARILRISEFKP

EVSKHFLKLISAET

ESRSKNNIRKDDFLDMLIQQLDPNESKEGQLSFNELAAQAFGFYYAGLETCPALLTWTLYELSNAQVMQKKARQHVKTAL

AKFNGEICFDSISAMTYLDQIVNESLRKYPPIPVLIRETTKNYQIPNTTTTLEAGTPIYIPVYAIHHDPELYPTPEKFNP

ERFSMNAKREPYTWIPFGEGPRACLGKQLSIMQAKIVLAYLLINFRFSIGKKCSMPLQVDVTSFVLTPKNLWLKVERI.

 

>CPIJ019701 CYP6CQ2 Culex pipiens 84% to CYP6CQ1 CPIJ016847 N-term in a seq gap

LVGQVNKITTxx &

APMFG &

GKQLKVMFQCVSSGKQLNDQLGDKVEAGKEIEIKNWLEQSMPDIMAKSYLGVDLK

FEKISRQGKFKKFLMNYMPRLARILRISEFKPEVSKYFLKLISDEAESRSQKSIRKDDLL

DMLIQQRDPNESKEGQLSFNELAAQAFGFYYAGLETCPALLTWTLYELSNAQVLQKKARQ

HVRTALAKFNGEICYDSISTMTYLDQIVKESLRKYPPIPVLIRETTKNYQIPNSTTTMEA

GTPIYIPVYAIHHDPELYPKPEKFDPERFSSKSKREPYTWIPFGEGPRACLGKRLVMMQA

KIVLAYLLINFRFSIGKKCSLPLEVDAKSFVLTPKDVWLKVERN

 

>CYP6CS1 Nilaparvata lugens FM994118.3

MEMLGDDGFSNSWWVQLLLVILVSLVATRIYASHVFSHWHRKGL

ASCAGSFPFGSIGNFVLQRKSISEVYADIYRSGKGHKLFGYYSFFSPSLLVRDPELIR

LVLVKDFPHFMNRGAYYNEKDDPLSAHIFSLDGEEWKKIRTKVSPFYATNKMKFMFDT

IRSCSVDLQRFLLGSSSSCKSEFELKSLMSKYSINVIAQTAIGMEGNNFKDKNMLSEM

SFKVTDPDDIVQTFRFSLPFINRNLAALLKLRFTPKATEDYYMAAVRQIIEQRKRENV

VKHDFMHLLLQMKGRSDTIDKGTAGLSVEEIAAQTFIFILAGHETSSSTIAFCLHGLA

LDSRIQQRLCHEIGASGVTVENVTFEQIQSMEYLDAVFQETLRKYPPAGVLIRECIKD

YECPDGFVIKKGTRINVSNYGLHRDPHFFPNPDKFDPGRFDKDSPSHPIVPFSYLPFG

EGPRFCLGKRFAMFTVKLGLFAILSKFSVESTGKSAPTVTFNPALFLNSPKDGLHIRF

VPRTVSI

 

>CYP6CT1 Zygaena filipendulae GQ915316

MTVLILLCLFMLMSLSLYLWFRHKYSYWSKRGVFGPRPVVLFGN

MLDVLMSRKQIFQPYCDYYFKYKHLPYVGLYSFSQPVLTINDLELARHILIKDFNYFE

ARGTFPGSAGDPLSGNLFNMQGNRWKGLRSKMSPTFTMGKLKSIYPLVEKIADEAMHY

AESKNIDEEAINFTELYSKFSMEVTGSIGFGVEFKGFKNSNSKFFEYGRGYFKPENMY

WNFVRVLALFEPHLFMKIGFQRIQPKITTFFSNLVETVVKYREENVFYKRNDYIQTLI

DLMKGRVVDENGKSNKIDTDFSFSMTDVAANTMLYMIAGSDTSTITSLITAYELARNP

DVQNRVREEILSVLARHDGRYTFEAQNEMKYLNMVIDETMRIHPPMRALIRRCTNDYK

VPNSDLIIEEGTLVFLPVQAYQMDPDIFPDPENFDPERFTAINKANMHPCHWMPFGAG

PRKCLGLRQGYIQTKLALIMILQRYELLLDERTEIPIKVKKSSLTYAPETDIWLKLRK

ISN

 

>CYP6CV1 Cnaphalocrocis medinalis FN421127

MALLVCLSLVAGLLTAFYYWTKKKFSYWSNKGVIGPTPLPIVGN

FGTVMLQQESAQLYVKKVHLKYKGEKLVGIYRGSQPAILVRDPELIKHVLIKDFNIFQ

DRGISTSSSRLSDNLFGADGEIWKILRQKLTPVFTSRKLKDMIPLILKCSNSFTKYVD

NLIEKNVEHEIRSLTSKYTLEVIGSCAFGLDLNTVSDEENEFSLIPKKIFKPSIYVRT

LVILDMIIPGIKKKFNTSSEIQDFFVNLVRSVIHERKGKPSNRKDFMDLMIELREQGK

ASRRKEDGVSEIEIDDLMIAAQSLVFYTAGFETSAASMSFLIHEMALNPEIQERIHDE

VCRVYEKYNGELTYESTKEMPYLDMVFDETLRKYSVAGILFRKSLADYTFPGTDVTIP

KGMPVMISANGLNADPEYFPNPNEFNPENFSPENKKNIPQCAYMPFGEGPRNCIGLRF

AKVQSMLGTAAFFKHFKVEPSSKTKRVLEYDPKGIVLVTAHGIWVKISKR

 

>CYP6CW1 Nilaparvata lugens FN421126

MLGLIVTGVLGGLIIYFINMYVKRSQSYWKEKGVPFLPPGSILF

GNMSDVILRKASMGENLIKIYRELDGQKFGGYFQFQTPVLMIRDPELINYFLIKDFGH

FHDRNMPTSEDFDLMGSSLASLTGQRWRSLRYKMTPTFTSGKLKRMFSQIVSCSDAII

DHVSTLPRGEAVEVRDLMFKFTINVIGSVAFGLQIDSHKAVDGRNKVFIDMSKRFFKP

SMIQFLKFFLRMSYPRLMEALGMRMNDPEMNEFFSTLVADIIRLRQAEEKDAKSSNKK

RDDFLQLMMDIRKSSKNKDEAAPKSNVKEEQMEAEDHALLDQFKHVPNDGKQAYDIEM

TDEIMTSQAFIFIAGGSETTAAVLQFALFEMAHKPEVLAKVHQEIDEFTAGGQFTYEA

VRDMKYLENVLNEALRLHPPGSILARFCTESYKIPGTDIVLEKGSQINVPVIGIHLDP

KYFPQPEEFMPERFDKEIPKGAFFPFGGGPRICIAMRLAMLQMKIFLARLLMRYSVTL

SDKTTVPLKLMSDSIVQHVKVVFGCTSSQEKYSKVTKNDSNKLIELTIQCLI

 

>CYP6CX1v2 Bemisia tabaci (whitefly) Susceptible strain GQ330542.1

VITCMIGLFLSAVLDPVATTVTFCLYELAYHPEIQDRLFQEIQTVRNECGDEIGFEDLKK

LQYLEQVVNETLRKYPPAGVLSRKCTESFQIPDSSVVIEKGLGLMIPAACFHHDPKYFPD

PEKFNPERFSKENIGNIVPGSYIPFGEGPRFCIANRLALMDVKTMLITLVSDYALHPCAR

TKNHFEFDRETFTLNPKGEVWLRLKKRN*

 

