Red algae Cyanidioschyzon merolae P450s

 

 

A search was done at the following link for the Keyword P450.

Four P450 sequences were found this way.  A fifth sequence (#444) was found later by

Suzanne Paquette, doing Blast searches.  This appears to be all the

P450s in this 16Mb red algal genome.  Note the CYP51 and CYP710s are

conserved with other plants. 

 

D. Nelson July 26, 2004

 

http://merolae.biol.s.u-tokyo.ac.jp/db/search.cgi?keywords=P450

 

for the Genome project page click  here

 

This algae is able to grow in hot acid water at 45C and pH less than 2.

 

 

 

#201

Locus CMD096C

Location c04f0001 232736>234421 [Show ORF map]

Annotation similar to cytochrome P450 monooxygenase

Comments KOG{KOG0157}

Deduced sequence

MILARNLLHVPRPSLYVVAALGAFSLFQVGSTVAKYALWFWKQKRAGRPVSRGLLEVVTA

LGPVPVPGFGNALYLSRVGFFRALYESCLERQVTVFWLSSTPLLIVSAPDLVEQVLTSRT

FEKPQYFGYRSRTVKTALELHQRAELLREKIETADPDQQQRVREDPSRAALLDLIDRSLT

EIASSTEKFLAELRAEDNVGKDASKLIQRFYVQLNCKVLFGLVVDNAEATRIASAIEKAG

AEFSRRMILPQRALYAWFANVSYIYHTSVLLIFGQKILRHLRISSNSWINGWLGKAGRLR

RLAKVLGLLMAATQTVPIAASWALILVSVHEDVREKLACEARRLLSEDLSVNGGRGVAQQ

GSQTSQTTPAQKANLTASDIATDVNRLSKLLKKHSYFDAVIAETLRLFPPFPLIQRQAQC

DTHLGDVFVPGGTLVAAVPWLQHHHPAYWKQAESFNPERWISPTDNVARHGDAPSDYCYI

PFGRGRRMCAGNPLAMVELKCLLLLVALQEPDLLFDLEPQETSPEPQAGMRFPPLTMRPP

RFAVRQEEPIHRKLCQQNSNEL

 

#4765

Locus CMJ270C

Location c10f0010 409471<411144 [Show ORF map]

Annotation similar to cytochrome P450

Comments KOG{KOG0157}

51% to chlamydomonas Scaffold 690 10 EXONS 43% to 710A1

44% to 710A1

Deduced sequence

MIETASLTRSTPVAAAEWVVSVARHCLRRADAALGIAGWGTASRALAYVALLVLGLAIAE

QVRLRRWAGYGRIPGPRFVIPLIGSIVEMVLSPYGFWERQRRLNPCGLSWNALAGFFVLF

VTDTDLSRYVLSENGPHAFEMILHPNGWRILGRNNIAFKSGEEHKLLRQSFLRLFTPKAL

GMYVSIHERLIGEHLAAWLSGRGTDGTAAAFEVRPRIRDLNLRTSQTVFVGPYLRDRERF

CADYLLITQGFLSFPLALPGTGLWRAIRARERVLRDLTACVRASKERFRKDAEAEPQCLL

DFWTVSVLEEVAAAKRENRAPPKYSADHEMADAMLDFLFASQDASTASLVWTTVLVAERP

DVLQRVREEQQRLRPHDEPITYELLEQMVYTRAVVLEVLRFRPPPVMVPQVASKRVQLPN

GYEVPRGALVVPSLWTACMQGFPSPERFDPERMLPPRQEEQKYRKHFLTFGCGPHMCVGR

NYAINHLMCYLAVLATTVDWTRVRTVHSDEIIYLPTIYPADSVIRARWRVADASTGAGTG

AGTDTACTSEAVPVVVAS

 

#4211

Locus CMJ284C

Location c10f0010 443069<444736 [Show ORF map]

