>aaaa01012243.1 $FI CYP51G1 Indica rice genome CYP51 New April 24, 2002

5108 MTLADPNHRLIAGAALLVATLAFIKLLLSSAGGGKKRLPPTIPAAPLVGGLLRFMRGPIPM 4926
4925 IREEYARLGSVFTVPILSRKITFLIGPEVSAHFFKGNEAEMSQQEVYKFNVPTFGPGVVF 4746
4745 DVDYSVRQEQFRFFTEALRANKLRSYVDQMVVEAE 4641
2774 EYFSKWGESGTVDLKYELEHLIILTASRCLLGREVREKLFDDVSALFHDLDNGMQPVSV 2598
2597 IFPYLPIPAHRRRDRARQRLKEIFATIIKSRKASGQAEEDMLQCFIDSKYKSGRSTTEGE 2418
2417 ITGLLIAALFAGQHTSSITSTWTGAYMLRFKQYFAAAEEEQKEVMKRHGDKIDHDILAEMDVLYR 2223
2222 CIKEALRLHPPLIMLLRQSHNDFSVTTKDGKEFDIPKGHIVATSPAFANRLPHIFKNPDS 2043
2042 YDPDRYAPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPF 1863
1862 PETNWKAMVVGIKDEVMVNFKRRKLVVDN* 1773

>AP005448.1b $F CYP51H1 (japonica cultivar-group) chromosome 7 21 June 2002

32724 MDHVTSSTIARGAMSWVAATVALLLTTAVILTALQKRKISSPAAAAPPVVRGAGLVRFA 32900
32901 RAMARDGPLEAIREQQAKLGSVFTAIAPFGLFKVTFLIGPEVSSHFYLAPESEMGQGSIY 33080
33081 RFTVPLFGPEVGYAVDPDTRAEQMRLFWDVLKPRSIEARVGAMAEEVQ 33224
35381 NYFSRWGEQGTVDLKKELEQVLMLIASRCLLGREVRESMVDEVYELFRDLDNGLHLIS 35554
35555 TMLPYLPTPAHRRRDRARQRLGEIFTEVIRSRRNSGTADNGDDVLQRLIDGRYKD 35719
35720 ERDLTDVEVVGLLVALVFAGKHSSSSVSTWTGINLLSHPNHLVAVIAEQDRLMASRARTD 35899
35900 DDHDRVNYDTVQEMTTLHRCIKEALRLHPPAVAMFRQARKHFTVQTKEGKEYTIPGGHTV 36079
36080 MSTILVNHHMPNVYKDPHVFDPSRFARGRGEDKAAGPFSFLAFGAGRHSCAGESFAYTQI 36259
36260 KVIWSHLLRNFELKMVSPFPETSWRMVTPEPKGTVMISYRRRNLTCK* 36403

>AP005188.2b $P CYP51H2P (japonica cultivar-group) chr 7 N-term fragment

52199 MDHLTSS 
      TISDTMWLTTVALLLTTVVIWTALQKRKRGEACPAAVAPPPIVQGTALVRFLRAMARDG 52375
52376 PLEVIREQLAKLGSVFMASAPLGLFKVTFLVGAEL 52480

>aaaa01001626.1 $FI CYP51H3 (indica cultivar-group) Cterm ONE FRAMESHIFT

22316 MQLTSSTVFWLTTAVAFLLINTVILRALQKRKSSPAAAAAAPPPPVVQGVGLVRFV
      RAMARDGPLEAIREQQAKLGSVFTASAPLGTFLIGSEVSSHFYVAPDSEISMGRLY
      EFTVPIFGPGVLYGVDLETRKEQIRFNWDILKPRSLKASVGAMAEEVE (0) 22795
23040 NYFSRWGDQGTVDLKHELEQVLMLTASRCLLGKELRER 23153 (FS)
23156 VPGKLCELFGELDNGLHLISGLLPYLPIPAH
23249 RRRDRARQRLGEIITEVIRSRRNSSRGAAGTDENNDDMLQCLINSRYKDGCAMTDAE 23419
23420 TAGLVVALMFAGKHTSSGVSIWTGVHLLSNPNHLAAVVAEQDRLMASCPGRTDDYHRLD 23596
23597 YDTVQEMRSLHCCVKEALRLHPPVAAVSQAYKHFTVQTKEGKEYTIPGGHMVVSTILVNH 23776
23777 YLPHIYKDPHVFDPQRFAPGREEEKVAGRFSFLSFSAGRHACAGESFSYTQIKVLWSYLL 23956
23957 SNFEIKMVSPFLETEWSTVIPEPKGKVMVSYRRRTAPK* 24073