>CYP6CY1 Acyrthosiphon pisum LOC100159226.pro SCAFFOLD10025:26656..31321

MFTASWWINVITPCTIIVTITYYFCVSTFKKWEKLNVPYIKPIPLFGNFLNVALGKNHPLEFYNKIYHEFAGQKYAGVFQ

MRTPYLMVRDPEIINDVMIKNFSSFPDRGIYSDFVAEPLTNNLLLMENPQWKIIRNKLTPAFTAGKLKTMYDQIKECGDE

LMKNIDIDLNRTSNEIEVKDIMGKYSTDVIGTCAFGLKLNAINDDESPFRKYGKLIFKPSLRVLMRELCVMITPALLKVV

RLKKFPTAATDFFHAAFNETMTYRLENNIVRNDFVHYLMQARNDLVLNTDLPKHEKFAESQIVANAFVLFAAGFETVSSA

ISYCLYELALNKSIQDRVRKEIQLQLSKNNGQINHELLIDLNYLDMVIAETLRKYPPLVALFRKASQTYRVPNSSLIIEK

GQKIIIPIYAIHYDNKYYSDPEKFIPERFSAEEKAKRPSGVYLPFGDGPRICIDSEWLRNVLMLQ

 

>CYP6CY2 ?Acyrthosiphon pisum LOC100163313.pro SCAFFOLD10025:31376..37086

MFTANWWINFITPCTIIVTIAYYFCVSTFKKWEKLNVPYIKPIPLFGNLLNVAVGKDHPLDFYNKIYHKFAAHKYAGVFQ

MRTPYLMVRDPEIINDMLIKDFSSFPDRGIYSDFVAEPFSNHLFFMENPQWKIIRNKLTPAFTSGKLKMMYDQIKECGDE

LMKTIDIELIKNDDEIEVRDIIGKYSTDVIGTCAFGLKLNAIKDDESPFRKHGKTLFEPSLRALFKELCLMIAPALLKVI

KVKDFPTDATDFLHTVFKETITYRQKNKIVRNDIFQCLIQVRNDLVLNADLSKNEKFTETQIVANAFAMFAAGFETVSSA

ISYCLYELALNKSIQDRVREDIELKLSNNDGQINHELLIDLNYLDMVIAETLRKYPPVVALFRKASQTYRVPNDSLIIEK

GQKIIIPIYALHYDSKYYTDPEKFIPERFSAEEKAKRPSGIHLPFGDGPRICIGKRFAEMEMKLAFVEILTKFEVFPCEK

TEIPLKYSNKVFTLMPKHGIWLRFKRIN

 

>CYP6CY3 Acyrthosiphon pisum LOC100168115.pro SCAFFOLD10025:41696..46319

MAYDLNEIKIKLNYVNIINVIIVVLYHYLFKIRFREKKYAEKYPLIEFDTKRENSVDSCVFCVGTLFNIQNCVNYRKGHM

YPSSSSATDWWIYIVTPCLVAVTITYYFCISTFNKWEKLNVPYIKPIPLFGNFLKVALAKDHPLEFYDKIYYKFSGLKYG

GLFQMRTPYLMVRDPEIINNMLIKDFSSFPNRGIYSDLAANPLSDNLFFMENPRWKTIRSKLTPAFTSGKLKIMYDQIKE

CGDKLMKNIDNDLKGKNDEIEVRDIMGKYSTDVIGTCAFGLKLNSISDDESPFRKYGKSIFIPSLRTLFRELCLMVSPAL

LKVVRVKDFPTDATAFFNAAFKETITYRLENKIVRNDFVNCLMQARNDLTLNTNLPKHERFSESQIVANAFVMFAAGFET

TSTTLSYCLYELALNIHIQDKVRQEIQLKLSKSDGQIDNEFLMGLNYLDMVIAETLRKYPPLIALFRKASQTYRLPDNLI

LEKGQKIVIPIYSIHFDSKYFEDPLKFNPERFSSEERAKRPNCVYLPFGDGPRTCIGKRFAELEMKLALVEMLTKFEVLP

CGKTEVPLKYSNKALTLMPKHGIWLRFKKIV

 

>CYP6CY4 ?Acyrthosiphon pisum LOC100164042.pro SCAFFOLD10025:137606..141395

MFTANWWINVITPCTIIVTIAYYFCVSTFKRWEKLNVPYIKPIPLFGNFLNIALGKDHPLEFYNKIYYEFAGRKYGGLFQ

MRTPYLMVRDPEIINDVMIKDFSSFPDRGIYSDFTANPLSNNLFFMENPQWKTIRNKLSPAFTSGKLKTMYDQIKKCGDE

LMKNIDIDLNKNGNEIEVRDILGKYSTDVIGTCAFGLKLNAISDDESPFRKYGKSIFTPSLRMLFRELCLMITPALLKVI

RVKDFPTAATDFFHAAFKETMTYRIENKIVRNDFVHCLMQARNDLVLNTDLPKHEKFTETQIVANAFVMFAAGFETVSTT

VSYSLYELALDKSIQDRAREEIQLKLSKNDGQINHEFLMDLNYLDMVIAETLRKYPPLVALFRKASQTYRIPNDSLIIEK

GQKIIIPIYAIHYDTKYYPEPEKFIPERFSVEEKAKRPSGIYLPFGDGPRMCIGKRFAEMEMKLAFVEILTKFEVFPCEK

TEVPLKYSNKVLTLMPKHGIWLRFNRIN

 

>CYP6CY5 Acyrthosiphon pisum LOC100167264.pro SCAFFOLD13514:28216..31057

MFTANWWINVITPCTIIVTIAYYFCVSTFKKWEKLNVPYIKPIPLFGNFLDIALGKAHPLEFYGKIYNEFAGRKYGGLYQ

MRTPYLMVRDPEIINDMLIKDFSSFPDRGIYSDFVANPLSNGLFFMENPQWKIIRNKLTPAFTSGKLKTMYDQIKECGDE

LMKTIDMDLIKNGKEIEVRDIMGKYSTDVIGTCAFGLKLNAINDDESPFRKHGKSIFTPSLRSLFRELCLMVTPALLKVV

RVKDFPTDATDFFHAVFKETITYRLENKIVRNDFVQCLIQARNDLVLNADLPNHDFVLEKFTESQIVANAFGMFAAGFET

VSSTISYCLYELALNKSIQDRLRKEIQLKLSKNDGQINPEFLMDLNYLDMVIAETLRKYPPLVALFRKASQKYRLPNDSL

IIEKGQKIIIPIYALHYDNKYFTDPENFIPERFSAEEKAKRPNGIYLPFGDGPRICIGKRFAEMEMKLAFVEMLTKFEVF

PCDKTDIPLKYSNNVITLVPKHGIWLTFKRIN

 

>CYP6CY6 Acyrthosiphon pisum LOC100165240.pro ?SCAFFOLD13514:36706..45131

MFTDNWWIYVITPCTIIVTIVYYFCVSTFKKWENLNVPYIKPVPLFGNFLNVALGKEHHIDFYNKFYHKFAGHKYAGVFQ

MRLPILMIIDPEIINDVLIKDFSSFPNRGFSVDFKANPLSNNLFLMENPQWKIIRNKLTPAFTSGKLKVMYDQIKECGEE

LMKNIDIDLKKSGDEIEVRDIMGKYSTDVIGTCAFGLKLDAINDDESPFRKHGKSIFAPSLRQLFREMCMLISPVLVKVV

RVKDFPKDATDFFHAAFKETMKYRHENKIVRNDLVHCLMQARNDLVLNTDLPKHEIVLEKFTESQIVANAFIMFAAGFET

VSSAISYCLYELALNKSIQDRVREEIQLKLSKNDGQINHEFLMELHYLDMVLAETLRKYPPLVFLMRKALQTYRLPNDSL

TIEKDQKVIIPVYAIHHDSKYYPEPENFIPERFSTEEKAKRPNGTYMPFGDGPRICIGKRFAEVEMKLAMVEMLTKFEVF

PCEKTEVPLKYSHKTITLMPKHGIWLKFKKIN

 

