These 1744 sequences are searchable at

the P450 BLAST server


>CYP4C1 cockroach M63798












>CYP4C2 Anopheles albimanus (mosquito) L38678





>CYP4C3 D. melanogaster AC014779 73845-80196 also AC008219















>CYP4C3 D. pseudoobscura ortholog of Cyp4c3 94% intron 3 missing














>CYP4C4 Diploptera punctata (Pacific beetle cockroach) AF071073



>CYP4C5 Diploptera punctata (Pacific beetle cockroach) AF071074



>CYP4C6 Diploptera punctata (Pacific beetle cockroach) AF071075





>CYP4C7 Diploptera punctata (Pacific beetle cockroach) AF071072



>CYP4C8 Mastotermes darwiniensis cytochrome U77126



>CYP4C9 Coptotermes acinaciformis AF046008



>CYP4C10 Coptotermes acinaciformis AF046009



>CYP4C11 Mastotermes darwiniensis AF067631



>CYP4C12 Mastotermes darwiniensis AF067632



>CYP4C13 Mastotermes darwiniensis AF067633



>CYP4C14 Mastotermes darwiniensis AF067634



>CYP4C21 Blattella germanica (German cockroach) AF275641











>CYP4C22v1   Culex pipiens pallens (mosquito) AF157093



>CYP4C22v2  Culex pipiens  AF208659




>CYP4C23    Culex pipiens pallens (mosquito) AF157090



>CYP4C25 Anopheles gambiae CYPb1x3, 495 aa AAAB01008846.1











>CYP4C26 Anopheles gambiae CYPb1x1, 480aa AAAB01008846.1









>CYP4C27 Anopheles gambiae CYPo3r3 515aa AAAB01008984.1













>CYP4C28 Anopheles gambiae CYPs3l1 460 aainc AAAB01008849.1 N-term added 








>CYP4C35 Anopheles gambiae CYPo3r1 509 aa AAAB01008984.1 











>CYP4C36 Anopheles gambiae CYPo3r2 512 aa AAAB01008984.1 













>CYP4C37 Anopheles gambiae CYPb1x2 548aa AAAB01008846.1









>CYP4C38 Aedes aegypti 1.673_1 AAGE01009885 CYP4C38 4T1.4









>CYP4C38 Aedes aegypti 4T1.4 84% to CYP4C36, 83% to 4C35,

82% to 4C27, 53% to 4T1.1





>CYP4C38 ortholog intact from CPIJ001810 + CPIJ018716, 78% to CYP4C38 Aedes

XM_001843432.1 with revisions, XM_001868893.1 (C-term)













>CYP4C40 Anopheles funestus AY648707



>CYP4C41 Anopheles funestus AY648700



>CYP4C43v1 Reticulitermes flavipes (termite) DQ279463.1





>CYP4C43v2 Reticulitermes flavipes (termite) DQ279464.1





>CYP4C44v1 Reticulitermes flavipes (termite) DQ279465.1





>CYP4C44v2 Reticulitermes flavipes (termite) DQ279466.1





>CYP4C45v1 Reticulitermes flavipes (termite) DQ279467.1





>CYP4C45v2 Reticulitermes flavipes (termite) DQ279468.1





>CYP4C46 Reticulitermes flavipes (termite) DQ279469.1





>CYP4C47 Reticulitermes flavipes (termite) DQ279470.1





>CYP4C48 Reticulitermes flavipes (termite) DQ279471.1






>CYP4C50 Aedes aegypti 1.295_3 AAGE01102043.1 4C25 ortholog  80% to 4C25










>CYP4C50v1 Culex pipiens CPIJ017351 ortholog XM_001867494

2 aa diffs to partial seq CYP4C22v1

3 aa diffs to CPIJ018854

89% to CYP4C50 Aedes, 63% to CYP4C52, 60% to CYP4C51











>Culex pipiens CPIJ018854 CYP4C50v2 ortholog XM_001869293.1

1 aa diff to partial seq CYP4C22v1











>CYP4C51 Aedes aegypti 1.295_2 92% to Aedes albopictus AY971511









>CYP4C51v1 Culex pipiens CPIJ018944 ortholog 71% to CYP4C51 Aedes XM_001869166.1

small diference at the ETAM exon boundary









>CYP4C51v2 Culex pipiens v2CPIJ018944 This seq missing a small (intron?) region near the N-term compared to CPIJ018944.  Aedes CYP4C51 has seq in this region so it is probably not an intron.









>CYP4C52 Aedes aegypti 1.295_1 AAGE01029369 Hils Version? 72% to 4C26









>Culex pipiens CPIJ018943 CYP4C52v1 ortholog, XM_001869165.1

75% to CYP4C52, 62% to CYP4C50, 55% to CYP4C51










>Culex pipiens CPIJ019395 CYP4C52v2 XM_001869675.1

78% to CYP4C52 97% to CPIJ018943, missing N-term








>CYP4C60 Nasonia vitripennis XM_001603426.1













>CYP4C61 Nilaparvata lugens FM163384










>CYP4C62 Nilaparvata lugens FM163385











>Cyp4d1 D. melanogaster AC017770 49988-51720











>CYP4D1 D. pseudoobscura ortholog with one N-terminal exon













>Cyp4d1 D. melanogaster alt. splice AC017770 48817-51720











>CYP4D1 D. pseudoobscura ortholog with alternative splice exon 1













>Cyp4d2 D. melanogaster AC017770 comp(32267-34028)











>Cyp4D2 D. pseudoobscura ORTHOLOG 79% TO 4D2











>CYP4D3v1 Musca domestica (house fly) 73% to 4D10

4 aa diffs to CYP4D3v2





>CYP4D3v2 Musca domestica (house fly) Nannan Liu 7/20/06 EF615000.1



>CYP4D4v1 Musca domestica (house fly)





>CYP4D4v2 AF182170 housefly 4aa diffs to CYP4D4v1





>CYP4D4v2 EF615001 housefly Nannan Liu 7/20/06




>CYP4D5      Anopheles albimanus (mosquito) L38679





>CYP4D6      Anopheles albimanus (mosquito) L38680





>CYP4D7      Anopheles albimanus (mosquito) L38681





>Cyp4d8 D. melanogaster AC017388 comp(37292-39859) AC010557 AC010112 AC010113













>Cyp4d8 D. pseudoobscura 79%














>CYP4D10 Drosophila mettleri U91634




>CYP4D11 Ceratitis capitata AF028606



>CYP4D12 Ceratitis capitata AF028817



>CYP4D13 Ceratitis capitata AF028818



>Cyp4d14 D. melanogaster AC017770 35699-37438 missing intron 3












>Cyp4d14 D. Pseudoobscura 79%












>CYP4D15 Anopheles gambiae CYPe2r3 , 522aa AAAB01008859.1 














>CYP4D16 Anopheles gambiae CYPe2r5, 510 aa AAAB01008859.1 










>CYP4D17 Anopheles gambiae CYPe2r4, 508 aa AAAB01008859.1








>CYP4D18v1  Culex pipiens AF190775





>CYP4D18v2  Culex pipiens AF191728           



>CYP4D19v1  Culex pipiens AF190786




>CYP4D19v2  Culex pipiens AF190789




>CYP4D19v3  Culex pipiens AF190777




>CYP4D19 Culex pipiens CPIJ009477 XM_001851373

4 aa diffs to CYP4D19v1 Culex pipiens partial PCR fragment

5 aa diffs to CYP4D19v2 Culex pipiens partial PCR fragment

7 aa diffs to CYP4D19v3 Culex pipiens partial PCR fragment








>Cyp4d20 D. melanogaster AC019509 comp(19731-21636)












>Cyp4D20 D. pseudoobscura ORTHOLOG 74% TO 4D20












>Cyp4d21 D. melanogaster AC020004 55466-57280













>CYP4D22 Anopheles gambiae CYPe2r6, old short CYP4H20 is same sequence




>CYP4D23 Aedes aegypti 1.283_3 CYP4D23v2 4T1.3









>CYP4D23v1 Aedes aegypti 4T2.8 CO635936.1

80% to 4D22, 99% to 4T1.3 1 diff, 98% to 4T1.1






>CYP4D23v2 Aedes aegypti 4T1.3 CO635937.1

80% to CYP4D22, 99% to 4T2.8 1 diff






>CYP4D23v3 Aedes aegypti 4T1.1 CO635938.1

79% to CYP4D22, 98% to 4T1.3 2 diffs






>CYP4D24 Aedes aegypti 1.283_7 AAGE01006231 CYP4D24 4T2.6









>CYP4D24 Aedes aegypti 4T2.6 CO635939.1

75% to 4D16, 56% to 4T1.6






>CYP4D25_Contig5 Anopheles funestus AY648701.1

94% to 4D22 56% to contig8 53% to contig10 probable ortholog of 4D22




289 CIGQ 278


>CYP4D26_Contig8 Anopheles funestus AY648702.1

85% to 4D15 78% to contig 10





>CYP4D27_Contig10 Anopheles funestus AY648703.1

86% to 4D17 78% to contig 10 possible ortholog of 4D17

79% to 4D16 and 80% to 4D15





>CYP4D35 Musca domestica (house fly) DQ642007.1












>CYP4D36 Musca domestica (house fly) DQ642008.1









>CYP4D37 Aedes aegypti 1.283_4 AAGE01019344 82% to

AAGE01055570 same seq as AAGE01019344.1











>CYP4D38 Aedes aegypti 1.283_5 AAGE01055570 100% but N-term does not match










>CYP4D39 Aedes aegypti 1.283_6 AY431801 64% to 4D24









>CYP4D40 Culex pipiens CPIJ009474 99% to CYP4D40 Culex_quinquefasciatus

XM_001851370 3 aa diffs to CYP4D18v2 Culex pipiens partial PCR fragment









>CYP4D40 Culex_quinquefasciatus_02

5 aa diffs to XM_001851370, 84% to 03, 67% to 4D24 Aedes

96% (5 aa diffs out of 127) to CYP4D18v2 AF191728 Culex pipiens



>CYP4D41 Culex pipiens CPIJ009473 XM_001851369

99% to CYP4D41 Culex_quinquefasciatus,

6 aa diffs to CYP4D18v1 Culex pipiens partial PCR fragment









>CYP4D41 Culex_quinquefasciatus_03

5 aa diffs to XM_001851369

60% to CYP4D16 Anoph. 66% to 4D24 Aedes

96% (5 aa diffs out of 127) to CYP4D18v2 AF191728 Culex pipiens











>CYP4D42 Culex pipiens pallens CB074945.1



>CYP4D42v1 Culex pipiens CPIJ009478 XM_001851374

1 aa diff to CYP4D42 Culex pipiens pallens partial fragment

1 aa diff to CPIJ020229 from TWFS to end, cyan parts do not match

missing correct N-term, compare to CPIJ009475










>CYP4D42v2 Culex pipiens CPIJ020229 XM_001870408.1

1 aa diff to CYP4D42 Culex pipiens pallens partial fragment

1 aa diff to CPIJ009478 from TWFS to end, cyan parts do not match

missing correct N-term, compare to CPIJ009475









>CPIJ009475 CYP4D43 XM_001851371

2 aa diffs to CYP4D43 Culex pipiens pallens partial fragment









>CYP4D43 Culex pipiens pallens CB074951.1



>CPIJ009476 CYP4D44 Culex pipiens XM_001851372.1

73% to CYP4D37, 71% to CYP4D38









>pseudogene fragment CYP4D45P Culex pipiens 59% to CPIJ009476 N-term

between 325X5P and CYP325X6



>Cyp4e1 D. melanogaster AC020402 44580-46698












>Cyp4e1 D. pseudoobscura ortholog of 4e1 INTRON 4 MISSING 73% to 4e1













>Cyp4e2 D. melanogaster AC020402 41848-44099














>Cyp4e2 D. pseudoobscura INTRON 4 MISSING 86% to 4e2














>Cyp4e3 D. melanogaster AC020324 73117-75125















>Cyp4e3 D. pseudoobscura ortholog 81%














>Cyp4e5 Drosophila mettleri U78486




>Cyp4e6 Ceratitis capitata AF028819




>Cyp4g1 D. melanogaster AC020093 comp(33262-34932) no introns












>Cyp4G1 D. pseudoobscura ortholog NO INTRONS 93% IDENTICAL TO 4G1












>CYP4G2v1 Musca domestica From Claus Tittiger 1/5/98

1 aa diff to EF615002





















>CYP4G2v1 Musca domestica Nannan Liu 7/20/06 EF615002




>CYP4G2v2 Musca domestica Nannan Liu, 5 aa diffs to EF615002

4 frameshifts = &








>CYP4G4 Manduca sexta Contig_4957_5'-truncated

sent to genbank

CA798770 AI187631 AI142166 AI187497

BE015410 BE015411 AY635178 = CYP4G4  aa 420 to the end















>CYP4G8v1 Helicoverpa armigera (Australian cotton bollworm) U86002



>CYP4G9 Helicoverpa armigera U86003





>CYP4G10 Helicoverpa armigera U86004





>CYP4G11 Apis mellifera













>CYP4G12 Trichogramma cacoeciae AF207949





>CYP4G13 Musca domestica (house fly)