>AP004890.1 $F CYP51H4 (japonica cultivar-group) chr 2 
78968 MDHIFSTNAWLTIALVFIITLAAKVVRSSVTLPAEKTSKPRPPPEAKGAPLV 79123
79124 GIIPAVLRRGLQAVIREQHRALGSVFTLRSLGLAVTFLVGPECSDHFFHAPELEIAID 79297
79298 GLYEVTVPIFGKEVGYDIDLDTRNEQHRFFAKMLRPAKLRGHVLPMVCEIEX 79450
79551 YFGKWGECGVVDLMQEVDHVLMLIASRCLLGKEVRENMFDEVASLFHELMGGMHLISMFF 79730
79731 PYLPTPGHRRRDKARAKLGEIFSQIVKTRKMSGRVEDDMLQDLIDSTYGDGRATT 79895
79896 DTEVTGLLVALLFAGHHTSSTVAVWTALRLLTHPEHLRAVRAEQERLVAAAEQQRSHHGG 80075
80076 GGGGGIDYGVLLQMDVLHRCIKEALRLHPVTPMILRRARRGFTVRDKEGGEYSVPAGRLL 80255
80256 ASPLVVNTLLPNIYKDPHVFDPDRFAAGRAEDKAVAGARDLAYLSFGAGKHACMGEGYAY 80435
80436 QQIKVILSHLVSNFELKLESPFPETEDMLSMRPKGKAIVSYKRRTLS 80576

>AP004090.1 $F CYP51H5 chr 2 clone OJ1399_H05 49% to 51A2

78158 MAVLFVATKMIQQRPRTLCLYEKENKEEELLLPPVMSVVSVLTAYLPTLIAKGLPAVIHDLH
77972 SRLVTLLVTAHFFQASESEIRQSNIYKVTVPVFGRGVLYDVDLATRSRQISFCTDS 77805
77804 IKPINLRGHVDSMVHEVE 77751 (0)
76666 GYFAQWGEDGVVDIKYEMGNLILLIANRCLLGKQFGESKLEQVSTLLHELFDNGFHLISLF 76484
76483 FPYLPTPQHRRRDKARAMLGEMIHEAVRSRRNSGVAEDDVLQKFLDSKYINGRCMTENEI 76304
76303 AGLLICMMFAAQHTSSSTSTWTGACLLSHGHRSYLAAAIQEQKRIIQQHGDRINWGILLQ 76124
76123 MTTLTHCIKEALRLHPPANLLIRHASKSFSVQTRQGHRYQIPKGHTLATCTTVGNRLPYI 75944
75943 YKDPNVYDPSRFGPGREEDKVGGKFSYTPFSAGRHVCLGEDFAYMQIKVIWSHLLRNFDL 75764
75763 ELISPFPEEEWEKFIPGPKGKVMVTYKRRRLL* 75665

>AC108875.1a $F CYP51H6 chr 5 51% to 51A2 same as AQ050946 AQ687182 AQ258479

70310 MELTSSSAMWLAMAILAITAALTKIALGGGRRRCLSESSDLTCKTPPPPPVVNCIALLGL 70489
70490 LPALFRGDVPATMQQLYAKFGSVFTVSVAGLLKATFLVGPEVSAHFFQGLESEVSHGDLF 70669
70670 EFTVPMFGKEVGHGVDNATRIEQGRFFAEALKPVRLRIHVDPMVQEVE 70813 (0?)
71263 DYFAKWGQHGTVDLKHELEQLLLLISGRCLLGKEVMGTKFDEVCNLFRDIEGGVNLMSV 71439
71440 FFPYTPLIPSNRRRDMARERLHAIFSDIVRSRKQQQGDQEEVNDKDVLQSFIDSR 71604 (2?)
71910 YKADGRATTEAEVAGLITGVLFAAKHTSTHTSVWTGARLLTHEKFLAAAVDEQDQIVR 72083
72084 KHGIINGRIVTDHYGFLMEMHMLHICIKETLRLHPPAPMIVRTALRQFTVRTREGHEYCV 72263
72264 PAGHTMASPIVISNRVPYIYKDAHLYDPDRFGPRREEDKVGGKFSYTSFGGGRNSCVGEN 72443
72444 YAYMQIKAIWSHLLRNFELKLLSPFPKTDWSKLVPEPQGKVMVSYKRRQL 72593