>CYP6CY7 Acyrthosiphon pisum LOC100160895.pro SCAFFOLD17283:187176..190201

MIDVISCSIIGLLSSVYILYATVFLSIAYYLCTSTHDKWRKLNVPYTKPLPLFGNSMNLVLAREHPMDFFTGLYNRFPDE

KLCGFYQMTTPFLMIRDPKLINNIMVRDFSYFTDHGFDTDPSVNILANSLFMLNGDRWRTMRQKLSPGFTSGKLKDTHDQ

IKECTDQLINIVDDNLKVSDHFEIRELVGNFSTDVIGMSAFGLKLDTIRNGNLDFRKFGKKIFQSDFKQLFVQAMMLFCP

KLVTILKLKQFPDDAADFYGSMFRDVLEYRDRNNVIRNDVTQTLIQAKKDLVTNNDGDDSTSKNKWTEMDIVGNAILMFV

AGAETVSITICFCLYQLALNKDIQDKLREEIVTTNAKHGGQLNNDFLTNLHYMNMVLEEVSRMYSITMILFRQATKNYEV

PGQSLVIEKGQKIIIPAYCIHNDPKYYPNPGTFDPERFSTEEKAKRLNGTYIPFGDGPRLCIGKRFAELEMKLVLSKILL

KYEVLPCEKTEVPINIRGAGSIVNPKNGVWLSFKPIVAN

 

>CYP6CY8 Acyrthosiphon pisum LOC100159248 ?SCAFFOLD5532:14697..15575 (- strand)

MLIFANFWMDFIILVTVLFSIIYYYCTSTFNVWKKLNVPYVRPIPLFGNYLKVALGIENPMETYKNIYYELAGFQYGGMF

QMRTPYLMIRDPEIVNNILIKDFSYFTDRGIHVDFKAEPLSEVLFLMENPRWKKLRSKLSPAFTSGKLKQMYSQIEKCGQ

DMIINIFAELKKNPNEIDIRDILAKYSIDVIGSCAFGLALNVASDDTSLFRSYGKTAFSETLRKYPLLFALFRVATKTYR

VPNDSLIIEKGQKIIIPTFSLHFDPRYFSDPEVFNPERFSTKEKAMRPNGVYLPFGDGPRLCIGKRFAEMEMKLALVEIL

SKFEVEPCEKTEIPIQFSKLSVVVIPKDEKILLKLNPLSE

 

>CYP6CY9 Acyrthosiphon pisum LOC100161627 ?SCAFFOLD1099:1136..6561 (+ strand)

MSASQLLVDLAAGWWTVAVLALLAATVYHFCTSTFGYWRDRGVPYVRPTVPLFGNIGGLALGVEHQARMFGRIYDGFRGQ

RYGGFFQMRTPHLMVCDPALVNRVLIGDFAHFTDHGMYTAGPDENPLANGLFNMNGAQWKIMRQKLSPVFTAGKLRHMRG

QVTECSEQLMRNVAADVPAGGGQMEIRDVLGKYSTDVIGTCAFGLHLNAINDERSSFRKHGKAVFAPSFRVLLKELAWMV

TPALRRALRIGDMPPDAAQFFTAAFTDTMKYREEHGIVRDDFMQSLIQARTDLVVNKTEPSVEFLETDIVANAFILFAAG

FETVSTAMSFCLYELALKKPIQDKVREEMNTTKKKHNAEIDNDFLKDLHYLEMVLAETLRKYPPLLTLFREATQDYQVPD

DTFVIEKGTKVLIPAYAIHHDYRYYPDPETFDPERFSPEEKAKRPNGTYMPFGDGPRLCIGKRFAEMEMKLALTELLTTY

EVEPCEKTDIPMRFSKRSLIITPENGIWLKFKPIHTSK

 

>CYP6CY10P Acyrthosiphon pisum LOC100159387 SCAFFOLD6634 coords:14145-18091

MESQILSNAFGFFAAGFDTTSTSISYCLYELALKKNIQDRVREEIKLTKSKYNGVIDNEFLNDLHYLDMVIAESLRKYPL

MFALFRVATKTYRVPNDSLIIEKGQKIIIPTFSLHYDPKYFSDPEVFNPERFSPKEKAMRPNGVYLPFGDGPRLCIGKRF

AEMEMKLALVEILSKFEVEPSEKTMIPVQFSKLSVVVIPRDEKILLKLNPLSE

 

>CYP6CY11P Acyrthosiphon pisum SCAFFOLD12002:AUG4_SCAFFOLD12002.g13.t1

MISCLIDFLLGTPAIAVTVLMAFVYYYTTNTYDKWLKLNLRYDPPWPLVGNTMKMVTLIE

HQLATIDGIYKRLAGEKYCGFYQTKTPFLMIRDPELINNILIKDFLNFANRGFHKDPALN

IIANGLFFMEGPKWDVMRQKLSSGFTSGKLKLAHNQIAECSDELMRFIAAKMKENDQIEVK

*TMSKYSTDVIGTCAFGLSL

 

>CYP6CY12 Acyrthosiphon pisum LOC100163195.pro 39% to CYP6AX1

MISCLIYVLFGTPAIAAVAVLAAILYYYTTNTYDKWLKLKVPHDPPWPLVGNTAKMMTLIEHQLTTIDGIYKRFSGEKYC

GFYQMKTPFLMIRDPELINNILIKDFSNFADRGFHKDPALNIIANGLFFMEGPKWKMMRQKLSPGFTSGKLKLAHNQIAE

CSDELMRFIAAKMKENDQIEVK

ETMSKYSTDVIGTCAFGLKLDTVKNEGSDFRLYGRKILKLSFRFLLAEMVSPKILKLLGVAEFPPDASAFYESAFKEVIR

YREENGIVRHDVAQSLIEARKELVLDSTDENGFTEQHIIANAILMFLAGFETVSSTLSFCLYHLALNQDVQEKIRDEMNS

KLKQHGKINNDFLVNLHYTDMVLAETERMYVVTNALFREAVKTYHVPGDTLVIEKGTKIMIPIYSIHHDPTYYPEPYIFD

PQRFSPEEKAKRQSSTYLPFGDGPRFCIGKRFAELEMKMVLSQIITTFRILPCEKTEVPLKLQNGLPMMVAKNGIWLRFQ

SISE

 

>CYP6CY13 Acyrthosiphon pisum LOC100167704.pro SCAFFOLD7563:47979..58025

MISWMFNCLIDSFTLICTTVIGLLFYYYSTSTYKKWRKANVPHTKPVPFFGNFFRSTLGFETINDTYHNIYKQFPDKKFC

GFYQMRTPTLMIRDPELINNVLIKDFSHFTDHGLDMDPSVNFLASSLFFTRGQKWKIMRQKMSAGFTSGKLKLMHSQIKD

CSKEMIDYIDRKSKTTDQFDMHDIMNKYATDVIGTCAFGLKLGSMKDEDNEFRKFTKLLFKPSFRLIFTNILSLISPKTS

NILKIKTSSPEVMEYFTTSFQNVIEYREKNNMDRNDVAQTLMRARKELKFTEMDIISNAILMYLAGAEPVSDTLGFCLHE

LAINKHVQDKLRKHINTKRKEHGGEFTNDYLMDLHYADMVLTETLRKCNGTIVLFRKATKAYQVPDSSLVIEKGQQIIIP

TYSIHHDPKYYTNPDVFDPERFSPEEKSKRPSSTELLFGDGPRFCIGKRLAELEMKLGLSEIISKFEILPCEKTENPVQL

ANAGGAIKPKNGIWLI

 