>CYP4G13v2 Musca domestica AF355145, 98% to CYP4G13












>CYP4G14 Tribolium castaneum (red flour beetle) XP_973423, AF263514,











>Cyp4g15 D. melanogaster AC013897 comp(8972-10574 and 5306-6643) two pieces













>Cyp4G15 D. pseudoobscura ortholog (94%) intron #4 missing













>CYP4G16 Anopheles gambiae CYPs1x5, 565 aawi AAAB01008885.1










>CYP4G17 Anopheles gambiae CYPs1x3, 562 aawi AAAB01008963.1 





>CYP4G18 Diabrotica virgifera (western corn rootworm) a beetle AF243507





>CYP4G19 Blattella germanica AY176056












>CYP4G20 Mamestra brassicae antennal cytochrome P450 AY390259












>CYP4G21_Contig4 Anopheles funestus 94% to 4G17 probable ortholog of 4G17






>CYP4G22 Bombyx mori (silkworm) 64% to 4G19












>CYP4G23 Bombyx mori (silkworm)  58% to 4G19 59% to CYP4G22













>CYP4G24 Bombyx mori (silkworm)  71% TO CYP4G23















>CYP4G25 Antheraea yamamai AB196795












>CYP4G25 Antheraea pernyi (Chinese oak moth, Chinese Tussah moth) GU205081












>CYP4G27 Ips paraconfusus (California fivespined ips, bark beetle) DQ471883












>CYP4G29 Leptinotarsa decemlineata (Colorado potato beetle) DQ117464











>CYP4G30 RAG3: 81% to 4G23 Spodoptera litura (common cutworm) DQ350813





>CYP4G31 SC2: 80% to 4G23 Spodoptera litura (common cutworm) DQ350812





>CYP4G32 SD2: 78% to 4G23 Spodoptera litura (common cutworm) DQ350812





>CYP4G33 Chironomus tentans (aquatic midge) AY880065












>CYP4G34 Leptinotarsa decemlineata (Colorado potato beetle) DQ631644



>CYP4G35 Aedes aegypti 1.318_1 AAGE01114834 100% to? AAGE01340100? 80% to 4G17










>CYP4G36 Aedes aegypti 1.106_1 AAGE01072700.1? 88% to 4G16












>CYP4G37 Spodoptera exigua EF113593





>CYP4G38 Pediculus humanus humanus (body louse) XM_002423454.1













>CYP4G39 Pediculus humanus humanus (body louse)












>CYP4G43 Nasonia vitripennis (jewel wasp)













>CYP4G44 Nasonia vitripennis (jewel wasp)













>CYP4G47 Zygaena filipendulae GQ915319












>CYP4G48 Zygaena filipendulae GQ915320












>CYP4G49 Manduca sexta Contig_1986_FL sent to genbank












>CYP4G51 Acyrthosiphon pisum LOC100164072 CYP4G like 64% to CYP4G16










>CYP4H1      Anopheles albimanus (mosquito) L38682





>CYP4H2      Anopheles albimanus (mosquito) L38683





>CYP4H3      Anopheles albimanus (mosquito) L38684





>CYP4H4      Anopheles albimanus (mosquito) L38685





>CYP4H5      Anopheles albimanus (mosquito) L38686





>CYP4H6      Anopheles albimanus (mosquito) L38687





>CYP4H7      Anopheles albimanus (mosquito) L38688





>CYP4H8      Anopheles albimanus (mosquito) L38689





>CYP4H9      Anopheles albimanus (mosquito) L38690






>CYP4H12v1  Culex pipiens pallens (mosquito) AF157091 = old CYP4H23v1





CYP4H12v2  Culex pipiens AF191731





CYP4H12v4  Culex pipiens pallens CB074950.1





CYP4H12v5  Culex pipiens pallens CB074949.1





CYP4H13 Culex pipiens pallens (mosquito) AF160259






>CYP4H14 Anopheles gambiae CYPc2r1, 485aa AAAB01008987.1 





>CYP4H14 Anopheles funestus cytochrome AY987354





>CYP4H15 Anopheles gambiae CYPc2r2, 500aa AAAB01008987.1




>CYP4H15 Anopheles gambiae AY062190 4 aa diffs to CYP4H15 CYPc2r2

2 aa diffs to CYP4H15v2





>CYP4H16 Anopheles gambiae CYPn3r1 499aa AAAB01008964.1 











>CYP4H17 Anopheles gambiae CYPn3r3 506aa AAAB01008964.1







>CYP4H18 Anopheles gambiae CYPn3r2 507 aa AAAB01008964.1 









>CYP4H19 Anopheles gambiae  CYPa1x1 514aa AAAB01008846.1 no introns 



>CYP4H21v1  Culex pipiens AF208660





>CYP4H21v2  Culex pipiens pallens CB074948.1





>CYP4H21v3  Culex pipiens pallens CB270837.1





>CYP4H22v1  Culex pipiens AF190782





>CYP4H22v2  Culex pipiens AF190784





>CYP4H22v3  Culex pipiens pallens CB074946.1





>CYP4H23v2  Culex pipiens AF190787





>CYP4H23v3  Culex pipiens AF191729





>CYP4H23v4  Culex pipiens AF190783





>CYP4H24 Anopheles gambiae CYPa1x2, 509aa AAAB01008846.1 no introns 9849469




>CYP4H25 Anopheles gambiae CYPc2r3,503aa AAAB01008987.1




>CYP4H26 Anopheles gambiae CYPc2r4, 507aa AAAB01008987.1











>CYP4H27v1 Anopheles gambiae CYPs3r1 511 aa AAAB01008944.1 plus strand 



>CYP4H27v2 Anopheles gambiae 95% to to 4H27v1, AAAB01008530.1



>CYP4H28 Aedes aegypti 1.85_2 AAGE01082714.1 CYP4H28 4T2.2









>CYP4H28 4T2.2 66% to 4H18, 57% to 4I1.8






>CYP4H29 Aedes aegypti 1.285_1 4H29? AAGE01010708 CYP4H29 4I1.8









>CYP4H29 4I1.8 66% to 4H16, 66% to 4H25, 57% to 4T2.2





>CYP4H30 Aedes aegypti 1.85_1 AAGE02005220.1 65% to 4H14












>CPIJ007188 CYP4H30 Culex quinquefasciatus synonym Culex pipiens

69% to CYP4H30 Aedes, probable ortholog


65% to CPIJ001886, 57% to CPIJ006721, 53% to CYP4H34, 55% to CYP4H38









>CYP4H30v1 Anopheles gambiae 4 DIFFS WITH 4H30v2, AAAB01008944.1 plus strand partial seq.




>CYP4H30v2 Anopheles gambiae 90% to 4H27, AAAB01008530.1 89454-91048 plus strand 



>CYP4H31 Aedes aegypti 1.48_5 AAGE01049176 67% to 4H14









>CPIJ001886 CYP4H31 Culex pipiens 79% to CYP4H31 probable ortholog









>CYP4H32 Aedes aegypti 1.283_1 AAGE01321728.1 JP_16 3aa

diffs use this seq 57% to CYP4H14











>CYP4H33 Aedes aegypti 1.923_1 AAGE0107691 68% to 4H18









>CPIJ011127 CYP4H34 Culex pipiens 98% to CYP4H34 Culex_quinquefasciatus









>CYP4H34 Culex_quinquefasciatus_04

58% to CYP4H31 Aedes, 66% to 4H12v5 and 4H12v4











>CPIJ010075 CYP4H35 Culex pipiens 100% to CYP4H35 Culex_quinquefasciatus

5 aa diffs to 4H22v1 Culex pipiens partial seq

3 aa diffs to 4H22v2 Culex pipiens partial seq

8 aa diffs to 4H22v3 Culex pipiens partial seq









>CYP4H35 Culex_quinquefasciatus_08

74% to 4H29 Aedes, 59% to 4H15 Anoph., 59% to 4H25 Anoph.,

40% to 4D1, 44% to 4H34, 45% to 4D40

The 4H subfamily seems to need to be split











>CPIJ008937 CYP4H36 Culex pipiens 100% to CYP4H36 Culex_quinquefasciatus

72% to CYP4H29 Aedes probable ortholog









>CYP4H36 Culex_quinquefasciatus_09

72% to 4H29 Aedes, 60% to 4H15 Anoph., 44% to 4H34











>CYP4H37 Culex_quinquefasciatus_10

62% to 4H19 Anoph., 62% to 4H31 Aedes, 59% to 4H34











>CPIJ006721 CYP4H37v1 Culex pipiens 100% to CYP4H37 Culex_quinquefasciatus (green from other seq)

95% to CYP4H12v1  Culex pipiens pallens partial seq

2 aa diffs to CYP4H12v2  Culex pipiens pallens partial seq

5 aa diffs to CYP4H12v4  Culex pipiens pallens partial seq

9 aa diffs to CYP4H12v5  Culex pipiens pallens partial seq

60% to CYP4H28 Aedes probable ortholog











>CPIJ015681 CYP4H37v2 Culex pipiens 99% to CYP4H37 Culex_quinquefasciatus (3 aa diffs)

This seq is missing the C-term 92 aa

Only 4 aa diffs to CPIJ006721

60% to CYP4H28 Aedes probable ortholog








>CPIJ001758 CYP4H38 Culex pipiens 99% to CYP4H38 Culex_quinquefasciatus,

79% to CYP4H33 probable paralog (3 adjacent genes)

3 aa diffs to 4H21v1 Culex pipiens partial seq

6 aa diffs to 4H21v2 Culex pipiens partial seq

7 aa diffs to 4H21v3 Culex pipiens partial seq









>CYP4H38 Culex_quinquefasciatus_16

70% to 4H18 Anoph., 79% to 4H33 Aedes, 53% to 4H34











>CPIJ001757 CYP4H39 Culex pipiens 92% to CYP4H13  Culex pipiens pallens partial seq

79% to CYP4H33 probable paralog (3 adjacent genes)









>CPIJ001759 CYP4H40 Culex pipiens 79% to CYP4H33 missing C-term probable paralog (3 adjacent genes)








>CPIJ008936 CYP4H41 Culex pipiens 66% to CYP4H29, 72% to CYP4H36









>CYP4J1 Anopheles albimanus (mosquito) L38691





>CYP4J2 Anopheles albimanus (mosquito) L38692





>CYP4J3 Anopheles albimanus (mosquito) L38693





>CPIJ016284 CYP4J4 Culex pipiens 2 aa diffs to CYP4J4v2









>CYP4J4v1 Culex pipiens pallens (mosquito) AF157092





>CYP4J4v2 Culex pipiens 96% identical to 4J4v1, AF190778





>CYPk2l2 = CYP4J5 Anopheles gambiae, 532 aa 65% to 4J2 62% to 4J1 54% to 4J8












>CPIJ001754 CYP4J6 Culex pipiens

3 aa diffs to CYP4J6v2 Culex pipiens partial PCR fragment

7 aa diffs to CYP4J6v1 Culex pipiens partial PCR fragment









>CYP4J6v1   Culex pipiens AF190776





>CYP4J6v2 Culex pipiens AF190781





>CYP4J7v1 Culex pipiens AF190780





>CYP4J7v2 Culex pipiens AF190785





>CYP4J8 Culex pipiens AF190788





>CYP4J8v2 Culex pipiens pallens CB074944.1





>CYP4J8v3  Culex pipiens pallens CB074947.1





>CYPk2l1 = CYP4J9 Anopheles gambiae,  506 aa retained intron before perf



>CYP4J9 Anopheles funestus AY987355.1





>CYPk2l3 = CYP4J10 Anopheles gambiae,  533 aa



>CYP4J11_CONTIG1 Anopheles funestus AY648705

79% TO 4J5 57% TO CONTIG 7 probable ortholog of 4J5

60% to 4J9 and 58% to 4J10





>CYP4J12_CONTIG6 Anopheles funestus AY648706

80% TO 4J10, SAME SEQ AS CONTIG 7 (1 AA DIFF) probable ortholog of 4J10

54% to 4J9 and 53% to 4J5





>CYP4J12_CONTIG7 Anopheles funestus 83% TO 4J10, SAME SEQ AS CONTIG 6 (1 AA DIFF) probable ortholog of 4J10





>CYP4J13 Aedes aegypti 1.869_1 AY431450 65% to 4J10









>CPIJ000294 CYP4J13 Culex pipiens

6 aa diffs to partial seq CYP4C23, 75% to CYP4J13 probable ortholog

51% to CYP4J14, 54% to 4J17, 50% to 4J15, 52% to CYP4J16









>CYP4J14 Aedes aegypti 1.869_2 AAGE01397643 AAGE02025842.1 ESTs DW194177.1 EB096538.1 use this seq













>CYP4J15v1 Aedes aegypti 1.869_3 matches Nelson 223407477 on top AAGE02025843.1











>CYP4J15v2 Aedes aegypti AAGE02030510.1 98% to AAGE02025843.1 6807-5100. 9 aa diffs












>CYP4J16 Aedes aegypti 1.4503_1 96% to AAGE01005255, = AAGE02035951.1









>CYP4J17 Aedes aegypti 1.985_2 AAGE01216085 JP_4









>CPIJ000293 CYP4J18 Culex pipiens, 99% to CYP4J18 Culex_quinquefasciatus

5 aa diffs to CYP4J8v1 Culex pipiens partial PCR fragment

4 aa diffs to CYP4J8v2 Culex pipiens partial PCR fragment

5 aa diffs to CYP4J8v3 Culex pipiens partial PCR fragment









>CYP4J18 Culex_quinquefasciatus_14 XM_001841814.1 (called CYP4V3 in GenBank entry, this is wrong)

68% to 4J16 Aedes, 54% to 4J9 Anoph.