Annotation cytochrome p450

Comments D40368(S2303) corresponds to a region of the predicted

gene.~Similar to Arabidopsis thaliana chromosome II BAC T31E10;

putative> cytochrome P450 (AC004077) KOG{KOG0157}

51% to chlamydomonas Scaffold 690 10 EXONS 43% to 710A1

44% to 710A1

Deduced sequence

MIRRPRYALDASGSSRVGGSVARHCLRRATLRWDRRLGYRQPCAGVRCAAGARPRDRRQV

RLRRWAGYGRIPGPRFVIPLIGSIVEMVLSPYGFWERQRRLNPCGLSWNALAGFFVLFVT

DTDLSRYVLSENGPHAFEMILHPNGWRILGRNNIAFKSGEEHKLLRQSFLRLFTPKALGV

YVSIQERLIREHLAAWLSGRGTDGTTAAFEVRPRIRDLNLRTSQTVFVGPYLRDRERFCA

DYLLITQGFLSFPLALPGTGLWRAIRARERVLRDLTACVRASKERFRKDAEAEPQCLLDF

WTVSVLEEVAAAKRENRAPPKYSADHEMADAMLDFLFASQDASTASLVWTTVLVAERPDV

LQRVREEQQRLRPHDEPITYELLEQMVYTRAVVLEVLRFRPPPVMVPQVASKRVQLPNGY

EVPRGALVVPSLWTACMQGFPSPERFDPERMLPPRQEEQKYRKHFLTFGCGPHMCVGRNY

AINHLMCYLAVLATTVDWTRVRTVHSDEIIYLPTIYPADSVIRARWRVADASTGAGTGAG

TDTACTSEAVPVVVAS

 

#331

Locus CMS319C

Location c19f0009 423695<425287 [Show ORF map]

Annotation cytochrome P450 involved in sterol biosynthesis

Comments 14-demethylase KOG{KOG0684}

48% to 51G1

Deduced sequence

MGTILAALANQFQALLARARDGDTDAIGWLALGVAALVWLMTRAAQALATLLSPAKPAEG

LELAYPPLYTEGFPVVGNVAAFARNPLQLAKRAYAQLGDVFTLRVGPKRFTFLVGPRAHE

VFFRANDDELDQGPVYGFSVPVFGRGVVYDAPLAIRLEQFRFVSTALRAARLREYVPLMV

AEAETYFKRHWHGTDGTADLLKSLSELIILTASRCLMGREVREQLFEEVSTLYHQLDQGM

QPLSVFAPHFPCKAHWQRDRARREMRRLFASIIANRRKRYQEIAAQAESVGQDPQQALEA

AKEVDVLQVFMDSQYRDGSRLTDDQITGLLIAVLFAGQHTSTITGTWTGLLMLRKPELVT

RVRAEQEQVLYDDDGCFKIDYDALLRLDVMHRCIKEALRMYPPLIFLMREVVIPRTYRDY

VIPKGDIVVVSPPLAMSLPEVFADPDRYDPDRYAPPREEDKRVPFSHIGFGGGRHACMGE

QFAYLQIKTIWSVILRDYDLEPVGPLPLPDYSAMVVGPKPPCLVRWRRRTP

 

#444

Locus CMR093C

Location c18f0001 254897<256381 [Show ORF map]

Annotation hypothetical protein

Comments KOG{KOG0684}

Deduced sequence

MFPVFIWFVIVAIAIVTFTFGVPGTLLRRQRRKQLRGDTFPVRDVSAERLPPCIRGWCPY

VRAGFQFAFGAAPPQSFLEAARKQHGDVFTVEMFGRRMTFLFSKNGIGQFFDSAPSKVSF

IRAVEPFTDGIFGLAPTYFEKILHMLLVQLREELHLDKGSDRGLARHLTGFAEALRMAMR

QQMASLDGQAVAHVDDLFDLCGRLIFTASFQTVFGRECANALNKDGRLYETFVAFDREFE

LAALPIPQFLLRSFSRARRQLLRAMQRAVRLVEPATPAGKLLAKLDSDEKVCASVLLTLL

WASSANTLLSAGWLIVLSAEWCNRARPVTESMAWELVTETLRLASSGIAVRIGCEPLYVD

DFRIPAGDYLCISPWLAHQDEHRGGKRFDPCRYQHIEDKKALFRGRTRQLYTFGGGMYRC

PGQEYALHELVLFIQIFFEFVERVELGVAGDPLTSMDAYRLVGIKRPTRPFPGKLFLISS

CCDLRCGDPHPSERW