>CYP6CY14 Acyrthosiphon pisum LOC100161480.pro SCAFFOLD8603:3827..8475

MISYLTNLLFDYIFLSLIIVCTFLYYYTTSTYDTWRKLNVPFAKPVPFFGNIFKMFTGLERQVDAFGRIYQQFPDEKFCG

FYQMSTPFLMLRDPELINTVIIKDFSYFTDHGIDMNPSVNVMARSLFFATGQKWKTMRQKLSPGFTSGKLKGTHEQIREC

SDQLTNCIYEKSQKTDAIEVYELVGNTATDVIGTCAFGMKLDTINNDNSSFRQNVKKVFKPSGKVIFAQILGVLFPKIVK

FLKLQTSPVDVDAVNFFHSVFGEVIEYRTKNDVVRNDLTQTLMKARQDLVVSSDYKGEEKYCELDIIANAMLLFTAGSET

VTATASFCFYELALNKVIQDRLRDEIISSKIKHGGQLNNEFLEDLHYADMVLDXXIEKGQKILIPIYSIHHDPKYYPNPE

TFDPERFTAEEKSKRPNGTFLPFGDGPRHCIGKRFAELELKLILSKILTKFEISPCEKTEIPLQMNKERGITSPKNGIWL

NFRPIVE

 

>CYP6CY15 Acyrthosiphon pisum LOC100163900.pro SCAFFOLD5222 coords:2410-5346

MYFLTDWLLDNFTYLSLIAVFTGFYYYSTSTYGKWQKLNIPYIPPVPLFGNAFRMVTKLECPMDMYDRLYKQFPDVKLLG

FYQMTEPMLLIRDPELINAILIKDFPYFTDHGFVMDPSTTVMAKSLFFSNGQRWRTMRQKLSPGFTSGKLRDTYLAINEC

SNQMVSSIVEKLGKTDRLAIRSIISGFSNDVIGMCAFGIQLDSMNNEDSDFRRYSERIFEKTTKQIIVQAVTTIFPFVIN

LFKIQMFSAEATNFFRKVFADVINYREKNNIVRNDLTQTLLQARKELVLKENSTAEGIVFADQFTDDDIIGNAIVLFADG

AETISSIVSFCLYELALNKEIQDKMRAEICSMKAKHDGQFNNDFLMDLRYTNMVLEETGRKYSIASILMREATKTYTLPD

ESFVIEKGQKLIIPMFSIHRDPKYYPDPLIFDPERFSKEQKSQRPNGIYMPFGDGPRMCMGKRFAELEMKLVLSNVLSKF

EVLPCEETEIPLEITDETGVIAPKRDLVLKFRPIIED

 

>CYP6CY16 Acyrthosiphon pisum LOC100162372 SCAFFOLD1019:69426..73624 (+ strand)

MISFMTDWLHDNVTCLSLIAVLASFYYYSTSTYGKWRILNIPYVPPVPLFGNTTRMMLRLEHPIDMFERFYNSFPDVKLF

GFYQMRDPVLLVRDPELINAILVKDFSYFTDHGIDLDSSTSVLANSLFFANGQKWRTMRQKLSPGFTSGKLKDTHGQINE

CSDEMVSGIVESIKKKTDQIDVKTITGGFSTDVIGTCAFGMKLDTIKNDDSDFRRYVKIMFQSTPKQMIVQVLLMICPWV

IKVLKINMFSVEATNFFHNVFTDVFKYREEHNVIRNDLTQTLMQARKELVLKENSSIEDKFTDADIIGNAILMFTAGSET

ISSMLSFCLYELALNIEIQDRLRSEICSMKAKHDGHLNNDYLMDLYYTNMVLEETARKYSIAFNLMRVATKTYTLPDESF

VIEKGQKLIIPMFSIHRDPKYYPDPLRFDPERFSTEQKSQRPNGIYMPFGDGPRLCIGKRFAESEMKLVLSNVLSKFEVL

PCEKTEIPVNIRSMSGFITPKNGIVLKFRPIVEH

 

>CYP6CY17 Acyrthosiphon pisum LOC100164459mod.pro SCAFFOLD2510:85936..93942

MNDIKLLNGLVSGAVDSPDLLSRIGFRIPDKYSNRKRPLPLNKPIMISFLIDCLVNNVTCLSLIVIFTGSFYYYSTSTYN

KWRKLKIPYVPPVPLFGNTFRMLARLEHPIDTFDKIYNHFPDFKLFGFYQMREPMLLVRDPELINMILVKDFLYFTDHGV

DIDPSMSTLAKSLFFANGQKWRTMRQKLSPGFTSGKLKGTYCQINECSDEMVSSIVEAIGKKTDRIELKTITGRFSTDVI

ATCAFGLKLDSIKNGDSEFRRYVKILFQTTTKQAIILILSLICPRVVKILRLQFFSLEATNFFSKVFADVIKYREDHNVS

RNDITQTLIEARKELVLKEISTTEDKFTDDDIIGNAIFLFSAGSETISSLVCFCLYELALNKEIQDKLRAEIYSMKAKHN

GKLNNDYLVDLRYTNMVLEETGRKYSIAFNITRVATKTYTLPDESFVIEKGQKLIIPMFNIHRDPKYYPDPLRFDPERFS

MEQKSQRPNGTYIPFGDGPRLCIGKRFAEAEMKLVLSKVLSKFEVQPCEQTEIPLDIRSGSGLLSPKNGLVLKFKPIIEH

 

>CYP6CY18 Acyrthosiphon pisum LOC100168007.pro SCAFFOLD1502:67256..70800

MHRTTLISLGGLFMHNINLLSNNIIVSVVKMSLYNLYLYCLYGCNVIYKLDKFSGITIYHNENPSSIQYRITNDIFTLYL

MKIAEANAVLTLAYVKLVVFCVFLIMFSFIFIWWINIITPCLFIFTITYYFCTLTYSKWEKINVPYIQPIPLFGNFLDVA

LGMQHPIDFYRKIYYELAGYKYGGLFQMRTPYLMIRDPEIINNVLIKDFSNFPNRGIYSDFSANPLSNQLFFMENPQWKI

IRKILSPAFTSGKLKLMYDQIKECGDELMKNIHKNLTKTDNKMEVRDILGKYSTDVIGTCIFGLKLNAVSDDNSTFRKYG

KSLFLPSLRTHLRELSLMITPALLNILRFKDFPADATEFFHSAFHETITYREKNNIVRNDFVQTLIQARNDLVLNKNIPQ

RERFLESQIVANAFVMFAAGFETVSTAISFCLYELSFCLYELSLKKHIQDKVREEINLKLSKNNGLINNDLLIDLNYLDM

VLAETLRKYPPTFALFRKASQTYHVPNDSLTIEKDQKVIIPIYSLHYDPKYFADPEVFDPERFSPEEKSKRISGTYLPFG

DGPRICIGKRFAELEMKLALVEILTKFETEPCERTEVPIRFSKKALITMPENGIWLTFKKITNQ

 

>CYP6CZ1 Acyrthosiphon pisum LOC100165972.pro ??SCAFFOLD1502:79066..88489

MFEFVYELFDLKMLLVTAFLGAIYVYSTWTHSHWSKLGISSPSAPVPLFGHAMPSMLGQMHFMDVLHNLYKELGDQRFGG

IYTMRTPQLLVKDPELIGHILIKDFNNFTDRGLYAGTHTNPLNNNIFFTRGERWKTMRQKLSPTFTANKLKYMNEQVKEC

SDGLLSTIGKNLDDDAGRIEIREMMAKYSTDVIGSCAFGLKLDAINDPDSEFRKHGKTVFQPSLRSKIRVAVIFMQPSLL

SIFRVHHYSHRTIRFFHDAFQQTIEYREKHNEDRKDFVQHLMKAREDLVLNPNLKPE

EKFTEMDIVANAYILFIAGFETVSTSMSFCMYELALRKDVQDKVRKEILEVKSKYNGQMNSECLNELHYMGMVIKETLRK

YPPLVTLNRVVTKPYVIPGTQIKLKIGTKIVVPVHAIHYDPKYYSDPEAFEPDRFSDENIHNIQPNTYMPFGDGPRFCIG

KRFAEFEMKMALSEVLTNYEVMACDKTQIPIKYVIGSFVNIPESVWLKFRKVNT

 