>CPIJ001755 CYP4J19 Culex pipiens, 100% to CYP4J19 Culex_quinquefasciatus missing C-term

6 aa diffs to CYP4J7v1 Culex pipiens partial PCR fragment

8 aa diffs to CYP4J7v2 Culex pipiens partial PCR fragment








>CYP4J19 Culex_quinquefasciatus_12

59% to 4J9 Anoph., 71% to 4J19 Aedes










>CPIJ010480 CYP4J20 Culex pipiens, 100% to CYP4J20 Culex_quinquefasciatus

5 aa diffs to CYP4J4v1 Culex pipiens partial PCR fragment









>CYP4J20 Culex_quinquefasciatus_13

54% to 4J5 Anoph., 50% to 4J13 Aedes











>CYP4K1 Anopheles albimanus (mosquito) L38694





>CYPe2r1 = CYP4k2 Anopheles gambiae, 509 aa 68% to 4K1 anoph. albimanus



>CYP4K3 Aedes aegypti 1.283_8 AAGE01021812??51% to 4K2 correct PKG, 54% to 4K2 after first exon










>CPIJ009468  CYP4K3 ortholog Culex pipiens 66% to CYP4K3









>CYP4L1 Manduca sexta (tobacco hornworm) L38668





>CYP4L2 Manduca sexta (tobacco hornworm) L38669





>CYP4L4 MbraC5 antennae of the moth Mamestra brassicae

AY063501.1 Martine Maibeche

59% to 4L1












>CYP4L5 Helicoverpa armigera cytochrome AY571901






>CYP4L6  Bombyx mori silkworm, 67% to 4L4, EU435135, NM_001114871















>CYP4L8 Clone A4 Spodoptera littoralis AM086017





>CYP4L9v1 Spodoptera litura (common cutworm) DQ350814

SA3: 97% to 4L9v2, 3 aa diffs,  87% to 4L4, 91% to 4L7, 88% to 4L8



>CYP4L9v2 Spodoptera litura (common cutworm) DQ352133

RAG1: 97% to 4L9v1, 3 aa diffs,  87% to 4L4 89% to 4L7 86% to 4L8



>CYP4L10 Spodoptera litura (common cutworm) DQ352134

RT5: 98% to 4L8 2 aa diffs, 78% to 4L4 possible ortholog of 4L8



>CYP4L11 Helicoverpa armigera AY588581.1 (2 aa diffs to CYP4L11 Ha-92N13-B)






>CYP4L17 Zygaena filipendulae (zygaenid moth, Lepidoptera) GQ915317

Zygae_P450-12 49% to CYP4L4, 48% to CYP4L7, probable ortholog of other CYP4Ls in moths



>CYP4L18 Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder FN356973.1



>CYP4M1 Manduca sexta Contig_457_FL (sent to Genbank)

3 aa diffs to partial seq CYP4M1 (L38670), probably the same gene











>CYP4M1 Manduca sexta (tobacco hornworm) L38670 (397bp)





>CYP4M2 Manduca sexta Contig_1737_known_Msexta_3'-truncated

(sent to genbank)

100% to CYP4M2 (L38671), includes the N-term (join)


only 1 aa diff to CYP4M2, X residues replaced by 4M2 seq











>CYP4M4 Helicoverpa armigera U86005





>CYP4M4v2 Helicoverpa armigera





>4M5 Bombyx mori (silkworm) Kyoko Kikuchi









>CYP4M6 x32 (501 aa) Helicoverpa zea (corn earworm) AY113687.1










>CYP4M6v1 Helicoverpa armigera AY588583 1 aa diff





>CYP4M6 Helicoverpa armigera AY588580






>CYP4M7 x39 (502 aa) Helicoverpa zea (corn earworm) AY113688










>CYP4M9 Bombyx mori (silkworm) BAAB01103156.1 BAAB01142776.1 BAAB01178932.1 57% to 4M5










>CYP4M10v1 Helicoverpa armigera Ha-33M07-C 99% 1 aa diff to CYP4M10 HaCypZ020a-v1Pep









>CYP4M12v1 Spodoptera littoralis (cotton leafworm) AM086015





>CYP4M12v2 Spodoptera littoralis (cotton leafworm) AM086016





>CYP4M13v1 Spodoptera litura DQ352135.1 RT4: 83% to 4M6, 98% or 2 aa diffs to CYP4M12v1 possible ortholog



>CYP4M13v2 Spodoptera litura DQ352136.1 SC4: 97% to 4M13v1, possible allele, 96% to 4M12v1, 81% to 4M6



>CYP4M14v1 Spodoptera litura DQ352137.2 R35: 79% to 4M6



>CYP4M14v2 Spodoptera litura DQ352138.1 SB2: 99% (1 aa diff) to CYP4M14v1, 78% to 4M6, 89% to CYP4M15



>CYP4M15 Spodoptera litura DQ352139.1 R31: 89% to 4M14v2, 81% to 4M6



>CYP4M16 Spodoptera litura DQ355382.1 SD1: 65% to CYP4M14v1, 63% to 4M7



>CYP4M19 Plutella xylostella (L.) (diamondback moth) EU189047.1, ABW34434

5 aa diffs to 4M11 this might be a CYP4M11 allele





>CYP4M20     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189048.1, GenPept ABW34435

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            75% to 4M15 Spodoptera litura





>CYP4M21     Plutella xylostella (L.) (diamondback moth) EU189049.1, ABW34436





>CYP4M22     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189050.1, GenPept ABW34437

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            65% to 4M19, 65% to 4M5





>CYP4M23     Plutella xylostella (L.) (diamondback moth, Lepidoptera)

            GenEMBL EU189051.1, GenPept ABW34438

            Jihyeong Baek

            submitted to nomenclature committee Dec. 3, 2007

            62% to 4M6 Helicoverpa zea





>CYP4M24     Ostrinia furnacalis (Asian corn borer) EU807990.2











>CYP4M25    Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder




>Cyp4p1 D. melanogaster AC018129 comp(67703-69662)













>Cyp4p1 D. pseudoobscura ortholog 72% to 4P1












>Cyp4p2 D. melanogaster AC018129 comp(70087-72192) revised 9/11/2000












>CYP4P2 D. pseudoobscura ORTHOLOG 78% to 4p2












>Cyp4p3 D. melanogaster AC018129 comp(65426-67385) revised 9/11/2000












>CYP4P3 D. pseudoobscura 66% to 4p3












>Cyp4p pseudogene D. pseudoobscura This fragment most like CYP4P exon 1



>CYP4Q1 Tribolium castaneum










>CYP4Q1 Tribolium castaneum (red flour beetle)





>CYP4Q1   Tribolium 3 aa diffs





>CYP4Q2 Tribolium castaneum










>CYP4Q2     Tribolium castaneum (red flour beetle)





>CYP4Q2 Tribolium 3 aa diffs at end





>CYP4Q3 Tribolium castaneum










>CYP4Q3 Tribolium 1 aa diff





>CYP4Q4 Tribolium castaneum










>CYP4Q4 Tribolium 1 aa diff





>CYP4Q5 Tribolium castaneum










>CYP4Q5 Tribolium





>CYP4Q6 Tribolium castaneum










>CYP4Q6 Tribolium 5 aa diffs





>CYP4Q7v1 Tribolium castaneum










>CYP4Q7v2 Tribolium castaneum










>CYP4Q7     Tribolium castaneum (red flour beetle)





>CYP4Q7v1 Tribolium castaneum 2 aa diffs old CYP4R1





>CYP4Q8 Tribolium castaneum











>CYP4Q8 Tribolium castaneum old CYPR22





>CYP4Q9P Tribolium castaneum














>CYP4Q9P Tribolium castaneum 1 aa diff at end old CYPS25





>CYP4Q10 P4Q53c63 Leptinotarsa decemlineata (Colorado potato beetle) DQ631651

49% to 4C3, 51% to 4C25, 66% to CYP4Q3 = XP_971112, 67% to P4G758106



>CYP4Q11 P4G758106 Leptinotarsa decemlineata (Colorado potato beetle) DQ631652

53% to 4J9, 52% to 4C3, 68% to CYP4Q8 = XP_970987



>CYP4S1 Helicoverpa armigera (Australian cotton bollworm) U86001.1





>CYP4S2 Helicoverpa armigera (Australian cotton bollworm) U86000





>Cyp4s3 D. melanogaster AC018488 comp(98620-101060) also AC015418 AC018487













>Cyp4s3 D. pseudoobscura ortholog












>CYP4S4 MbraB1 antennae of the moth Mamestra brassicae AY063500

Martine Maibeche 86% to 4S1












>CYP4S5 Bombyx mori 66% to CYP4S4 from the moth Mamestra brassicae













>CYP4S6 Bombyx mori 94% to CYP4S5 missing C-term.







2314 MDEVNTFMFE 2343 ()





>CYP4S8v1 Spodoptera littoralis (cotton leafworm) Clone A2 AM086018.1




>CYP4S8v2 Spodoptera littoralis (cotton leafworm) Clone A6 AM086019.1





>CYP4S8v3 Spodoptera littoralis (cotton leafworm) Clone A9 AM086020.1





>CYP4S8v4 Spodoptera litura (common cutworm) DQ355381.1

SB1: 84% to 4S2, identical to 4S8v1 except for a short

frameshifted region.

The CYP4S8v1 sequence is probably wrong in this region.



>CYP4S9v1  Spodoptera litura (common cutworm) DQ355383.2

RTH17: 78% to 4S4, 97% to 4S9v2



>CYP4S9v2 Spodoptera litura (common cutworm) DQ355384.1

SA4: 78% to 4S4, 97% to 4S9v1



>CYP4S10 Plutella xylostella (L.) (diamondback moth) 1 aa diff to CYP4S10v2





>CYP4S10v2 Plutella xylostella EU189052





>CYP4S11 Spodoptera exigua EF113592





>CYP4S13 HAH006401 67% TO CYP4S5, 45% to CYP4M15, 45% to CYP4J9

EF591060 (3 aa diffs)



>CYP4S13 Helicoverpa armigera EF591060 (3 aa diffs to HAH006401)











>CYP4U1 Coptotermes acinaciformis (termite) AF046010











>CYP4U2 Coptotermes acinaciformis (termite) GenEMBL AF046011





>CYP4U3 Reticulitermes flavipes RfP4501V1 DQ279461

99% to CYP4U3v1 (only 1 aa diff)

98% to 4U3v2 (only 2 aa diffs)

52% to CYP4U1 Coptotermes acinaciformis (termite),

69% to CYP4U2 partial seq

47% to CYP4BN6 Tribolium



>CYP4U3v1   Reticulitermes flavipes (termite) #1V1



>CYP4U3v2   Reticulitermes flavipes (termite) #1V2 DQ279462



>CYP4U4P Reticulitermes flavipes pseudogene DQ279472





>Cyp4aa1 D. melanogaster AC020355 comp(15477-16779) AC007579 comp(38212-38842)












>Cyp4aa1 D. pseudoobscura 79%













>CYPi2r2 = CYP4AA1 Anopheles gambiae, 512aa 55% to Drosophila 4AA1



>CYP4AA1-de7b8b Anopheles gambiae CYPi2r1 AAAB01008888.1

nearly identical to 4AA1







>CYP4AA1 Apis mellifera









>CYP4AA1 ortholog Nasonia vitripennis (jewel wasp)












>CYP4AA1 Tribolium castaneum















>CYP4AA1 Lutzomyia longipalpis Jacobina (phlebotomine sandfly)

            GenEMBL AM096652 AM096653 AM096654 AM096655, EW993708.1

            63% to anoph. 4AA1, 62% to Drosophila 4AA1









>CYP4AB1     Solenopsis invicta (fire ant) AY345970











>CYP4AB2     Solenopsis invicta (fire ant) AY345971












>CYP4AB3 Apis mellifera (honeybee)














>CYP4AB4 Nasonia Nv4n32 515aa 12 exons SCAFFOLD4 minus













>CYP4AB5 Nasonia Nv4n16 511aa 12 exons SCAFFOLD4 minus













>CYP4AB6 Nasonia Nv4n8 510aa 12 exons SCAFFOLD127 minus













>CYP4AB7 Nasonia Nv4n18 515aa 12 exons SCAFFOLD28 minus













>CYP4AB8 Nasonia Nv4n19 513aa 11 exons SCAFFOLD28 minus













>CYP4AB9 Nasonia Nv4n24 509aa 12 exons SCAFFOLD29 minus













>CYP4AB10 Nasonia Nv4n25 509aa 12 exons SCAFFOLD29 minus













>CYP4AB11 Nasonia Nv4n26 508aa 11 exons SCAFFOLD29 minus













>CYP4AB11-de7b8b10b11b Nasonia Nv4nP1 126aa 4 exons





>CYP4AB12 Nasonia Nv4n7 507aa 12 exons SCAFFOLD22 plus













>CYP4AB13 Nasonia Nv4n4 517aa 11 exons SCAFFOLD6 plus













>CYP4AB14 Nasonia Nv4n13 509aa 12 exons SCAFFOLD13 minus













>CYP4AB15 Nasonia Nv4n30 508aa 12 exons SCAFFOLD15 plus













>CYP4AB16 Nasonia Nv4n23 511aa 12 exons SCAFFOLD16 minus













>CYP4AB16-de1b2b Nasonia Nv4frag3 72aa 2 exons SCAFFOLD16





>CYP4AB16-de1c2c11c12c Nasonia Nv4nP2 178aa 4 exons






>CYP4AB17P Nasonia Nv4P3 506aa 12 exons SCAFFOLD16 minus














>CYP4AB18 Nasonia Nv4n21 508aa 12 exons SCAFFOLD8 plus













>CYP4AB19 Nasonia Nv4n20 501aa 12 exons SCAFFOLD2 minus














>CYP4AB20 Nasonia Nv4n15 511aa 12 exons SCAFFOLD110 plus












NNN*  48472


>CYP4AB21 Nasonia Nv4n17 509aa 12 exons SCAFFOLD18 plus













>CYP4AB22 Nasonia Nv4n1 510aa 12 exons SCAFFOLD39 minus













>CYP4AB23 Nasonia














>CYP4AB24 Solenopsis invicta (Lausanne fire ant) EE131689 EST




>CYP4AB25 Solenopsis invicta (Lausanne fire ant) EE142405 EST






>CYP4AB26 Solenopsis invicta (Lausanne fire ant) EE148664.1 EE147029.1









>CYP4AB27 Solenopsis invicta (Lausanne fire ant) EE134101 EST




>Cyp4ac1 D. melanogaster AC017771 comp(24745-26507)












>Cyp4AC1 D. pseudoobscura deletion at heme 82%












>Cyp4ac2 D. melanogaster AC017771 comp(22220-24109) revised 9/8/2000












>Cyp4ac2 D. pseudoobscura Contig3635_Contig7816.24 75% to 4ac2 74% to 4ac1













>Cyp4ac3 D. melanogaster












>Cyp4ad1 D. melanogaster AC020402 comp(36565-39829)












>Cyp4AD1 D. pseudoobscura 87%













>Cyp4ae1 D. melanogaster old 4e4 AL009194 16210-17867












>Cyp4AE1 D. pseudoobscura ortholog 71%












>CYP4AJ1 Diabrotica virgifera (western corn rootworm) a beetle AF243506





>CYP4AK1 Diabrotica virgifera (western corn rootworm) a beetle AF257100





>CYP4AR1 Anopheles gambiae CYPe2r2 494 aa AAAB01008859.1 












>CYP4AR2 Aedes aegypti 1.457_1 AAGE01044016 4I1.3 2aa diffs probable ortholog of 4AR1











>CYP4AR2 Aedes 4T1.6 59% to 4D22, 99% to 4I1.3 1 diff, 57% to 4AR1

3 aa diffs to CYP4AR2






>CYP4AR2 Aedes 4I1.3 58% to 4D22, 99% to 4T1.6 1 diff, 57% to 4AR1

2 aa diffs to CYP4AR2





>CPIJ014579 CYP4AR3 Culex pipiens 100% to CYP4AR3 Culex_quinquefasciatus

100% to 4H23v2 Culex pipiens partial seq

1 aa diff to 4H23v3 Culex pipiens partial seq









>CYP4AR3 Culex_quinquefasciatus_11

70% to CYP4AR2 Aedes, 45% to 4AR1 Anoph.