>AC108875.1b $F CYP51H7 chromosome 5 48% to 51A2
80009 MAIILAITAAVTKIARGGRRRSATDPTCKMPPPPPVVNSIALLRLLPTLFRSGLPA 80176
80177 ILHELYTKFGSVFTINLAGLLKMTFLVGPEVSAHFFQGLESEISHGNLLEFTVPMFGKEI 80356
80357 AHGVDSATRNEQARFFVDALKPARLRIHVDPMVQEVE 80467 (0?)
84741 DYFAKWGQHGTVDLRRELEQLLLLISGRCLLGKEVMGTMFDEVCNLFRDIEGGVNLMSV 84917
84918 FFPYTPLIPSNRRRDMARKRLHAIFSDIVRSRKQREGDNVDKDVLQSLIDSRYKADGRAT 85097
85098 TEA*VAALMICLLFAAKHTSAYTSVWTGARLLSHERFLTAAVDEQDKIAREHSNINGGGR 85277
85278 ITDDRYGSLMEMRTLHSCIKETLRLHPPVPMLVRTAHKQFTVRTREGHEYAVPAGHTIAS 85457
85458 PIVISNQVPYIYKDGHLYDPDRFGPAGREEDKVGGKFSYASFGGGRTGCVGEGYAYMQIK 85637
85638 AIWSHLLRNFELRLLSPLPKSDFTKFVPEPHGELMVSYKRRQL 85766

>AC108875.1c $F CYP51H8 chromosome 5 50% to 51A2
122577 MDLVSISIYMWAMAALCTIITAMVTTKLARVRRPITLNPKSKRPLPPVVNVIA 122735
122736 LLEHLPRLCTKGVIPVYKGSVFTVSLFGLKATFLVGPEVSAHFYQGMDSEISQGDLYEFT 122915
122916 VPLFGKGVGFDIDNATRTEHLRFFIDAIKTSKLRNHVNSMVQEVE 123050 (0?)
123296 DYFAKWGENGIVDIKHEFEKLLMLISGHCLLGKEVRDNMFDEVFSLF 123436
123437 HELDSGVGLGSVIFPYIPIPSHIRCDKAHAKLAKIFSKIVRSRRDSNRPAEQDVLQYLID 123616
123617 SKHRDGNSTTEQEVTGWIISMVFAGKHTSTNSTTWTGACLLTHDKFLTEALDEQKHMIQK 123796
123797 HGDHIDYNVLLDMDILHCCIKEALRMHPVAPIIYRKAQKSFVVRTREGDAYDIPEGHNLL 123976
123977 SPMIFNNRLPYIYKDPHMYDPDRFAPKREEDKVGGMFSYTSFGGGRHICIGEAYAYMQIK 124156
124157 VIWSHLLRNFELKLESPFPKTNWSKILLEPWGKVMVSYKRRRL 124285

>AP003866.1a $F CYP51H9 chr 7 clone OJ1092_A07 53% to 51A2
50920 MDMAAAAAVWFSAIAAVLLAASTIAVVVVAKMTGKRNGGAAAAAAAAAEAELPL
51082 PPVVSGVSLIIPVITRGPMAVADELYVKLGSVFT (0)
      GGFYSRPE 51261
51262 SEVHQGGTYRMTVPMFGRGVMYDVDVATRSEQIAVCFEALRPTKLRSSTVTMVRETE 51432 (0)
52114 EYFAKWGEQGTVDLKRELDLLILTIASRVLLGKEVRETMFADVVASFHELMDNSMHLI 52299
52300 SLCFPNLPIPRHRRRDTASARLKELFSRAIQLRRGSGRAEDDVLQRFLESRYRDGRAMSD 52479
52480 NEITGMLIALVVAGQHMSSSASTWTGAFLLRDPKHLAAAVDEQRRLIGDDRVDYDALT 52653
52654 TGMSTLHRCIKEALRMHPPAPALVRTVRRGFAVWTREGKEYRMPAGHSVVSYAAFNHRLG 52833
52834 YVYRDPDEYDPERFGPERKEDRVAGKFSFTAFGGGRHACLGEHYAFLKMKVIWSYLLRNF 53013
53014 ELELVSPFPEVELNNIMLGPRGEVMVRYKRRKLTST* 53124