>CYP6DA1 Acyrthosiphon pisum LOC100159636.pro SCAFFOLD17790 coords:18123-22112

MSGVWSIPFVQLCAAAVLLVTFLGYMYLTYHYGKWTGLGVPHAAPSPPFGSLRDVVMGRVPLVDAIHSLYRRFDGQRYFG

IYEGRQPLLVVCDPQLVHTIMVKDFRSFVDRNAGKVSFVHDKLFDHLVNLRGEQWKAIRAKLSPTFSAAKLKSMLGDINV

CTARLIDNLNGQITKNSGIVDVSEASAQFTTDTIGSCAFGLDCNALSNPDSEFRRTGRAIFTPSLRSNLLNITRLVGFGR

LLDVFRIRGMSGNIYDFFDNLLDTTMEQHKSGENTRNDFIALLVKLKDEEKQKEHGQKLFTDDILAANSFVFFVAGFETT

ASTISYCLYELAMNPEIQVKLRENIKKTLDANDGKLAYDTLKDMKYLDMVINETFRLHPPVPVLNRVCTQKYTITDSNIT

LNVGDKLIIPTYSLHHDSKYYSDPEIFDPERFTEENISSRPHGTFLPFGDGPRICIGLRFAMMEAKTGLAEILSKFEVSP

CKETQTPIKIKPRSILLTPNESIRLSFKSIDQ

 

>CYP6DA2 Acyrthosiphon pisum LOC100168454.pro SCAFFOLD17790:22986..29493

MICFSCWLEIVPIAAIASALLTYVYCTRYYGHWTALGVPHTKPAPLLGHFAGPTMGRESGTITVDTLYRRFVGHRYFGVY

QLRHPMLVVRDPVLVHAVLATEFGSFHDRVMSRTSFEHDGLFNSLVNLRGDKWKAVRAKLSPTFTVAKLKAMFASLHVCT

GQLTDKLLLLTSGGQGIVNVTDVSSKFTIDTIGRCAFGINCNTLFDSNTEFQRAGQAVFTPTLKSSVLNFMRLIDLGWLV

DLFRLRSMPDLVYEFYLNLFQDTLELRKNEKEDRNDFVSILVKLRNDEKINNSRVELFTDDVLASNAFIFFAAGFETTAS

AMSYCLYELALNQDIQVELRKQIQHTLNENGGILTYDVLKDMKYLDMVLNETLRMHPPGPGLLRVCTKKFKIPDSDITLD

TGMKVLIPTYSLHHDPAYYPNPELFDPLRFTEDNKALRPNGTFLPFGDGPRICIGLRFALMEAKTGLAEIISKFEIFPCK

YTKIPIKLNPRSILLTPNEPISLLFKQIA

 

>CYP6DB1 Acyrthosiphon pisum AUG5s6612g1t2 XR_045850 40% to CYP6K1

MISKEIIFVYTTCAIVVLFTAVYLYYRNIYSYWKKLGVYHLEPLFFFGNAKERVLFKKSFHEFHRD

MYFKFKGHRYAGYYLGRRASLVILDPEIIKCIMIKDFNHFTDRQTMRFRTSEYITEMLINLKGSKWKRMRGQLTPAFTSG

KLRTMEHLVDVCCNNMSDFLNENIKSEQGYDLEMKDFFGKFTLDVIATCAFGVESNSLKDVNGGFASRVSKFASLSIMKR

LTLYIVLLFMPGIARFVPLSFFNMEVIQFLANVIKEAKKCRKSTGQKRNDFLQLLLDSETDLDKNDKTKSKEDVLTEAQV

VAQSVLFLIAGFETSSTLLTFTCYELAINQTIQDKLREEICSVLKRFNGKCTYEAMQEMPLLDMVLMETLRMHPPVAQLE

RVSTQDYTLPDSNLLLKKGMTVQIPVIGLHYDPEYYPDPYKFEPYRFSPEEKAKRSHYVFLPFGTGPRNCIGLRFALMST

KRGMVHLLKDFSIDLSKEMTVPYEYSKHSMLLKAKDGIRLSFNKLSA

 

>CYP6DC1 Acyrthosiphon pisum AUG5s9515g6t1p 41% to CYP6AM1 Hodotermopsis sjostedti

MVFFDSSLLNLVAYGIVISTTFYFYLRYRYTFWQRQGCPVPLKPHIIYGHTKEVTKMKTWVGKHYANIYYNTDGYKFVGF

YQFQKPKLMLRDLNIIKDVFTKEFSTFPNRGIVFDDKLEPLTGNLLTLEGHRWKVLRNKLTPAFTIGKIKNMIDLIDGRA

QEMVRVLEKSAVIGEQVEFKELLARFSTDVISIVAFGFETNSLTNPDAEFRRVGRMLFSTSLETIIRNALNALAPSLIGL

LKVRSIKKEYADFFYNVVNDTVKYREENGIQRNDFLDLLMKIKRGQNLASDEDNFKFTMDVLAAQCFVWFIGGYETSSVT

LTFTFFELAQNLDVQMRAQDEIDSVLSKYDGKLTYEILQEMPYLDMIVSEALRKYPPVPNLTRKAVKPYKLPNSDFTLDK

GLQVVIPVYGIHNDPEYWPEPEKFIPERFTEEEKRNRPQYAYLPFGAGPRLCIGMRFGMMQVKVALFRILSTYNISLSKS

MKLPMKMNPKTIPANPDGGMFLHITKRKN

 

>CYP6DD1 Acyrthosiphon pisum LOC100162594.pro SCAFFOLD16233:102870..132505

MMLYINFKFIQLRAIIPKHEAALYIRFI

MFPAVVIIVACCTTVILFLYKYTTYTYKYWKSKSVTFATPVPLFGNIKDHVTLKMTQGECLKNIYNDFPREKFVGMYQLQ

TPTLLLRDPETIRLFLVKSFAHFTDRGFSYDGHREPLTKHLVNLEGDTWKILRQKLTPTFSSGKIKSMLGLLQGCGVQLI

EYMDATIESGKTEFEIRDLTAKFTTDVIGTCAFGLECNSLKDSQSEFRRMGCAVLNSSASLALAKMVRVFFPKLFKALKL

RTFPAEVQQFFMGIVKQTIDFRNTNRVRRNDFIQLLLEIKNQNHNQENAIKSIELTEELIAAQVFVFFLAGFETSSTTLS

FCLHEMAVNQDIQNRVYDEINETANMYGLPFSYEAISSMNYLEQCLKETMRKYPPVQALARVCTKQFRVPGTDLDLDVGT

AVLIPVYAIHHDPQYYPEPDTFNPDRFAKDGDGGGGDNGRPSGVFLPFGDGPRICIGMRFAMLEMKLALAQFLHRYLVTL

SDKSCTRIEFEPASFLSCPKGGIWLNVNKRKA

 

>CYP6DE2 Dendroctonus ponderosae

EZ115860.1

MVLIIALGVLLSTILLYCAYSKWKFQYWARQGVPQLNPRIFFGDTLPLVRGKPVQDFHLD

IYQKFKPTGAKCVGMYNSHIPELVAIDINLLKDIIVKDYSSFASHGLFYHEKNVLTPHVF

NIEGQIWKERRTKLTPLFTSAKMKQMFATVAGKSPGLIRLVGLSVDANKPADIKEILSRF

TTDVISEAAFGLDCKSLDEPDNMFRSIGREAFKPNSIKLYIENLFPSQFLGNIGYQAFSS

RIVSYFSKVVNETIQYREKNNVQRNDFLQLMLQLKQHGSLVKEDGT

 