>CPIJ009469 CYP4AR4 Culex pipiens 52% to CYP4AR1, 46% to CYP4AR2, 48% to CYP4AR3









>CYP4AU2 Bombyx mori seq gap before I-helix includes a small exon














>CYP4AU3 Heliconius erato (red postman or red passion flower butterfly)

         GenEMBL EST EL596754.1






>CYP4AU4 Heliothis virescens GR960305.1






>CYP4AV1 Apis mellifera












>CYP4AV5 Nasonia Nv4n9 513aa 5 exons SCAFFOLD4 plus (5121737-












>CYP4AW1 Phyllopertha diversa (scarab beetle) AY605086.1

            Maibeche-Coisne,M., Nikonov,A.A., Ishida,Y., Jacquin-Joly,E. and


            Pheromone anosmia in a scarab beetle induced by in vivo inhibition

            Proc. Natl. Acad. Sci. U.S.A. 101 (31), 11459-11464 (2004)



>CYP4AW2 Phyllopertha diversa (scarab beetle) AY605087.1

            Maibeche-Coisne,M., Nikonov,A.A., Ishida,Y., Jacquin-Joly,E. and


            Pheromone anosmia in a scarab beetle induced by in vivo inhibition

            Proc. Natl. Acad. Sci. U.S.A. 101 (31), 11459-11464 (2004)



>CYP4AX1 Bombyx mori 50% to CYP4S4 53% to CYP4Sxx lower case is from CYP4AX2



vvlshsknitknviydflkpwlgtglllst ()









>CYP4AX2 Bombyx mori 94% identical to CYP4qq lower case is from CYP4AX1

CYP4rr 94% identical to CYP4qq lower case is from CYP4qq







ghdttgtaltfslmllsdheeaq ()





>Cyp4AY1 Ips paraconfusus (bark beetle) IparaP450A3 D. Huber

revised, full length DQ471874.1











>CYP4AY2 IparaCyp4A4, full length (Ips paraconfusus) 56% to 4AY1rev












>CYP4BD1 IparaCyp4A27, full length (Ips paraconfusus) DQ471876











>CYP4BE1 IparaCyp4A20, full length (Ips paraconfusus),missing about 88 aa at N-term DQ471877.1










>CYP4BE2 IparaCyp4cod6, (Ips paraconfusus), most of gene, seeming missing small part of 5' end, a few ambiguities 65% to 4BE1, DQ471878.1










>CYP4BF1 IparaCyp4A25, full length (Ips paraconfusus) 50% to 4BE1,












>CYP4BG1 IparaCyp4cod43, full length (Ips paraconfusus) 43% to 4J9












>CYP4BH1 IparaCyp4A6, full length (Ips paraconfusus) 43% to 4AW1












>CYP4BJ1 IparaCyp4A1 (Ips paraconfusus) missing C-term DQ471882












>CYP4BM1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966563

           poor match 42% to 4C3










>CYP4BN1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971854

           66% to 4BN4, 48% to 4AW1, 48% to 4BH1










>CYP4BN2    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971905

           72% to 4BN5












>CYP4BN3    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966858, XP_975914

           56% to 4BN1











>CYP4BN4    Tribolium castaneum (red flour beetle)

           GenEMBL XP_971963

           66% to 4BN1, 52% to 4AW1, 51% to 4BD1










>CYP4BN5    Tribolium castaneum (red flour beetle)

           GenEMBL XP_967939

           72% to 4BN2










>CYP4BN6    Tribolium castaneum (red flour beetle)

           GenEMBL AAJJ01000217.1, DT795816 = EST

           76% to 4BN1, 46% to 4d2, 50% to 4D24,

           51% to 4AW1, 43% to 4H8




41908  IIC (1) 41916









>CYP4BN7     Tribolium castaneum (red flour beetle)

            GenEMBL XP_972577

            66% to CYP4BN8









>CYP4BN8     Tribolium castaneum (red flour beetle)

            GenEMBL XP_972624, AAJJ01005264.1

            66% to CYP4BN7, 55% to 4BN4










>CYP4BN9     Tribolium castaneum (red flour beetle)

            GenEMBL XP_971513, AAJJ01000614.1 also has 4BN10

            66% to CYP4BN10












>CYP4BN10    Tribolium castaneum (red flour beetle)

            GenEMBL XP_971570

            66% to CYP4BN9










>CYP4BN11    Tribolium castaneum (red flour beetle)

            GenEMBL AAJJ01000275

            53% to CYP4BN4, 49% to CYP4BN6




74068 CALDIIC (1) 74088



74457 VDTFMFA (0) 74477






>CYP4BN12v1 P4D262110 Leptinotarsa decemlineata (Colorado potato beetle)

71% to 4E2 (short match), 64% to 4D2, 96% to P4PD1553, 2 aa diffs




>CYP4BN12v2 P4PD1553 Leptinotarsa decemlineata (Colorado potato beetle)

68% to 4E2 short match, 61% to 4D2, 69% to 4BN1, 67% to P4PD25180




>CYP4BN13v1 Leptinotarsa decemlineata (Colorado potato beetle)

P4PD25180 like 57% to 4D2, 71% to 4BN3




>CYP4BN13v2 P4PD24810 like Leptinotarsa decemlineata (Colorado potato beetle)

54% to 4D2, 95% to P4PD25180 (3 aa diffs), 68% to 4BN3




>CYP4BN13v3 P4PD29346 Leptinotarsa decemlineata (Colorado potato beetle)

56% to 4D2, 95% to P4PD25180 (3 aa diffs), 71% to 4BN3




>CYP4BN13v4 P4PD61109 Leptinotarsa decemlineata (Colorado potato beetle)

52% to 4D2, 96% to P4PD25180, 69% to 4BN3 same aa seq as P4PD29346, different nucleotide seq DQ631649.1



>CYP4BN14v1 P4D215Ic4 Leptinotarsa decemlineata (Colorado potato beetle)

63% to 4D2, 64% to 4BN1 98% to P4PD273ic4, 1 aa diff




>CYP4BN14v2 P4PD273ic4 Leptinotarsa decemlineata (Colorado potato beetle)

73_IC4C8_M13R_A10 61% to 4D2, 62% to 4BN1




>CYP4BQ1 Dendroctonus ponderosae

EZ115352.1 with frameshift, missing C-term










>CYP4BR1    Tribolium castaneum (red flour beetle)

           GenEMBL XP_966411, XP_975718 (missing an exon)

           AAJJ01002884.1 formerly CYP4BP1 (name conflict) and CYP4H10 wrong subfamily

           53% to 4BR3, 45% to 4H11, 43% to 4D23,








HGN 8527


>CYP4BR2P   Tribolium castaneum (red flour beetle)

           GenEMBL AAJJ01002884 pseudogene between 4BR1 and 4BR3









>CYP4BR3    Tribolium castaneum (red flour beetle)

           GenEMBL XP_967724

           53% to CYP4BR1










>CYP4BS1 Pediculus humanus Ph4-2 495aa 8 exons XM_002428194.1

1103172107803 plus (315168-315315,315409-315515,315601-315880,315951-316020,316094-316394,316454-316694,316899-317078,317171-317328) similar to  Ag4C25,  upstream from Ph4-3, 49% to 4C1 cockroach

79% to Ph4-3



>CYP4BS2 Pediculus humanus Ph4-3 496aa 8 exons 1103172107803 plus (318223-318376,318459-318565,318652-318931,318994-319063,319148-319448,319508-319748,319817-319996,320076-320230) similar to  Ag4C25,  downstream from Ph4-2, upstream from Ph4-4, can't find M on N-term

48% to CYP4C1 cockroach, 79% to Ph4-2



>CYP4BS3 Pediculus humanus Ph4-4i 497aa 8 exons 1103172107803 plus (321341-321497,321583-321689,321767-322046,322216-322285,322382-322682,322742-322982,323053-323232,323304-323458) similar to  Ag4C25,  downstream from Ph4-3, can't find N-term exon

48% to CYP4C1 cockroach, 71% to Ph4-2



>CYP4BT1 Pediculus humanus Ph4-5 508aa 10 exons 1103172108237 plus (85774-85963,86049-86246,87180-87365,87458-87527,87754-87944,88098-88201,88321-88389,88481-88646,88738-88911,89005-89180) similar to  Ag4C25,  not happy with N-term of exon 6, should more be included here? 42% to 4C3



>CYP4BU1 Pediculus humanus Ph4-6 509aa 8 exons 1103172108222 plus (495610-495778,495870-495976,496053-496338,496420-496619,496695-496874,496954-497191,497289-497468,497555-497721) similar to  Dm4C3,  upstream from Ph4-7, GC donor on intron 4 42% to 4C1 cockroach, 52% to Ph4-7



>CYP4BU2 Pediculus humanus Ph4-7 503aa 8 exons 1103172108222 plus (499765-499939,500016-500122,500217-500493,500571-500770,500844-501017,501125-501362,501448-501627,501722-501879) similar to  Dm4C3,  downstream from Ph4-6 38% to 4C1, 39% to 4AZ1 Am, 52% to Ph4-6



>CYP4BV1 Pediculus humanus Ph4-8 504aa 9 exons 1103172107373 minus (53344-53188,53085-52979,52896-52806,52731-52543,52459-52390,52311-52103,52029-51923,51851-51783,51703-51191) similar to  Ag4D22, 41% to 4C3 Dm



>CYP4BZ2 Nasonia Nv4n10i 439aa 9 exons SCAFFOLD11 plus


(1) 4350












>CYP4CA1 Nasonia Nv4n11 493aa 12 exons SCAFFOLD13 plus














>CYP4CB1    Liposcelis bostrychophila (psocid)


           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           36% to CYP4C3 Droso., 37% to CYP4C37, 38% TO 4C61, 37% TO 4C62

           40% TO EU979551, 41% TO EU979549, 37% TO 4BM1 Tribolium



>CYP4CC1    Liposcelis bostrychophila (psocid)


           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           39% to CYP4D22, 43% to CYP4D2, 40% TO 4C62, 39% TO CYP4C61

           44% TO CYP4CD1, 41% TO CYP4CB1, 41% TO CYP4BN1 TRIBOLIUM



>CYP4CD1    Liposcelis bostrychophila (psocid)


           Jiang Hongbo

           Submitted to nomenclature committee Feb. 20, 2009

           47% TO CYP4BN6 TRIBOLIUM,

           42% to 4D17, 43% to 4D2, 41% to CYP4C62, 39% to 4C61

           44% TO CYP4CC1, 40% TO CYP4CB1



>CYP4CE1    Nilaparvata lugens (Homoptera: Delphacidae) FN356974.2



>CYP4CG1 Contig_1538_FL Manduca sexta (tobacco hornworm)

sent to genbank

1 aa diff to partial seq CYP4CG1 (L38672), renamed CYP4CF1, 48% TO CYP4M7











>CYP4CG1 formerly CYP4M3 Manduca sexta (tobacco hornworm) L38672





>CYP4CH1 Acyrthosiphon pisum LOC100167623p SCAFFOLD15279:22883..50385











>CYP4CH2 Acyrthosiphon pisum LOC100167777p SCAFFOLD9588:3006..11080









>CYP4CH3 Acyrthosiphon pisum LOC100163721 SCAFFOLD9588:25696..30352 (+ strand)











>CYP4CJ1 Acyrthosiphon pisum SCAFFOLD7010:99236..111631









>CYP4CJ2 Acyrthosiphon pisum SCAFFOLD7010:120446..129462









>CYP4CJ3 Acyrthosiphon pisum SCAFFOLD7010:131616..139794









>CYP4CJ4 Acyrthosiphon pisum LOC100160629 SCAFFOLD7010:141476..155172









>CYP4CJ5 Acyrthosiphon pisum AUG5s3079g1t1 ?SCAFFOLD3079:13926..21110








>CYP4CK1 Acyrthosiphon pisum SCAFFOLD15733:160611..183325









>CYP6A1      Musca domestica (house fly) L27241











>Cyp6a2 D. melanogaster AC007549 comp(100072-101661)











>Cyp6a2 D. pseudoobscura orth











>CYP6A3 housefly U09231











>CYP6A4 housefly U09232











>CYP6A5 housefly U09343











>CYP6A6 housefly U09344





>CYP6A7 housefly AF240400








>Cyp6a8 D. melanogaster AC020447 comp(122688-124264)











>Cyp6a8 D. pseudoobscura ortholog











>Cyp6a9 D. melanogaster AC020447 comp(115043-116610)











>CYP6A10 Ceratitis capitata (Mediterranean fruit fly) U78795











>CYP6A11 Ceratitis capitata (Mediterranean fruit fly) AF028002



>CYP6A12 Ceratitis capitata (Mediterranean fruit fly) AF028003



>Cyp6a13 D. melanogaster AC020451 3757-5238 AC007085 126189-124714 no introns











>CYP6A13 D. pseudoobscura ortholog 77% to 6A13 no introns












>Cyp6a14 D. melanogaster AC007085 33266-34850 frameshift at amino acid 73













>CYP6A14 D. pseudoobscura ortholog no frameshift as in D. melanogaster













>Cyp6a15p D. melanogaster pseudogene on AC020451 2595-3373








>Cyp6a16 D. melanogaster AC004721 comp(2956-5070) note 1 extra intron














>CYP6A16 D. pseudoobscura ortholog Contig4092_Contig573.216 61% to 6A1












>Cyp6a17 D. melanogaster AC020447 109264-110826











>Cyp6A17 D. pseudoobscura Ortholog of D. pseudoobscura











>Cyp6a18 D. melanogaster AC008285 85740-87319











>Cyp6A18 D. pseudoobscura ortholog D. pseudoobscura ortholog












>Cyp6a19 D. melanogaster AC020447 113084-114646











>Cyp6a20 D. pseudoobscura Probable ortholog 71% to 6A20 65% to 6A19.?