>AK107185.1 CYP51G3 (japonica cultivar-group) cDNA clone AC135914.2 genomic seq 
    MDLTTGAIWLFLAQLFVAATMLSKIATRERTRTTGTKFSRPPPPPLARGAPLVGVLPSLLANGPVEFIRH 182
183 HYEKMGSVFTVSLLQQKVTFLVGSEASSHFYKGLDSEISQDEVSQFTIPTFGPGVAFDVD 362
363 YATRHEQFRFFGDIMKPAKLRTYVDLMVAEVE (0)
    GYFARWGQSGTVNMKQEFEQLVTLIASR 542
543 CLLGEEVRDKMFDEVSTLLRELNDGMRLVTILFPRLPIPAHRRRDRARARLGEIFSDIVR 722
723 SRRGSSGGGGGGGGARHDDMLQCLIDARYKDGRATTETEVAGMLVAALFAGQHTSSSTST 902
903 WAGARLLTNPDHLRAAVEEQARLLRRHGGDRVDHAALAAMDTLQRCVKETLRLHPPALML 1082
1083LRHARRSFVVRGGSGEREYEVPEGHTVASPLLLHNALPRVYRDPGEFDPGRFGAGRE 1253
1254EGAGGLAYTAFGGGRHACVGEAFAYMQIKVIWSHLLRNFELQLVSPFPETDWTVVMPGPK 1433
1434GKVMVTYNRRKLT* 1475

>aaaa01005681.1b $PI CYP51G4P (indica cultivar-group) ortholog of AP003866.1b
4595 VRFLHRKVTFLVGPEESSHFFTGLDAEISQDEVSRFIIPTFGS*VAFDA 4741
5197 GYATQ*EQFRFFGDTMKPTKLRSYVSHMVYEVE 5295
6670 VVTPIATRCLFGEVRSKMLGEVSTLLRELNDSMRLITIVFPYLPIPAHRRRDSARARLGE 6849
6850 IFVEIVRSRRSSPGGGGAGHDDMLQCLIDARYKDGRATTEG
6975 AEVAGMLVSALLAGQYTSSSTSTWTG 7052 
7055 ARLLTHPEHLRAAVREQEELVLVRHRHGGDVVDHDALQRMGHLHRCVKETLRLHPPSLML 7234
7235 LRHARRSFVVRARGSGDAEYEVPAGHTVAS 7324
     PMVIHNALPHVY 7359
7360 EDAGSFDPGRFGPAREEYRAYAADHAYTVFGGGRHACVGE 7479 frameshift
7482 VIKVIWSHLLRNFELELMLPFPETDWNDVMPGPKGKVMVLPPSHNKIISVTVGFSVQL 7655

>AP003909.1a $F CYP71C12 chromosome 8 clone OJ1300_E01 55% to 71C4
orth aaaa01000238.1f
50394 MAQMLDGLRHDEQASLHAPQEASTMPTMSCSD
50298 LLLAMMCPLILLLIIFRCYAYATRSGGMLSRVPSPPGRLPVIGHMH 50161
50160 LISSLPHKSLRDLATKHGPDLMLLHLGAVPTLVVSSARTAQAILRTHDRVFASRPYNTIA 49981
49980 DILLYGATDVAFSPYGDYWRQIKKIVTMNLLTIKKVHSYGQTRQQEVRLVMAKIVEEAAT 49801
49800 HMAIDLTELLSCYSNNMVCHAVSGKFFREEGRNQLFKELIEINSSLLGGFNLEDYFPSLA 49621
49620 RLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLSIQQEY 49441
49440 GLTKDNIKANLVVMFEAGTDTSYIELEYAMAELIQKPQLMAKLQAEVRGVVPKGQEIVTE 49261
49260 EQLGRMPYLKAVIKETLRLHPAAPLLVPHVSMVDCNVEGYTIPSGTRVIVNAWAIARDPS 49081
49080 YWENAEEFMPERFLSNTMAGYNGNNFNFLPFGTGRRICPGMNFAIAAIEVMLASLVY 48910
48909 RFNWKLPIDQAANGGIDMTETFGITIHLKEKLLLVPHLP* 48790