>CYP6-un1 Acyrthosiphon pisum  AUG5s17796g1t1p SCAFFOLD17796:3506..66376

MFVPRKNSRFSIIALSFLLRNLVADVNILAVRISFLFIPPSADVADKQVRLDMFEFVTGTIEQTAALVTGALYELARDQN

IQNHLREHLDSVLDEHQEQVTIDQWXXXXXXXXXXXXXXXXXXNQTLRKYPLAAVVRRVATKPYVVPGTGGRGTIEPDSL

IVVPVYELHHDAEHFTEPEKFQPHRFPGQLSSAYMPHGSGPQSYIGKHFVELEAKLVIAMLMSRYEVHVDSATPGTPPDP

LDRKSFEGVRMTVANRSSVRESTMGASLRQFHMSNGVNSGDRKFLFF

 

>CYP9A1v1 Heliothis virescens (tobacco budworm) U23506

MILLLTWLVVIITAVLLYFRSVYSQLSKQGVNHLPTIPVFGNLM

WMVMKQEHFVDTLGRCVKAFPDDKIVGHYDMVSPILVVLDVDTVKRITVKDFEHFVDR

RSFTSSFDPIFGRGLLLLHGDEWKAMRSTMSPAFTSSKMRLMVPFMEEIALEMIRVLR

GKIKDSGKPYIDVEAKSMMTRYANDVIASCAFGLKVNSQASDHEFYVNSQAITKFKFS

AFLKVLFFRCLPSVAQKLKMSLVPRECSDYFSNVVLTTMKDREKNKVVRNDLINILME

VKKGQLTHEKDDADADAGFATVEESHIGRKQHNYEWTDSDLIAQAALFLFAGFDTVST

SMSFLLYELAVNPDVQDRLLQEIREYDEKNHGKIDYNVVQSMTYLDMVVSEGLRLWPP

AAVVDRVCVKDYNIGRPNKKATKDLIIHTGQAVAISPWLFHRNPKFFPEPAKFDPERF

SPENRHKILPFTYFSFCLGPRNCIGSRFALCEIKVILYLLIREMEVYPFEKTIYPPQL

SKDRFNMHLEGGAWVRLRVRPEKS

 

>CYP9A1v2 Heliothis virescens Satish Pimprale yellow strain

97% to CYP9A1v1,

RSRQSVTVTV TTSARAPVSV IWFLFFLAAM ILLLTWLVVI ITAVLLYFRS  50

VYSQLSKQGV NHLPTIPVFG NLMWMVMKQE HFVDTLGRCV KAFPDDKIVG  100

HYDMVSPILV VLDVDTVKRI TVKDFEHFVD RRSFTSSFDP IFGRGLLLLH  150

GDEWKAMRST MSPAFTSSKM RLMVPFMEEI ALEMIRVLRG KIKDSGKPYI  200

DVEAKSVMTM YANDVIASCA FGLNVNSQAS DHEFYVNSQA ITKFKFSAFL  250

KVLFFQCLPS VAQKLKMSLV PRECSDYFSN VVLTTMKDRE KNKVVRNDLI  300

NILMEVKKGQ LTHEKDDAEA DAGFATVEES HIGRKQHNYE WTDSDLIAQA  350

ALFLFAGFDT VSTSMSFLLY ELAVNPDVQD RLLQEIREYD EKNHGKIDYN  400

VVQSMTYLDM VVSEGLRLWP PAAVVYRVCV KDYNIGRPNE QATKDLIIHT  450

GQAVAISPWL FHRNPKFFPE PAKFDPERFS PENRHKIQPF TYFPFGLGPR  500

NCIGSRFALC EIKVILYLLI REMEVYPFEK TIYPPQLSKD RFNMHLEGGA  550

WVRLRVRPEK SLGVLTCDFI LFKYILLINI VHLCI  585

 

>CYP9A1v2 Heliothis virescens Satish Pimprale Pyrethroid-Resistant strain

98% to CYP9A1v1, 1 aa diff from yellow strain D397Y

AF140021

RSRQSVTVTV TTSARAPVSV IWFLFFLAAM ILLLTWLVVI ITAVLLYFRS  50

VYSQLSKQGV NHLPTIPVFG NLMWMVMKQE HFVDTLGRCV KAFPDDKIVG  100

HYDMVSPILV VLDVDTVKRI TVKDFEHFVD RRSFTSSFDP IFGRGLLLLH  150

GDEWKAMRST MSPAFTSSKM RLMVPFMEEI ALEMIRVLRG KIKDSGKPYI  200

DVEAKSVMTM YANDVIASCA FGLNVNSQAS DHEFYVNSQA ITKFKFSAFL  250

KVLFFQCLPS VAQKLKMSLV PRECSDYFSN VVLTTMKDRE KNKVVRNDLI  300

NILMEVKKGQ LTHEKDDAEA DAGFATVEES HIGRKQHNYE WTDSDLIAQA  350

ALFLFAGFDT VSTSMSFLLY ELAVNPDVQD RLLQEIREYD EKNHGKIDYN  400

VVQSMTYLDM VVSEGLRLWP PAAVVDRVCV KDYNIGRPNE QATKDLIIHT  450

GQAVAISPWL FHRNPKFFPE PAKFDPERFS PENRHKIQPF TYFPFGLGPR  500

NCIGSRFALC EIKVILYLLI REMEVYPFEK TIYPPQLSKD RFNMHLEGGA  550

WVRLRVRPEK SLGVLTCDFI LFKYILLINI VHLCI  585

 

>CYP9A2 Manduca sexta AF172278

IQEKLYAEIMENEANTSGKFDYNSIQNLTYLDCVISEALRLWPL

PVGLDRMCVRDYNMGRANEKSKKDFIIRKGEGIVVPVYSIHHDPEYFPEPYKFDPDRF

SEENKHNIKPMTYIPFGV

 

>CYP9A3v1 Helicoverpa armigera (Australian cotton bollworm) U86006

RVAENPDVQDKLLREIREYDEKNRGKIDYNVIQSMTYLDMVVSE

GLRLWPPAAIVDRMCVKDYNFGRPSPHATKDLIIREGQGVGVAPWVFHRNPKYFPEPT

KFDPERFSPENRHKILPFTYFPFGLGPSNCIG

 

>CYP9A4 Manduca sexta AF172279

ILLLALIQYIWKTYSRYDGTGVNYLKPLPIVGNVGMMFLGKRHQ

AQDLDLLYTSFPDDRFVGRYEMMQSIILLRELELIKKVTIKDSEHFIDHTSLIDSSVD

SIFGRILFSLNGQEWKDMRSTLSPAFTSSKMRGMVPFMIDVNKQMVGVIKNKMQAAGT

DYLDIECKDFTTRYANDVIASCAFGVKVDSHTEENNEFYTNGLATALAPFRRLLALGY

STFPSVMKKFNVKVFPTESKTFFKNLVLRTMKEREKHNIFRPDMIQLLMEAKKGKLTH

DEKASTETDTGFAAVEESDIGKRKVNAVWTDDDLVAQAVVFFLAGFETISTTMSFILH

ELAMNPDVQEKLYAEIMENEARTSGKFDYNAVQNLTYLDCVITETLRLWPPLVALDRL

CVKDYNLGRANRKCKKDFIIRKGESVAISVYSIHHDPKYFPEPYKFDPDRFSEENKHN

IKPMTYMPFGVGPRNCIGARFALCELKVMIYQVLQHFEVKVCEKTMIPARLDTTTLSM

GIHGGHWVRFKLRH

 

>CYP9A4v2    Manduca sexta AF172280

MMTLIWLGILLLALIQYIWKTYSRYDGTGVNYLKPLPIVGNVGM

MFLGKRHQAQDLDLLYTSFPDVRFVGRYEMMQSIILLRELELIKKVTIKDSEHFIDHT

SLIDSSVDSIFGRILFSLNGQEWKDMRSTLSPAFTSSKMRGMVPFMIDVNKQMVGVIK

NKMQAAGTDYLDIECKDLTTRYANDVIASCAFGVKVDSHTEENNEFYTNGLATALAPF

RRLLALGYSTFPSVMKKFNVKVFPTESKTFFKNLVLRTMKEREKHNIFRPDMIQLLME

AKKGKLTHDEKASTETDIGFAAVEESDIGKRKVNAVWTDDDLVAQAVVFFLAGFETIS

TTMSFILHELAMNPDVQE

 