>Cyp6a20 D. melanogaster AC020447 117416-119045












>Cyp6a21 D. melanogaster AC020447 comp(120585-122149)












>Cyp6a21 D. pseudoobscura Contig3531_Contig5436.185 78% TO 6A21














>Cyp6a22 D. melanogaster AC020447 106987-108653











>CYP6A22 D. pseudoobscura ortholog Contig3531_Contig5436.181 82% to 6A22












>Cyp6a23 D. melanogaster AC020447 111145-112718











>CYP6A23 D. pseudoobscura ortholog Contig3531_Contig5436.183 76% to 6A23















>CYP6A24 housefly AB050019











>CYP6A25 housefly AF240401








>CYP6A26 Drosophila simulans AY489265











>CYP6A27 Lucilia cuprina (Australian blowfly) DQ917666.1

Lc_CYP6A8 revised June 27, 2005 61% to 6A9 64% to 6A32



>CYP6A28 Lucilia cuprina (Australian blowfly) DQ917667.1

Lc_CYP6A2 revised June 27, 2005 52% to 6A9 63% to 6A1 and 6A24



>CYP6A36 Musca domestica (house fly) DQ642009.1











>CYP6A37 Musca domestica (house fly) DQ642010.1











>CYP6A38v1 Musca domestica Nannan Liu 7/20/06 EF615003.1




>CYP6A40 Musca Domestica insecticide-susceptible strain TJS


top 19 BLAST hits are all CYP6A sequences

52% to Cyp6a9 D. melanogaster

47% to CYP6A1 Musca domestica

47% to Cyp6a2 D. melanogaster

43% to CYP6A3 Musca domestica

44% to CYP6A4 Musca domestica

44% to CYP6A5 Musca domestica

46% to CYP6A6 Musca domestica (partial seq)

49% to CYP6A7 Musca domestica (partial seq)

45% to CYP6A24 Musca domestica

50% to CYP6A25 Musca domestica (partial seq)

49% to CYP6A36 Musca domestica

51% to CYP6A37 Musca domestica

45% to CYP6A38v1 Musca domestica

45% to CYP6A39 Musca domestica











>CYP6B1 S48952











>CYP6B1v3 Papilio polyxenes (black swallowtail butterfly) U05037











>CYP6B2 Helicoverpa armigera cytochrome P-450 (CYP6B2) mRNA, complete cds.

ACCESSION   U18085, note 20 aa diffs to CYP6B2v1 (18 in the N-term)

Note CYP6B27 N-term matches this seq (possible hybrid seq)











>CYP6B2 Helicoverpa armigera DQ780605

4 aa diffs to U18085, 5 aa diffs to CYP6B2v1





>CYP6B3 Papilio polyxenes (black swallowtail butterfly) U25819











>CYP6B3v2 Papilio polyxenes (black swallowtail butterfly) U65488











>CYP6B4 Papilio glaucus (butterfly) U47059 (1619bp)











>CYP6B4v2 Papilio glaucus (butterfly) U65489











>CYP6B5v1 Papilio glaucus (butterfly) U65490











>CYP6B6v1 Helicoverpa armigera  U64800

3 aa diffs to Ha-12E11-D











>CYP6B6v2 Contig_187 99% to 6B6 U64800 4 aa diffs









>CYP6B7 Helicoverpa armigera AF031468











>CYP6B8v1 Helicoverpa zea AF102263











>CYP6B8v2 Helicoverpa zea AF285828











>CYP6B8v3 Helicoverpa zea AF285829











>CYP6B8v4 Helicoverpa zea AF285830











>CYP6B8v5 = old CYP6B28 AF285186 Helicoverpa zea











>CYP6B8v6 Helicoverpa armigera Contig_208 99% to 6B8v1 (2 aa diffs)

100% identical to Ha-12E11-A









>CYP6B9 Helicoverpa zea AF140278











>CYP6B10 AF140279 Heliothis virescens











>CYP6B11 AF280614 Papilio canadensis cytochrome











>CYP6B12 AF280615 Papilio glaucus











>CYP6B13 AF280616 Papilio canadensis











>CYP6B14 AF280612 Papilio canadensis











>CYP6B15 AF280613 Papilio canadensis











>CYP6B16 AF280617 Papilio glaucus











>CYP6B17 AF280618 Papilio glaucus











>CYP6B18 AF280619 Papilio canadensis











>CYP6B19 AF280620 Papilio canadensis




>CYP6B20 AF280621 Papilio glaucus











>CYP6B21 AF280622 Papilio glaucus











>CYP6B22 AF280623 Papilio canadensis










>CYP6B23 AF278602 Papilio glaucus SF-X9











>CYP6B24 AF278601 Papilio glaucus SF-X43











>CYP6B25 AF278603 Papilio canadensis CAN-X21











>CYP6B26 AF278604 Papilio canadensis CAN-X22











>CYP6B27 AF285831 Helicoverpa zea 6B27 (CYP6B27)

5 diffs to Ha-12E11-B











>CYP6B27 Helicoverpa armigera Ha-12E11-B

5 aa diffs to AF285831 Helicoverpa zea (ortholog)

2 aa diffs to DQ458470.1 (22332-24108) called CYP6B6 in Genbank entry









>CYP6B29 Bombyx mori (silkworm)











>CYP6B29 Bombyx mandarina (wild silkworm) DQ252325











>CYP6B31v2 Spodoptera exigua (beet armyworm) FJ524855 (5 aa diffs to CYP6B31v1)











>CYP6B45 Manduca sexta Contig_359_FL (sent to genbank)

72% to Contig_1239_FL, 64% to CYP6B29











>CYP6B46 Manduca sexta Contig_1239_FL (sent to genbank)

72% to CYP6B45 Contig_359_FL,

60% to CYP6B2v1 HaCypZ017a-v1Pep Helicoverpa armigera











>CYP6B47 Spodoptera Litura (first 6B seq) 72% to CYP6B2v1 Helicoverpa armigera.

84% to CYP6B39, GQ465039









>CYP6B48 Spodoptera Litura (second 6B seq) 72% to CYP6B2v1 Helicoverpa

94% to CYP6B47 Spodoptera Litura (first 6B seq), 85% to CYP6B39










>CYP6C1 U09233











>CYP6C2 Musca domestica (housefly) U09345











>CYP6D1v1 Musca domestica (housefly) strain LPR U15168 pyrethroid-resistant












>CYP6D1v2 Musca domestica (housefly) strain CS pyrethroid-susceptible SwissProt Q27698











>CYP6D1v3 Musca domestica strain aabys pyrethroid-susceptible (housefly) AF064795












>CYP6D1v4 Musca domestica (housefly) strain ISK pyrethroid-susceptible












>CYP6D1v5 Musca domestica (housefly) strain OCR pyrethroid-susceptible












>CYP6d2 Drosophila melanogaster AC020206 comp(66328-68065) also AC008350











>Cyp6d2 D. pseudoobscura ortholog 80%












>CYP6D3v1 Musca domestica AF200191












>CYP6D3v2 Musca domestica AF283257












>CYP6d4 D. melanogaster AC017250 37993-39657 also AC008197 AC009846











>Cyp6d4 D. pseudoobscura ortholog











>Cyp6d5 D. melanogaster AC018176 comp(132649-134791)











>CYP6D5 D. pseudoobscura ortholog Contig7891_Contig7492A.fa.196 75% to 6D5
















>CYP6D8 Musca Domestica insecticide-susceptible strain TJS FJ911557

56% to Cyp6d5 D. melanogaster











>CYP6E1 Culex pipiens CPIJ017462

97% to CYP6E1 Culex pipiens quinquefasciatus AB001323











>CYP6E1 AB001323 Culex pipiens quinquefasciatus











>CYP6F1 AB001324 Culex pipiens quinquefasciatus Say (mosquito) Culex-2











>CPIJ010858 CYP6F1 Culex pipiens

100% to CYP6F1 Culex pipiens quinquefasciatus AB001324











>CYP6F2 1.1219_1 Aedes aegypti (yellow fever mosquito) CYP6AL2 AAGE01012031 CYP6AL2v1 6T1.2










>CYP6F3 1.1219_2 Aedes aegypti (yellow fever mosquito) AAGE01073711









>CPIJ015223 CYP6F4 Culex pipiens 75% to CYP6F1











>CPIJ008972 CYP6F5P Culex pipiens pseudogene

52% to CYP6F1, & = frameshift













>CPIJ020082 CYP6F6 Culex pipiens

has full length cDNA been determined for this gene?

95% to CPIJ015223 CYP6F4 N-term is in a seq gap






>CYP6g1 AC015208 comp(21239-22935) also AC007440











>Cyp6g2 D. melanogaster AC015208 19014-20624












>CYP6g2 D. pseudoobscura sequence











>CYP6G3 Lucilia cuprina (Australian blowfly) DQ917668.1

Lc_CYP6G revised June 27, 2005 60% to 6G1



>CYP6G4 Musca Domestica insecticide-susceptible strain TJS FJ911556.1

60% to Cyp6g1 D. melanogaster

sequence # 2











>CYP6H1      Locusta migratoria migratorioides AF115777












>CYP6J1   AF281325   Blattella germanica (German cockroach) Jeff Scott 1/20/99











>CYP6K1 AF281328 Blatella germanica (German cockroach) Jeff Scott 3/9/99

originally called CYP6M1












>CYP6L1 Blatella germanica (German cockroach) AF227531











>CYP6M1 Anopheles gambiae CYPm3r7 =, 503aa AAAB01008964.1



>CYP6M1v2 Anopheles gambiae CYPm3r7 503aa AAAB01008119.1 8 aa diffs with CYP6M1v1











>CYP6M1 Anopheles funestus AAY85600




>CYP6M2 Anopheles gambiae CYPm3r9 499aa AAAB01008964.1




>CYP6M3 Anopheles gambiae CYPm3r10 500aa AAAB01008964.1




>CYP6M4 Anopheles gambiae CYPm3r11 501aa AAAB01008964.1




>CYP6M5 Aedes aegypti (mosquito) 1.371_12 CYP6M5 CYP6M5v2 6I1.1









>CYP6M5v1 Aedes aegypti (mosquito) 6I1.4 67% to CYP6M2,

66% to CYP6M1, 97% to 6I1.1






>CYP6M5v2 Aedes aegypti (mosquito) 6I1.1 66% to CYP6M2, 97% to 6I1.4






>CYP6M6 Aedes aegypti (mosquito) 1.371_11 CYP6M6 AAGE01004894 CYP6M6 6T1-1










>CYP6M6 Aedes aegypti (mosquito) 6T1-1 72% to CYP6M3,

70% to CYP6M2, 77% to 6I1.4, 75% to 6I1.1






>CYP6M7 Anopheles funestus GenPept AAV68095





>CYP6M8 Anopheles funestus GenPept AAV68096





>CYP6M9 Aedes aegypti (mosquito) 1.371_13 AAGE01032555 CYP6M5v2 6I1.1









>CYP6M10 Aedes aegypti (mosquito) 1.371_14 AY433475 AAGE01031181









>CYP6M11 Aedes aegypti (mosquito) 1.371_15 AAGE01105997



>CYP6M12 Culex_quinquefasciatus_06 83% to CYP6M6 Aedes



>CPIJ016849 CYP6M12 Culex pipiens 99% to CYP6M12 Culex_quinquefasciatus

& = frameshift











>CPIJ016846 CYP6M13 Culex pipiens 72% to CYP6M11











>CPIJ016848 CYP6M14 Culex pipiens 74% to CYP6M11











>CPIJ019700 CYP6M15 Culex pipiens 73% to CYP6M11











>CPIJ019702 CYP6M16 Culex pipiens











>CYP6N1 Anopheles gambiae 52% to 6Q1 Hilary Ranson 8/9/99  CLONE NAME 12D2










>CYP6N1v1 Anopheles gambiae CYPm3r8 501 aa AAAB01008964.1 allele of CYP6N1v2





>CYP6N1v2 Anopheles gambiae CYPm3r8 501 aa AAAB01008119.1 allele of CYP6N1v1




>CYP6N2 Anopheles gambiae CYPm3r4 =, 501aa 2 aa diffs with CYP6N2 04IgeneA of Hilary Ranson



>CYP6N2 Anopheles funestus AY987357





>CYP6N3v1 Aedes albopictus AF283836











>CYP6N3v2 Aedes albopictus AF283837











>CYP6N3v3 Aedes albopictus AF283838











>CYP6N3v4 Aedes albopictus AF284783







>CYP6N4v1 Aedes albopictus AF284782










>CYP6N4v2 Aedes albopictus AF284784






>CYP6N4v3 Aedes albopictus AF284785






>CYP6N4v4 Aedes albopictus AF284786






>CYP6N4v5 Aedes albopictus AF284787






>CYP6N4v6 Aedes albopictus AF284788






>CYP6N5 Aedes aegypti CYPm3r8 =, 501 aa not same gene as 6N1 h.r. (only 82%)



>CYP6N6 Aedes aegypti 1.371_4 AAGE01504815 88% to CYP6N3v1 Aedes albopictus CYP6N6v1 6T1.4












>CYP6N6v1 Aedes aegypti 6T1.4 62% to CYP6N2, 97% to 6I2.2






>CYP6N6v2 Aedes aegypti 6I2.2 61% to CYP6N2, 97% to 6T1.4






>CYP6N7 Ochlerotatus sollicitans DQ427077




>CYP6N8 Ochlerotatus sollicitans DQ427073




>CYP6N9 Aedes aegypti 1.371_1 AAGE01173027



>CYP6N10P Aedes aegypti 1.371_2p AAGE01078584 pseudogene 100%





>CYP6N11 Aedes aegypti 1.371_3 AAGE01020246 Charle?s version 100%











>CYP6N12 Aedes aegypti 1.371_5 AAGE01273771? 100% to CYP6Nae2, 85% to CYP6N3v1 Aedes albopictus












>CYP6N13 Aedes aegypti 1.371_7 476419050 52% to CYP6N3, 63% to 6N2











>CYP6N14 Aedes aegypti 1.371_8 AAGE01021887











>CYP6N15 Aedes aegypti 1.371_9 AAGE01004071? 100% to CYP6Nae4











>CYP6N16 Aedes aegypti 1.457_3 AAGE01005098 100% to CYP6Nae3









>CYP6N17 Aedes aegypti 1.457_2 AAGE02018066.1 60% to 6N2












>CYP6N18 Culex_quinquefasciatus_33

100% idenctical to v1 at the amino acid level (are these different sequences?)

75% to 6N16 Aedes, 74% to 6N2 Anoph.











>CPIJ016856 CYP6N18 Culex pipiens 100% to CYP6N18 Culex_quinquefasciatus











>CYP6N19 Culex_quinquefasciatus_31

68% to 6N11 Aedes, 57% to 6N1v2 Anoph.











>CPIJ016852 CYP6N19 Culex pipiens 100% to CYP6N19 Culex_quinquefasciatus











>CYP6N20 Culex_quinquefasciatus_28

55% to 6N1v2 Anoph., 67% to 6N9 Aedes











>CPIJ016855 CYP6N20v1 Culex pipiens 99% to CYP6N20 Culex_quinquefasciatus 1 aa diff











>CPIJ020199 CYP6N20v2 Culex pipiens yellow part not a P450





98% to CYP6N20







>CPIJ016853 CYP6N21P Culex pipiens

(missing approx 14 aa in middle) probable pseudo

CYP6N 58% to CYP6N11 & = frameshift and deletion











>CPIJ016854 CYP6N22 Culex pipiens 60% to CYP6N9









>CPIJ005900 CYP6N23 Culex pipiens 65% to CYP6N12 added EXXR motif











>CPIJ019704 CYP6N24 Culex pipiens 68% to CYP6N11









>CYP6N25 CPIJ011129 Culex pipiens 60% to CYP6N12











>CYP6N26P CPIJ005899 Culex pipiens pseudogene 66% to CYP6N12

has duplication of part of exon 1, & = frameshift and deletion













>CPIJ019705 CYP6N27P Culex pipiens 95% to CYP6N22 end in a seq gap







>CYP6P1 Anopheles gambiae (mosquito) CYPf2r7 =, 509aa



>CYP6P1 Anopheles funestus EU852642











>CYP6P2 Anopheles gambiae (mosquito) CYPf2r8 =, 507aa



>CYP6P3 Anopheles gambiae (mosquito) CYPf2r4 =,   509 aa



>CYP6P4 Anopheles gambiae (mosquito) CYPf2r6 =, 506aa



>CYP6P5 Anopheles gambiae (mosquito) CYPf2r5 = ,509aa



>CYP6P5 Anopheles funestus EU852646












>CYP6P6 Anopheles minimus AY128947











>CYP6P7 Anopheles minimus AY426719












>CYP6P8 Anopheles minimus AY426720












>CYP6P9 Anopheles funestus EU852650










>CYP6P10v1 Ochlerotatus sollicitans AY948075











>CYP6P10v2 Ochlerotatus sollicitans AY948076











>CYP6P10v3 Ochlerotatus sollicitans AY948077











>CYP6P10v4 Ochlerotatus sollicitans AY948078











>CYP6P10v5 Ochlerotatus sollicitans AY948079











>CYP6P10v6 Ochlerotatus sollicitans AY948079




>CYP6P10v7 Ochlerotatus sollicitans DQ427078




>CYP6P10v8 Ochlerotatus sollicitans DQ427079




>CYP6P10v9 Ochlerotatus sollicitans DQ427080




>CYP6P10v10 Ochlerotatus sollicitans DQ427081




>CYP6P11 Ochlerotatus sollicitans DQ427084




>CYP6P12v1 Aedes aegypti 1.702_1 AAGE02023125.1







44758  GLRYLDNVVN (1) 44729





>CYP6P12v2 Aedes aegypti AAGE02030882.1 96% to AAGE02023125 allele?







7598  GLRYLDNVVN (1)  7593





>CYP6P13 Anopheles funestus EF152577











>CPIJ005955 CYP6P14 Culex pipiens 70% to 6P10v1 Ochlerotatus sollicitans











>CYP6R1v1 Anopheles gambiae 04IgeneB 6R1









>CYP6R1v2 Anopheles gambiae CYPm3r3 =, 499aa, 97% to CYP6R1v1



>CYP6S1v1 Anopheles gambiae 04IgeneC








>CYP6S1v2 Anopheles gambiae CYPm3r2 =, 498aa



>CYP6S2 Anopheles gambiae CYPm3r1 = , 504aa



>CYP6S3 Aedes aegypti 1.371_6 AAGE01028822 Nelson?s version 100% to CYP6Sae









>CYP6S4 Culex_quinquefasciatus_27_2 (replaced duplicate #33)



>CPIJ016857 CYP6S4 Culex pipiens, 100% to CYP6S4 Culex_quinquefasciatus 77% to CYP6S3











>CYP6t1 D. melanogaster AC012831 comp(42975-44564) no introns











>Cyp6t1 D. pseudoobscura ortholog 77%? 1 intron












>Cyp6t2p D. melanogaster AC014742 1042-2504 64% to 6t1













>Cyp6t3 D. melanogaster AC015208 comp(17123-18689)











>Cyp6t3 D.Pseudoobscura











>Cyp6u1 D. melanogaster AC017706 15959-17471 also AC008288











>Cyp6u1 D. pseudoobscura ortholog











>Cyp6v1 D. melanogaster AC011761 comp(54926-57766) also AC015002












>CYP6v1 D. pseudoobscura ortholog













>Cyp6w1 D. melanogaster AC014226 comp(15025-16689) also AC008257












>Cyp6w1 D. pseudoobscura ortholog












>CYP6X1v1 Lygus lineolaris (Heteroptera:  Miridae) Lygus bug AY054411.1

Yu Cheng Zhu 8/17/01









>CYP6X1v2 Lygus lineolaris AY054412












>CYP6X1v3 Lygus lineolaris AY125086












>CYP6Y1 Anopheles gambiae (mosquito) CYPm3r6 =, 504aa



>CYP6Y1 Anopheles funestus AY987361





>CYP6Y2 Anopheles gambiae (mosquito) CYPm3r5 = , 519aa



>CYP6Y3 Aedes aegypti (yellow fever mosquito) 1.371_10 AAGE01054542 76% to 6Y1











>CYP6Y4 Culex_quinquefasciatus_29

57% to 6Y3 Aedes, 64% to 6Y2 Anoph.











>CPIJ016850 CYP6Y4 Culex pipiens 100% to CYP6Y4 Culex_quinquefasciatus











>CPIJ016851 CYP6Y5 Culex pipiens 60% to CYP6Y4

(missing about 80 aa near N-term in a seq gap)











>CPIJ019703 CYP6Y6 Culex pipiens 59% to CYP6Y4

This seq is nearly the same as CPIJ016851 (5 aa diffs)

with 53 extra aa from the gap region, still missing the N-term

gc boundary after VVRQ












>CYP6Z1 Anopheles gambiae (mosquito) CYPm3r14 =, 494 aa



>CYP6Z2 Anopheles gambiae (mosquito) CYPm3r13 = , 488aa XM_317252.2|



>CYP6Z3 Anopheles gambiae (mosquito) CYPf2r10 = , 498aa



>CYP6Z4 Anopheles gambiae (mosquito) CYPm3r12 = , 492 aa



>CYP6Z5v1 Ochlerotatus sollicitans DQ427067





>CYP6Z5v2 Ochlerotatus sollicitans DQ427068





>CYP6Z5v3 Ochlerotatus sollicitans DQ427069





>CYP6Z5v4 Ochlerotatus sollicitans DQ427070





>CYP6Z5v5 Ochlerotatus sollicitans DQ427071





>CYP6Z5v6 Ochlerotatus sollicitans DQ427075




>CYP6Z5v7 Ochlerotatus sollicitans DQ427082




>CYP6Z6 Aedes aegypti (yellow fever mosquito) 1.371_16 CYP6Zae2












>CYP6Z7 Aedes aegypti (yellow fever mosquito) 1.371_17 AAGE01005406












>CYP6Z8 Aedes aegypti (yellow fever mosquito) 1.371_18 AAGE01065173 6Z3 like











>CYP6Z9 Aedes aegypti (yellow fever mosquito) 1.371_19 CYP6Zae1









>CYP6Z10 Culex_quinquefasciatus_05

58% to CYP6Z4 Anoph.



>CPIJ015428 CYP6Z10 Culex pipiens 98% to CYP6Z10 Culex_quinquefasciatus











>CPIJ004410 CYP6Z11 Culex pipiens 60% to CYP6Z10









>CPIJ004411 CYP6Z12 Culex pipiens 60% to CYP6Z10









>CPIJ019586 Culex pipiens (not certain about exon boundaries)

CYP6Z13P pseudogene 58% to CYP6Z10, & = frameshift and small deletion

63% to CPIJ008566












>CPIJ019587 CYP6Z14 Culex pipiens 61% to CYP6Z9











>CPIJ008566 CYP6Z15 Culex pipiens 66% to CYP6Z10











>CPIJ020018-pt 1 CYP6Z16 Culex pipiens

(partial CYP6Z- gaps in contig missing 5')

84% to CPIJ019586








>CPIJ020018-pt 2 CYP6Z17 Culex pipiens

(partial CYP6Z- gaps in contig missing 5')

92% to CPIJ019587   CYP6Z14







>CYP6AA1 Anopheles gambiae (mosquito) CYPf2r1 = , 505aa



>CYP6AA2 Anopheles gambiae ,501 aa CYPf2r2 =



>CYP6AA3 Anopheles minimus AY129952











>CYP6AA4 Anopheles funestus EU852640











>CYP6AA5v1 Aedes aegypti (yellow fever mosquito) 1.702_3 AAGE02023125.1  55% to 6AA2, 97% (12 aa diffs to AAGE01185776)







14210  VEQIVH (1)  14193





>CYP6AA5v2 Aedes aegypti (yellow fever mosquito) AAGE01185776 probable allele











>CYP6AA6 Aedes aegypti (yellow fever mosquito) AAGE01569058











>CPIJ005959 CYP6AA7 Culex pipiens 59% to CYP6AA6











>CPIJ005958 CYP6AA8 Culex pipiens 64% to CYP6AA6









>CPIJ005957 CYP6AA9 Culex pipiens 66% to CYP6AA6









>CYP6AB3 heme1 Depressaria pastinacella AY295773.1




>CYP6AB4 Bombyx mori 64% TO 6AB1











>CYP6AB5 Bombyx mori BAAB01021567.1 BAAB01206787.1 58% to 6AB3












>CYP6AB7 Depressaria pastinacella EF111023












>CYP6AB8 Bombyx mori AADK01010774.1,













>CYP6AB13 Manduca sexta Contig_546_FL sent to genbank

77% to CYP6AB2 Trichoplusia ni











>CYP6AD1 Anopheles gambiae CYPf2r9 = , 500aa



>CYP6AE1 AY295774 Depressaria pastinacella parsnip webworm N-term












>CYP6AE2 Bombyx mori











>CYP6AE3P Bombyx mori












>CYP6AE4 Bombyx mori











>CYP6AE5 Bombyx mori











>CYP6AE6P Bombyx mori













>CYP6AE7 Bombyx mori











>CYP6AE7    Bombyx mori strain Laos            GenEMBL EF432656

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007












>CYP6AE8 Bombyx mori Laos strain

            GenEMBL EF528486

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007












>CYP6AE9v1  Bombyx mori strain Laos

            GenEMBL EF535809

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007












>CYP6AE9v2 Bombyx mori

note: name changed fron CYP6AAE8 (old CYP6AEgg)











>6AE12v2 Helicoverpa armigera DQ256407










>CYP6AE14 Helicoverpa armigera DQ986461, gossypol-induced













>CYP6AE21  Bombyx mori Laos strain

           GenEMBL EF432657

           Dong Wang

           submitted to nomenclature committee Oct. 2, 2007

           94% to CYP9AE3P












>CYP6AE22v1 Bombyx mori strain Laos

            GenEMBL EF528485

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

            4 amino acid differences to CYP6AE22v1, probable allele












>CYP6AE22v2 Bombyx mori

note: name changed from CYP6AAE9 (old CYP6AEhh)