>CYP9A5      Manduca sexta AF172281

IQYIWKTYSRYDGTGVNYLKPLPIVGNVGMMFLGKRHQAQDLDL

LYTSFPDDRFVGRYEMMYSKILLRELELIKKESIKDSEHFIDHTSLISSSADSIFGRI

FGRILFSLNGQEWKDMRSTLSPAFTSSKLRGMVPFMIDVNKQMVGVIKNKMQAAGTDY

LDIECKDLTTRYANDVIASCAFGVKVNSHAEEDNEFYINGLATALAPFRRLISLGYST

FPSVMKKFNVKLFPTESTTFFKNLVLRTMKEREKRNIFRSDMIQLLMEAKKGKLTHDE

KARTETDTGFAAVDESDIGKRKVNVVWTDDDLVAQAVVFFLAGFETISTTMTFILHEL

AMNPDVQEKLYAEIMENEARTSGKLHYNSVQNLTYLDCVITETLRLWPPLVSLDRLCI

KDYNLGRANRKCKKGFIIRKGESVAVPVYSIHHDPEYFPEPYRFNPDRFSEGNKHDIK

PMTYMPFGVGPRNCIGARFALCEVKVMIYEVLQHFEVKVCEKTTIPARLDTTTLSMGI

DGGHWVRFKLRH

 

>CYP9A6 Depressaria pastinacella AY295776

MIFWIWTAAILIALVLYFRQVYSRFSRYGVKHLRVVPFLGNLTR

VAFRKEHVIDMVLKNYEAFPEKRFVGTYQFINPVVYIKDLELVKKITVKDYEHFIDHN

QIFDADKDPFLGKNLLSLKGQDWKDMPSSLSP

 

>CYP9A7 Depressaria pastinacella AY295775

DIEFGTRDAFPEERFVGNYQFMNPVVIIRDLDLVKNITVKDFEY

FIDHNQLFNEDTEPFFGRTLLNLKGQDWKDMRSSLSPAFTSSKMRNMVPFMVDVGEQM

IHSLKKKILDSGANFIDVEISDLTTRYANDVIASCAFGLKVNSHMEENNQFYKMGRAV

SSFDFKQTIILFLNASFPKLMNRLNISVLSETIHNFFRSLVIDTMKDRETRQIIRPDT

IHLLMEAKKGKLTHDNEPTQNADAGFATVEESNLGKKQTNKVWTDDEIIAQAIIFLVA

GFETVSSTMTLLLHELTINPDVQEKLVQEINQNDIKNNGKFDYNSIQQLTYMDMVVSE

LLRRWPAVPILDRYCTKDCNIGRPNEKATEDYIVREGESLQIPTWGIHHDPQYFPNPF

KFDPER

 

>CYP9A8 Spodoptera litura AF525031

MIILLIWSAVLVAVITLYFRRLYSSFSRHGIKHIKPVPILGNMA

KVVLRAEHVSDGLTKVYNDFPEERVVGRYEFTKELIVVRDLELVKKITVKDFEHFLDH

RPLLGNGESYFSRNLFSLRGQEWKDMRSTLSPAFTSSKMRLMVPFMVEVGDQMMRSLH

RTIKESKNGSVDVDCKDLTARYANDVIASCAFGLKVDSHNDKNNNFYELGKETSTFNF

RQVIKAFLFANLPEVAKLLKLDFLSESSKNAFKRLVLDTMENRELKNIIRPDMIHLLM

EAKKGQLTHEDIKSKDQAVGFATVTESAVGKIKVNREWTDEDLVAQAVLFFIAGFEAV

SSSMSFLLYELAVNPDVQERLAQEIKETDAKNGGKFDFNSIQNMVYMDMVVSEVLRLW

PTAGALDRICTKDYNMGKPNLKAEKDYIIRKGTGMWIPVFTIHRDPDYFPNPLKFDPE

RFSEENRHTINPLAYMPFGVGPRNCIGSRFALCEVKVMTYQILREMEVSPCEKTCIPA

KLCNETFNLRLRGGHWLKFRART

 

>CYP9A9 Spodoptera exigua AB381883

MIILWIWLVVLVAVITLYFRRVYSSFDRHGIKHIKPTPMLGNMT

KVILRAEHMADALKKVYNDFPEERFVGRYEFIKELIVVRDLELVKKITVKDFEHFLDH

RPLLGNSDSYFSRNLFSLRGQEWKDMRSTLSPAFTSSKMRLMVPFMVEVGDQMMRSLH

KIIKESKNGSVDLDCKDLTTRYTNDVIASCAFGLKVDSHNDKNNSFYALGKETSTFDF

SQIIKAFLFANLPEVAKFLKLDFLSKSSKNAFKRLVLYTMENREMKNIIRPDMIHLLM

EAKKGKLTHDDIKSNDLAAGFATVTESAVGKKKVNRVWSDEDLVAQAVLFFIAGFEAV

SSGTSFLLHELAMNPDVQERLAQEIKEHDAKNGGKFDFNSIQNMVYMDMVVSEVLRLW

PAAGALDRICTKDYNMGKPNAKAEKDYIIRKGTGVWIPVFSIHRDPQYFPNPLKFDPE

RFSEENRHNINPLAYMPFGVGPRNCIGSRFALCEVKVMTYQIIREMVVSPCERTCIPA

KLCPETFNMRLKGGHWLNFRPRTEQIRM

 

>9A12 Helicoverpa armigera (Australian cotton bollworm) AY371318.1

MILVLVWVAVLITVAVLYLRQIYSRFSRYGVKHFRPVPLLGNMT

RMVLKQDHLIEDILRYYNSFPGE RFVGRFEFISEMVVIRDLELVKKIAVKDFEHFLDH

RSIFSSSDSFFSRNLFSLKGQEWKDMRSTLSPAFTSSKMRMMVPFMVEVGDQMMDTIK

KKIKESGNGYIDLECKDLTTRYANDVIASCAFGLKVDSHNETDNEFYTMGKLSSTFRF

REMIMFFVIANAPTVAKILKLDFLSEAAKKFFRNFVLDTMKNRELNHIIRPDMIHLLM

EAKKGKLTHEEIKSNDVTAGFATVEESAVGQKEITRVWTEEDLIAQAVLFFIAGFETV

SSGMSFLLYGLAVNPDVQERLAQEIKENDAKNGGKFDFNSIQNLQYMDMVVSELLRLW

PPGAALDRICTKDYSLGKPNDKAKHDFIVRKGTGISIPAFAFHRDPQFFPNPEKFDPE

RFSEENKHNIQSFAYMPFGIGPRNCIGSRFALCEMKVMAYQILQHMEVSPCERTCIPA

KLDTETFNMRLKGGHWLRFRPRQ

 

>CYP9A13 Mamestra brassicae antennal cytochrome P450 AY390260

MIILLIWVAVLIAVLVLYLRQVYSRSSRYGVKHFKPVPLLGDMT

GILFRVNHFTDDIVNLYDSFPEEKFVGRFEFLNEMVMIRDIELVKKITVKDFEHFLDH

RSIFSTSDSFFSRNLFSLKGQEWKDMRSTLSPAFTSSKMRLMVPFMVEVGDQMMSSLQ

KKIKESESGYIDIDCKDLTTRYANDVIASCAFGLKVDSHNDVDNEFYAMGKVSSTFNF

RQMLMFFLIVNAPKLAKVLKLDFLSEASKIFFRKLVLETMANREMKNVIRPDMIHLLM

EAKKGKLTHEDIKSSDEAAGFATVEESSVGQKEINRVWTDDDLIAQAVLFFIAGFETV

SAGMSFLLYELALNPDVQERLAQEIKETDAKNGGKFDFNSIQNMPYMDMVVSELLRLW

PPGIALDRICTKDYNLGKPNEKAEKDFIVRKGTGISIPAYAFHRDPQFFPNPDKFDPE

RFSEENKHNIQMFAYMPFGVGPRNCIGSRFALCEMKVMAYQILQHLEVSPCEKTTIPA

KLDKQTFNIRLEGGHWLRFRARK

 