>CYP6AE25 Ostrinia furnacalis GU301782











>CYP6AE26 Epiphyas postvittana (Light brown apple moth)

EV813520 EST from male antennae

56% to CYP6AE12v1












>CYP6AE27 Zygaena filipendulae (zygaenid moth, Lepidoptera) GQ915322

#Zygae_c6669 51% to 6AE8 Bombyx, 52% to CYP6AE11 Helocoverpa armiger, a probable ortholog to the CYP6AE subfamily of moths



>CYP6AE30 Cnaphalocrocis medinalis (Lepidoptera: Pyralidae) rice leaffolder













>seq6 CYP6AE31(1) Manduca sexta sent to genbank

made from Contig_10481_3'-truncated and Contig_7242_5'-truncated









>seq7 CYP6AE32 (2) Manduca sexta sent to genbank

made from Contig_2417_3'-truncated and Contig_4726_5'-truncated









CYP6AE fragments from several Manduca sexta genes


>CYP6AE Manduca sexta Contig_4461_3'-truncated_(presence of PolyA tail)

54% to CYP6AE12 N-term






>CYP6AE Manduca sexta Contig_10287_3'-truncated

64% to Contig_10481, 53% to CYP6AE2 N-term




>CYP6AE Manduca sexta Contig_17280_5'- and 3'-truncated

90% to Contig_10481 except two short regions, may be same gene

54% to CYP6AE8, N-term to mid region





>CYP6AE Manduca sexta Contig_11225_5'- and 3'-truncated

67% to Contig_730, 57% to CYP6AE12, N-term to mid region




>CYP6AE Manduca sexta Contig_18570_5'- and 3'-truncated

60% to CYP6AE10 C-term





>CYP6AF1 Anopheles gambiae CYPq3l1 = , 500 aa



>CYP6AF2 Anopheles gambiae CYPq3l2 500 aa AAAB01008823.1




>CYP6AG1 Anopheles gambiae CYPh2r1 = , 452aa missing middle





>CYP6AG2 Anopheles gambiae CYPh2r3 498aa AAAB01008904.1 also BM594498










>CYP6AG2 Anopheles gambiae CYPh2r2 AAAB01008904.1

duplicate exons 2 and 3 this gene





>CYP6AG3 Aedes aegypti (yellow fever mosquito) 1.231_4









>CYP6AG4 Aedes aegypti (yellow fever mosquito) 1.231_5









>CYP6AG5 Aedes aegypti (yellow fever mosquito) 1.231_1 AAGE01005157









>CYP6AG6 Aedes aegypti (yellow fever mosquito) 1.231_2 AAGE01002325









>CYP6AG7 Aedes aegypti (yellow fever mosquito) 1.231_3 AAGE01024111 JP_25









>CYP6AG8 Aedes aegypti (yellow fever mosquito) 1.4359_1 AAGE01024260









>CPIJ002535 CYP6AG9 Culex pipiens 69% to CYP6AG5 (-) strand









>CPIJ002536 CYP6AG10 Culex pipiens 70% to CYP6AG6 (+) strand









>CPIJ002537 CYP6AG11 Culex pipiens 68% to CYP6AG6 (+) strand









>CPIJ002538 CYP6AG12 Culex pipiens 74% to CYP6AG3 (+) strand









>CPIJ009085 CYP6AG13 Culex pipiens 59% to CYP6AG6











>CPIJ017014 CYP6AG14 Culex pipiens 60% to CYP6AG6











>CPIJ019673 CYP6AG15 Culex pipiens 60% to CYP6AG6











>CPIJ019751 CYP6AG16 Culex pipiens 59% to CYP6AG6











>CYP6AH1 Aedes aegypti (yellow fever mosquito) 1.257_1 AAGE01277917 63% to 6AH1 Anopheles (ortholog)









>CYP6AH1 Anopheles gambiae CYPs2l4 499 aa AAAB01008807.1











>CPIJ000298 CYP6AH2 Culex pipiens 69% to CYP6AH1









>CPIJ000299 CYP6AH3 Culex pipiens 68% to CYP6AH1









>CYP6AJ1 Anopheles gambiae (malaria mosquito) CYPs3l3 = , 522aa



>CYP6AK1 Anopheles gambiae (malaria mosquito) CYPs3l2 = , 516aa



>CYP6AK1_Duplicate exon 1  Anopheles gambiae partial 2 aa diffs AAAB01008823.1




>CYP6AK1 Aedes aegypti (yellow fever mosquito) 1.136_1 AAGE01171970, 69% to 6AK1 Anopheles (ortholog)










>CPIJ016356 CYP6AK1 ortholog Culex pipiens 73% to CYP6AK1 Aedes









>CPIJ016355 CYP6AK1-de1b Culex pipiens pseudogene 3kb upstream

45% to CYP6AK1 N-term





>CYP6AL1 Aedes aegypti (yellow fever mosquito) 1.354_1 CYP6AL1 6I1.2











>CYP6AL1 6I1.2 Aedes aegypti 50% to CYP6N1, 48% to 6Y1, 60% to 6I2.3






>CYP6AL2v1 Aedes aegypti 6T1.2 50% to CYP6P2, 97% to 6I2.3






>CYP6AL2v2 Aedes aegypti 6I2.3 56% to CYP6P2, 97% to 6T1.2






>CYP6AL3 Aedes aegypti (yellow fever mosquito) 1.415_1 AAGE01116725




>CYP6AM1 Hodotermopsis sjostedti AB194532



>CYP6AN2 Bombyx mori BABH01029151.1, BABH01029152.1













>CYP6AN5 Maduca sexta Contig_1007_FL sent to genbank

61% to CYP6AN2 Bombyx mori











>CYP6AQ1 Apis mellifera AmGroup12.14 (315628-318450) honeybee 45% to 6K1, 42% to 6g2m 43% to 6G1ps new subfamily in CYP6












>CYP6AQ2 Philotrypesis sp. 5 YL-2008 EU661088





>CYP6AQ3 Philotrypesis sp. 5 YL-2008 EU661089





>CYP6AQ4 Nasonia vitripennis (jewel wasp)












>CYP6AQ5 Nasonia vitripennis (jewel wasp)












>CYP6AQ6P Nasonia vitripennis (jewel wasp)











>CYP6AQ7 Nasonia vitripennis (jewel wasp)












>CYP6AQ8 Nasonia vitripennis (jewel wasp)












>CYP6AQ9 Nasonia vitripennis (jewel wasp)












>CYP6AS1 Apis mellifera












>CYP6AS2 Apis mellifera












>CYP6AS2P1 Apis mellifera FRAGMENT GB19197-PA 209aa 3 exons gnl|Amel_2.0|GroupUn.5353 minus (2931-2710,2531-2286,2114-1950) 51% to D. melanogaster CYP6a17(AC020447) pseudogene fragment, similar to C-term of CYP6AS2 100%







>CYP6AS3 Apis mellifera












>CYP6AS4 Apis mellifera












>CYP6AS5 Apis mellifera












>CYP6AS7 Apis mellifera












>CYP6AS8 Apis mellifera












>CYP6AS9P PSEUDOGENE Apis mellifera












>CYP6AS10 Apis mellifera












>CYP6AS11 Apis mellifera












>CYP6AS11-de1b Apis mellifera (honeybee)

only 6 amino acid differences to 6AS11 in an 11 amino acid window

alternative exon 1




>CYP6AS12 Apis mellifera












>CYP6AS13 Apis mellifera












>CYP6AS14 Apis mellifera












>CYP6AS15 Apis mellifera












>CYP6AS16P PSEUDOGENE? Apis mellifera












>CYP6AS17 Apis mellifera












>CYP6AS18 Apis mellifera












>CYP6AS19 old CYP6AR1 Apis mellifera AmGroupUn.19 (44801-47550)



>CYP6AS20 Philotrypesis pilosa CYP6AS20 EU660213








>CYP6AS21 Philotrypesis sp. YL-2008 CYP6AS21 EU660214








>CYP6AS22 Philotrypesis sp. 1 YL-2008 EU660212





>CYP6AS23 Philotrypesis sp. 4 YL-2008 EU660209





>CYP6AS24 Philotrypesis sp. 4 YL-2008 EU660210





>CYP6AS25 Philotrypesis sp. 5 YL-2008 EU660211





>CYP6AS26 Solenopsis invicta (Lausanne fire ant) EE143495.1






>CYP6AS27 Nasonia vitripennis (jewel wasp)












>CYP6AS28P Nasonia vitripennis (jewel wasp)









>CYP6AS29 Nasonia vitripennis (jewel wasp)












>CYP6AS30 Nasonia vitripennis (jewel wasp)












>CYP6AS31 Nasonia vitripennis (jewel wasp)












>CYP6AS32 Nasonia vitripennis (jewel wasp)












>CYP6AS33 Nasonia vitripennis (jewel wasp)












>CYP6AS34 Nasonia vitripennis (jewel wasp)












>CYP6AS35 Nasonia vitripennis (jewel wasp)












>CYP6AS36P Nasonia vitripennis (jewel wasp)












>CYP6AS37P Nasonia vitripennis (jewel wasp)











>CYP6AT1 Phyllopertha diversa Cyp6Pd (antennae-rich 507aa Walter Leal scarab beetle (Coleoptera: Scarabeidae), AY605088.1



>CYP6AU1 Bombyx mori BAAB01129923.1 AADK01004964.1










>CYP6AV1 Bombyx mori BAAB01020563.1 BAAB01140967.1











>CYP6AW1 Bombyx mori BAAB01195862.1 BAAB01153386.1 CK496233 EST











>6AX1 Nilaparvata lugens brown planthopper seq 1 40% to 6AM1 40% to 6AS1












>6AY1 Nilaparvata lugens brown planthopper seq 2 42% to 6M3












>CYP6AZ1 Mayetiola destructor HFP450-1: Hessian fly AY884043























>CYP6BA1 Mayetiola destructor HFP450-2: Hessian fly AY884044























>CYP6BB1v1 shaoming huang 1/7/05 salt marsh mosquito Ochlerotatus sollicitans










>CYP6BB1v2 salt marsh mosquito Ochlerotatus sollicitans AY896793

only 4 aa diffs to CYP6BB1v1, 66% to CYP6BB1v2 XM_001847349











>CYP6BB1v3 salt marsh mosquito Ochlerotatus sollicitans AY896794











>CYP6BB1v4 salt marsh mosquito Ochlerotatus sollicitans AY896795











>CYP6BB1v5 salt marsh mosquito Ochlerotatus sollicitans AY896796











>CYP6BB1v6 salt marsh mosquito Ochlerotatus sollicitans DQ059299










>CYP6BB1v7 salt marsh mosquito Ochlerotatus sollicitans DQ427072




>CYP6BB1v8 salt marsh mosquito Ochlerotatus sollicitans DQ427076




>CYP6BB1v9 salt marsh mosquito Ochlerotatus sollicitans DQ427083




>CYP6BB2 Aedes aegypti 1.1327_1 AAGE01011017? CYP6Pae1, 54% to 6BB1, 53% to 6P4, 48% to 6P1












>CYP6BB3 Culex quinquefasciatus XM_001847349

100% to CYP6BB3 Culex pipiens misnamed in Genbank entry CYP6BB1v2

66% to CYP6BB1 salt marsh mosquito Ochlerotatus sollicitans











>CPIJ005953 CYP6BB3 Culex pipiens 99% to CYP6BB3 Culex_quinquefasciatus 2 aa diffs









>CPIJ005952 CYP6BB4 Culex pipiens 56% to CYP6BB2











>CYP6BC1 Apis mellifera












>CYP6BC2 Nasonia vitripennis (jewel wasp)












>CYP6BD1 Apis mellifera













>CYP6BD2 Nasonia vitripennis (jewel wasp)












>CYP6BD2-de4b Nasonia vitripennis (jewel wasp)




>CYP6BD3 Nasonia vitripennis (jewel wasp)












>CYP6BD4 Nasonia vitripennis (jewel wasp)












>CYP6BD5 Nasonia vitripennis (jewel wasp)












>CYP6BD6 Contig_933_FL Manduca sexta sent to genbank

68% to CYP6BD5 Nasonia vitripennis (jewel wasp)











>CYP6BE1 Apis mellifera












>CYP6BF1v1 Plutella xylostella (L.) (diamondback moth) (error in name, was called 6BG2) AY971374











>CYP6BF1v2 Plutella xylostella DQ088989












>CYP6BF1v3 Plutella xylostella DQ098153









>CYP6BF1v4 Plutella xylostella (L.) (diamondback moth) AB236319











>CYP6BG1 Plutella xylostella (L.) (diamondback moth)