>CYP9A14 Helicoverpa armigera AY487948

MIALLWLAVLVAALTLYLRQVYSRFSRFGVKHFEPVPLVGNLST

VLMRKAHASEDFNNLYQAFPGERFVGRYEFLRNIVMIRDLELVKSITVKDFEHFIDHR

MLADADVEPLFGRNLFSLRGHEWKEMRSTLSPAFTSSKMKAMVPFMMEVSEQLINFLK

MQIKESGGKHADIECKDLMTRYANDVIASCAFGLKVDSHNDRENEFYSIGTETANFDF

KKMLVIFGYACFPAIMKKFNVKMFSELIVNFFKNIVIGTMRNRQKNNILRPDMIHLLM

VAKKGKLTHEEKVAEANTGFATVEESDIGKVTVKKEWTEDDLTAQAVLFFVAGYETIS

SAMAFLIYELAVHPEVQEKLAKEIREHDAKNGGKFDFNSIQNMPYLDMVISEVLRLWP

PAVGLDRECSKDYNLGKPNDKAEKDYILRKGEALVIPVWSIHHDPEYFPDPYKFDPER

FSEENKHKIQPFSYMPFGLGPRNCIGSRFALCEVKVMAYQLIQQMELSPCEKTSIPAV

LAKDTFNLKVEGGHYIRVKLRQ

 

>CYP9A17v1 Helicoverpa armigera AY753201

MILALVWVAVLIAVAVLYLRQVYSRFSRYGVKQFRPVPILGNMT

RILLKQDHFVDDTMRYYNSFPEERFVGKFEFIKELVVIRDIELAKKIAVKDFEHFLDH

RSMFSSSDSFFSRNLFSLKGQEWKDMRSTLSPAFTSSKMRMMVPFMVEVGDQMMAAIK

NKIKESGNGYIDIECKDLTTRYANDVIASCAFGLKVDSHNETDNEFYTMGKLSSTFNF

RQMLVFFFIANAPTVAKILKLDFLSEAAKKFFRNLVLDTMKNRELNHIIRPDMIHLLM

EAKKGKLTHEEIKSNDVTAGFATVEESAVGQKEITRVWTDEDLIAQAVLFFIAGFETV

SSGMSFLLYELAVNPDVQERLAQEIKENDAKNGGKFDFNSIQNLQYMDMVVSELLRLW

PPGAALDRICTKDYNLGKPNDKAKHDFIVRKGTGISIPAFAFHRDPQFFPNPEKFDPE

RFSEENKHNIQSFAYMPFGIGPRNCIGSRFALCEMKVMAYQILQHMEVSPCERTCIPA

KLDTETFNMRLKGGHWLRFRLRM

 

>CYP9A17v2 Helicoverpa armigera (Australian cotton bollworm) DQ003275

MILVLVWVAVLIAVAVLYLRQVYSRFSRYGVKQFRPVPILGNMT

RILLKQDHFVDDTMRYYNSFPEERFVGKFEFIKELVVIRDIELVKKIAVKDFEHFLDH

RSMFSSSDSFFSRNLFSLKGQEWKDMRSTLSPAFTSSKMRMMVPFMVEVGDQMMAAIK

NKIKESGNGYIDIECKDLTTRYANDVIASCAFGLKVDSHNETDNEFYTMGKLSSTFNF

RQMLVFFFIANAPTVAKILKLDFLSEAAKKFFRNLVLDTMKNRELNHIIRPDMIHLLM

EAKKGKLTHEEIKSNDVTAGFATVEESAVGQKEITRVWTDEDLIAQAVLFFIAGFETV

SSGMSFLLYELAVNPDVQERLAQEIKENDAKNGGKFDFNSIQNLQYMDMVVSELLRLW

PPGAALDRICTKDYNLGKPNDKAKHDFIVRKGTGISIPAFAFHRDPQFFPNPEKFDPE

RFSEENKHNIQSFAYMPFGIGPRNCIGSRFALCEMKVMAYQILQHMEVSPCERTCIPA

KLDTETFNMRLKGGHWLRFRPRQ

 

>CYP9A18 Helicoverpa armigera DQ256408.1

MTILLLIWALVLAVIVLRDLRRLYSTFSKDGIKHFKPVPLLGNM

SSVIFRRNHYADNILKFYKSFPDEKFVGRFEFVNQSIVILDLELVKKITIKDFEHFPD

HRNFGAESFFSRTLFLLAGQEWKDMRSTLTPAFTSSKIRLMVPFMVEVGDQMILSLKK

KLEESKDDYIEVDCKDLTTRYANDVIASCAFGLKVDSHMDRDNRFYAMGGSLFEFGFR

TMIMFFVLLNAPKVAKFFKWDIVPASVRKFFTNLVLDTMKDREMRHIIRPEMIHLLME

ANKGKLTHEDIMPNDNAVGFATVEESAIGLNSSKRVWTDEDIVAQAFVFFAAGFETVS

ATMAFLLYELAVHPEVQERLAQEIREYDDKNDGKFDFNSIQDMKYMDMVVSEVLRKWP

APLVLDRICTKDYNLGKPNNAAEKDFIIRKGSGVQIPVYAFHNDPRYFPNPEKFDPER

FSPDNKHKFNANAYMPFGVGPRNCIGSRFALCEVKVITYQILRHMEVSPCKSTCIPAK

LATNNLNLRLKGGHSLRFKLRK

 

>CYP9A19 Bombyx mori (silkworm)

MIIIIWTLVIGLALLLYLKQTYSYFSKHEIKSVTPLPILGNMGKIVFKFNHLVDDISQLYNNFPEER ()

FVGRYEFVNPVIYIRDIEIVKRITIKDFEHFLDHRTIVNEDSDPMFGRNLFSLK ()

GQEWKDMRSTLSPAFTSSKMKLMMPLIVEVGEQMINAIKENIKNS ()

GVGYVDIDTKDLTTRYANDVIASCAFGLKVDSLTEENNRFYAMGKAATNFSFKQILMLLGFISFPKLMK ()

MTKFRLFSEETSGFFKELIM

GTMKDREMRKIIRPDMIHLLMEAKK ()

GKLVHDNKSSKDTDAGFATVEESAVGKKQIDR ()

VWTDDDIIAQAVLFFIAGFETVSSAMTFLLHELALNPEVQEKLVEEIKENKERNNGKFDYNSIQNMAYLDMVVS ()

ELLRLWPPAVSMDRICVQDYNLGKPNDKAKRDFI (0)

LRKGTGVAIPVWAFHRNPEFFPDPQKFDPERFSEENKHNIKPFTYLPFGVGPRNCI (1)

GSRFALCEVKVMAYQLLQHMEISPCEKTCIPSKLSKEIFNLRLEGGHWVRLKIRD*

 

>CYP9A20 Bombyx mori (silkworm)

MILLIWAVVLIAAFVLFYKQAYSLFSKHGVKGFTPLPFFGNMGRIVIKMDHFSDHIQSLYDSFPEER ()

FVGRYEFLNPMVIIRDIELLKKITVKDFEHFLDHRTIINKDTDPFFGRSLFFLR ()

DQDWKDMRSTLSPAFTSSKMKLMMPFIVEVGEQMNKA LKQRIQEAG ()

VGYVDIDSKDLTTRYANDVIASCAFGLKVDSITEENNQFYAMGKAASTFNFRQLLIFFGLASVPKLV ()

KILRITLFQKEIKTFFRELILGTMKNREAQNIIRPDMIHLLMEAKK ()</