Seq 1 of bautista 62% to 6AE1 69% to seq 2 58% to Li's seq CYP6BF1

1 aa diff to AB372008




>CYP6BG1 Plutella xylostella (L.) (diamondback moth) AB372008










>CYP6BH1v1 Leptinotarsa decemlineata (Colorado potato beetle) DQ117461

CYP6(R1v1)|Sequence 1 ORF:67..1548 Frame +1 39% to 6N3 potato beetle










>CYP6BH1v2 Leptinotarsa decemlineata (Colorado potato beetle) DQ117462











>CYP6BJ1v1 DQ117463

CYP6(R5)|Sequence 1 ORF:52..1584 Frame +1 46% to 6M1 potato beetle










>CYP6BJ1v2 Leptinotarsa decemlineata DQ631656



>CYP6BJ2 Leptinotarsa decemlineata DQ631655



>CYP6BK1 Tribolium castaneum









>CYP6BK3 Tribolium castaneum










>CYP6BK2 Tribolium castaneum










>CYP6BK4 Tribolium castaneum










>CYP6BK5 Tribolium castaneum








>CYP6BK6 Tribolium castaneum










>CYP6BK7 Tribolium castaneum









>CYP6BK8P Tribolium castaneum














>CYP6BK9 Tribolium castaneum












>CYP6BK10 Tribolium castaneum










>CYP6BK11 Tribolium castaneum










>CYP6BK12 Tribolium castaneum










>CYP6BK13 Tribolium castaneum










>CYP6BK14 Tribolium castaneum









>CYP6BK15P Tribolium castaneum









>CYP6BK16P Tribolium castaneum








>CYP6BK17 Tribolium castaneum



>CYP6BL1 Tribolium castaneum









>CYP6BM1 Tribolium castaneum










>CYP6BN1 Tribolium castaneum









>CYP6BP1 Tribolium castaneum









>CYP6BP2P Tribolium castaneum












>CYP6BQ1 Tribolium castaneum











>CYP6BQ2 Tribolium castaneum










>CYP6BQ3P Tribolium castaneum












>CYP6BQ4 Tribolium castaneum










>CYP6BQ5 Tribolium castaneum











>CYP6BQ6 Tribolium castaneum










>CYP6BQ7 Tribolium castaneum










>CYP6BQ8 Tribolium castaneum










>CYP6BQ9P Tribolium castaneum












>CYP6BQ10 Tribolium castaneum










>CY6BQ11 Tribolium castaneum










>CYP6BQ12 Tribolium castaneum










>CYP6BQ13 Tribolium castaneum










>CYP6BQ14P Tribolium castaneum













>CYP6BR1 Tribolium castaneum










>CYP6BR2 Tribolium castaneum










>CYP6BR3 Tribolium castaneum











>CYP6BS1 Tribolium castaneum










>CYP6BT1 Tribolium castaneum









>CYP6BU1 Leptinotarsa decemlineata DQ631653



>CYP6BW1 Dendroctonus ponderosae (mountain pine beetle, bark beetle)

EZ116081.1, EZ115472










>CYP6BW2 Dendroctonus ponderosae




>CYP6BW3 Dendroctonus ponderosae EZ116080






>CYP6BX1 Dendroctonus ponderosae












>CYP6BY1 Aedes aegypti 1.7_1 AAGE01026936



>CPIJ003361 CYP6BY2 Culex pipiens 59% to CYP6BY1











>CPIJ003375 CYP6BY3 Culex pipiens 67% to CYP6BY1 (-) strand









>CPIJ003376 CYP6BY4 Culex pipiens 62% to CYP6BY1 (-) strand









>CPIJ003377 CYP6BY5 Culex pipiens 61% to CYP6BY1 (-) strand











>CPIJ003378 CYP6BY6 Culex pipiens 59% to CYP6BY1 (+) strand









>CPIJ003389 CYP6BY7 Culex pipiens 66% to CYP6BY1









>CYP6BZ1 Aedes aegypti (yellow fever mosquito) 1.702_2 AAGE01408667 50% to 6P2









>CPIJ005956 CYP6BZ2 Culex pipiens 100% to CYP6BZ2 Culex_quinquefasciatus, 64% to 6BZ1











>CYP6BZ2 Culex_quinquefasciatus_32

50% to 6P4 Anoph., 64% to 6BZ1 Aedes











>CYP6CA1 Aedes aegypti 1.1219_3 AAGE01005840 no introns









>CYP6CB1 Aedes aegypti 1.48_4 AAGE01206812









>CYP6CB2 Aedes aegypti 1.1337_1 AAGE01003592



>CYP6CC1v1 Aedes aegypti 1.1327_5 AAGE01083421b 17 diffs, new gene or allele?



>CYP6CC1v2 Aedes aegypti AAGE01083421a













>CPIJ005954 CYP6CC2 Culex pipiens 100% to CYP6CC2 Culex_quinquefasciatus











>CYP6CC2 Culex_quinquefasciatus_35

53% to CYP6CC1 Aedes,  44% to 6AD1 Anoph.











>CYP6CD1 Aedes aegypti 1.138_1 AAGE01126587









>CPIJ018494 CYP6CD2 Culex pipiens 63% to CYP6CD1











>CPIJ017609 CYP6CD3 Culex pipiens 56% to CYP6CD1











>CYP6CE1 psocid, Liposcelis bostrychophila Jiang Hongbo 1/31/07












>CYP6CE1v2 psocid, Liposcelis bostrychophila EU266572

1 aa diff to CYP6CE1, DDVP resistant strain












>CYP6CE1v3 psocid, Liposcelis bostrychophila EU266573

6 aa diffs to CYP6CE1, phosphine resistant strain












>CYP6CE2 Liposcelis bostrychophila EF421246












>CYP6CF1 Pediculus humanus humanus Ph6-3 516aa 4 exons 1103172107895 plus (167174-168074,168342-168560,168639-168890,168965-169140) similar to  Tc6BQ13,  40% to 6N5 Ag



>CYP6CG1 Pediculus humanus humanus Ph6-6 534aa 6 exons 1103172108300 plus (16013-16406,16506-16858,16934-17153,17250-17456,17542-17796,17937-18109) similar to  Tc6BQ8, 

44% to 6CE1 psocid, Liposcelis bostrychophila, 55% to Ph6-9i



>CYP6CG2 Pediculus humanus humanus Ph6-9i 396aa 5 exons 1103172107451 plus (3-144,290-648,795-996,1103-1333,1460-1711) similar to  Tc6BQ2,  incomplete, missing N-term and last exon on C-term, upstream from Ph6-10i 51% to 6BQ10 Tc

54% to 6CE1 psocid, Liposcelis bostrychophila, 91% to 6CG3

N-term from EST seq CB887363.1 Pediculus humanus corporis

CYP6CG2 C-term Ph6-4f 93aa 2 exons 1103172108418 plus (44-162,238-398),  last two exons on C-term, upstream from Ph6-5f 52% to  Tc6BK5, 56% to 6AM1 Hodotermopsis sjostedti, 48% to 6CG1 C-term only

exact match to CYP6CG2 for 39 amino acids, probable C-term seq. (also 100% to CYP6CG3 C-term 27 amino acids)

green seq above













>CYP6CG3 Pediculus humanus humanus Ph6-10i 339aa 4 exons 1103172107451 plus (1833-2198,2306-2507,2597-2827,2941-3156) similar to  Tc6BQ2,  incomplete, missing N-term and last exon on C-term, downstream from Ph6-9i, upstream from Ph6-11

53% to 6CE1 psocid, Liposcelis bostrychophila, 91% to 6CG2

CYP6CG3 N-term Ph6-5f 112aa 1 exon 1103172108418 plus (922-1255) similar to  Tc6BK5,  only first exon on C-term, dowstream from Ph6-4f 38% to CYP6AS13, 90% to louse EST CB887363, 48% to 6CG1 N-term only

probably = N-term of CYP6CG3 Note: YS (red) probably in the intron


XXXX (1?)






>CYP6CG4 Pediculus humanus humanus Ph6-7 395aa 5 exons 1103172108239 plus (259-617,715-901,1084-1311,1383-1634,1708-1868) similar to  Tc6BQ2,  missing first exon on N-term, upstream from Ph6-8

53% to 6CE1 psocid, Liposcelis bostrychophila, 54% to 6CG1



>CYP6CH1 Pediculus humanus humanus Ph6-8 497aa 6 exons 1103172108239 plus (8055-8358,8443-8801,8885-9050,9157-9387,9469-9720,9805-9983) similar to  Tc6BQ2,  downstream from Ph6-7

39% to 6CE1 psocid, Liposcelis bostrychophila, 40% to 6BK4 Tc, 60% to 6CH2



>CYP6CH2 Pediculus humanus humanus Ph6-11 511aa 6 exons 1103172107451 plus (4921-5248,5330-5688,5759-5954,6047-6277,6374-6625,6707-6873) similar to  Tc6BQ2,  GC-donor on 3rd intron, downstream from Ph6-10i

45% to 6CE1 psocid, Liposcelis bostrychophila, 60% to 6CH1



>CYP6CJ1 Pediculus humanus humanus Ph345 519aa 5 exons 1103172108318 plus (455289-455679,455762-456298,456379-456591,456680-456934,457024-457184) similar to  Tc345A2, 

47% to CYP6K1 Blatella germanica, new CYP6 subfamily, 45% to 6CG2



>CYP6CK1 Philotrypesis sp1 (Hymenoptera: Chalcidoidea: Agaonidae) non-pollinating fig wasp, EU661087





>CYP6CK2P Nasonia vitripennis (jewel wasp)












>CYP6CK3 Nasonia vitripennis (jewel wasp)












>CYP6CK4 Nasonia vitripennis (jewel wasp)













>CYP6CK5 Nasonia vitripennis (jewel wasp)













>CYP6CK6 Nasonia vitripennis (jewel wasp)












>CYP6CK7 Nasonia vitripennis (jewel wasp)













>CYP6CK8 Nasonia vitripennis (jewel wasp)













>CYP6CK9P Nasonia vitripennis (jewel wasp)













>CYP6CK10 Nasonia vitripennis (jewel wasp)













>CYP6CK11 Nasonia vitripennis (jewel wasp)













>CYP6CK11-de3b6b Nasonia vitripennis (jewel wasp)





>CYP6CK12 Nasonia vitripennis (jewel wasp)













>CYP6CK13 Nasonia vitripennis (jewel wasp)












>CYP6CL1 Nasonia vitripennis (jewel wasp)












>CYP6CM1 Bemisia tabaci GQ214539












>CYP6CN1 Plutella xylostella EU189053








>CPIJ012640 CYP6CP1 Culex pipiens 42% to CYP6F1











>CPIJ016847 CYP6CQ1 Culex pipiens (no introns)

47% to CYP6M11, 84% to CPIJ019701









>CPIJ019701 CYP6CQ2 Culex pipiens 84% to CYP6CQ1 CPIJ016847 N-term in a seq gap










>CYP6CS1 Nilaparvata lugens FM994118.3












>CYP6CT1 Zygaena filipendulae GQ915316












>CYP6CV1 Cnaphalocrocis medinalis FN421127











>CYP6CW1 Nilaparvata lugens FN421126












>CYP6CX1v2 Bemisia tabaci (whitefly) Susceptible strain GQ330542.1






>CYP6CY1 Acyrthosiphon pisum SCAFFOLD10025:26656..31321








>CYP6CY2 ?Acyrthosiphon pisum SCAFFOLD10025:31376..37086









>CYP6CY3 Acyrthosiphon pisum SCAFFOLD10025:41696..46319










>CYP6CY4 ?Acyrthosiphon pisum SCAFFOLD10025:137606..141395









>CYP6CY5 Acyrthosiphon pisum SCAFFOLD13514:28216..31057









>CYP6CY6 Acyrthosiphon pisum ?SCAFFOLD13514:36706..45131









>CYP6CY7 Acyrthosiphon pisum SCAFFOLD17283:187176..190201









>CYP6CY8 Acyrthosiphon pisum LOC100159248 ?SCAFFOLD5532:14697..15575 (- strand)







>CYP6CY9 Acyrthosiphon pisum LOC100161627 ?SCAFFOLD1099:1136..6561 (+ strand)









>CYP6CY10P Acyrthosiphon pisum LOC100159387 SCAFFOLD6634 coords:14145-18091





>CYP6CY11P Acyrthosiphon pisum SCAFFOLD12002:AUG4_SCAFFOLD12002.g13.t1






>CYP6CY12 Acyrthosiphon pisum 39% to CYP6AX1










>CYP6CY13 Acyrthosiphon pisum SCAFFOLD7563:47979..58025









>CYP6CY14 Acyrthosiphon pisum SCAFFOLD8603:3827..8475









>CYP6CY15 Acyrthosiphon pisum SCAFFOLD5222 coords:2410-5346









>CYP6CY16 Acyrthosiphon pisum LOC100162372 SCAFFOLD1019:69426..73624 (+ strand)









>CYP6CY17 Acyrthosiphon pisum SCAFFOLD2510:85936..93942









>CYP6CY18 Acyrthosiphon pisum SCAFFOLD1502:67256..70800










>CYP6CZ1 Acyrthosiphon pisum ??SCAFFOLD1502:79066..88489









>CYP6DA1 Acyrthosiphon pisum SCAFFOLD17790 coords:18123-22112









>CYP6DA2 Acyrthosiphon pisum SCAFFOLD17790:22986..29493









>CYP6DB1 Acyrthosiphon pisum AUG5s6612g1t2 XR_045850 40% to CYP6K1









>CYP6DC1 Acyrthosiphon pisum AUG5s9515g6t1p 41% to CYP6AM1 Hodotermopsis sjostedti









>CYP6DD1 Acyrthosiphon pisum SCAFFOLD16233:102870..132505










>CYP6DE2 Dendroctonus ponderosae








>CYP6-un1 Acyrthosiphon pisum  AUG5s17796g1t1p SCAFFOLD17796:3506..66376






>CYP9A1v1 Heliothis virescens (tobacco budworm) U23506












>CYP9A1v2 Heliothis virescens Satish Pimprale yellow strain

97% to CYP9A1v1,














>CYP9A1v2 Heliothis virescens Satish Pimprale Pyrethroid-Resistant strain

98% to CYP9A1v1, 1 aa diff from yellow strain D397Y















>CYP9A2 Manduca sexta AF172278





>CYP9A3v1 Helicoverpa armigera (Australian cotton bollworm) U86006





>CYP9A4 Manduca sexta AF172279












>CYP9A4v2    Manduca sexta AF172280









>CYP9A5      Manduca sexta AF172281












>CYP9A6 Depressaria pastinacella AY295776





>CYP9A7 Depressaria pastinacella AY295775










>CYP9A8 Spodoptera litura AF525031












>CYP9A9 Spodoptera exigua AB381883












>9A12 Helicoverpa armigera (Australian cotton bollworm) AY371318.1












>CYP9A13 Mamestra brassicae antennal cytochrome P450 AY390260












>CYP9A14 Helicoverpa armigera AY487948












>CYP9A17v1 Helicoverpa armigera AY753201












>CYP9A17v2 Helicoverpa armigera (Australian cotton bollworm) DQ003275