>AP003909.1b $P CYP71C13P chromosome 8 clone OJ1300_E01, 4 in frame stops pseudogene 
orth aaaa01000238.1g note this seq is out of order in this gene cluster
54948 MAQMLGALLLFQDSLMSTMTRMSY
54876 SLLLPILCPLILLLLFRCYAYATRSGGMLDKLPSPPGRLPLIGHM 54742
54741 HLIGFFPHMSLRDLATDLMLLHLGTVPTLVVSSSRMAQVILRTHDRVFASR*QSAI 54574
54573 TDILF*GATDVAFSPYGDYWRQIKKIVTTNLLTIKKIRSYSQTRQQEVRLVMAKIVEEAA 54394
54393 THMA IDLTELLSCYSNNMVCHAVSGMFFCEEGRNQLFKELI*INSSLLGGFNIEDYFPSL 54214
54213 ARLPVRRL LYAKAYDVKKRWDQLLDKLIDDHSSKHRSSLLDNNDVESDFIDVLLSIQQE 54037
54036 YGLTKDNIKANLAIMFEAGTDTSFIELEYSMAELM*KPQMIAKLQAEVRGVVSKGQDIVT 53857
53856 EEHLGRMPYLKAVIKETLRLHPAAPLLAPHVSVVDCNVEGYTIPSGTRVIVNAWAIARDP 53677
53676 SYWENAEEFMPERFLSNTMADYNGNNFNFLPFRTGRRICPGINFAITTIEIMLASLV 53506
53505 YRFDWKLFTSRIDMTETFGATIHLKEKLFLVPHLPQDN* 53389

>aaaa01000238.1e $FI CYP71C14 (indica cultivar-group) AP003909.1c 99%
      MAVMLVPIPLLLLHQHHNHEHEH
40499 PSPVAPQPTMASYYTLLLALLCPLLLLLIKLCRAKTRDDELFDKLPSPPGRLPVIGHL 40326
40325 HLIGSLPYVSFRELAIKHGPDLMLLRLGTVPTLVVSSARAAQAILRTNDHVFASRTYSAV 40146
40145 TDILFYGSSDVAFSPYGEYWRQVKKIATTHLLTNKKVRSYSRARQQEVRLVMARINEAAV 39966
39965 ARTTVDLSELLNWFTNDIVCHAVSGKFFREEGRNQMFWELIQANSLLLSGFNLEDYFPNL 39786
39785 ARVTTVRRLLCAKAHNVNKRWDQLLDKLIDDHATKRSSSVLDLDNEESDFIDVLLSIQHE 39606
39605 YGLTRDNVKAILVIMFEGGTDTAYIELEYAMAELIRKPQLMAKLQAEVRSVVPRGQEIVT 39426
39425 EEQLGRMPYLKAVIKETLRLHLAGPLLVPHLSIAECDIEGYTIPSGTRVFVNAWALSRDP 39246
39245 SFWENAEEFIPERFLNSIAPDYNGNNFHFLPFGSGRRICPGINFAIATIEIMLANLVYRF 39066
39065 DWEIPADQAAKGGIDMTEAFGLTVHRKEKLLLVPRLTQD* 38946

>AP003909.1d $F CYP71C15 chromosome 8 clone OJ1300_E01 
68223 MELNNTEPLTASRAQAAAVFLLLPVALLLLLLRFARATTMAGDRNSELLLSKLPS 68387
68388 PPLRLPVIGHMHLVGSLPHVSLRDLAAKHGRDGLMLVHLGSVPTLVVSSPRAAEAVLRTH 68567
68568 DLAFASRPRAMVPDIITYGATDSCYGPYGDHFRKVRKAVTVHLLNSHKVQAYRPAREEEV 68747
68748 RLVIAKLRGAAAMAGAPVDMTELLHSFANDLICRAVSGKFFREEGRNKLFRELIDTNASL 68927
68928 LGGFNLEDYFPSLARTKLLSKVICVRAMRVRRRWDQLLDKLIDDHATRLVRRHDHDQQQD 69107
69108 SDFIDILLYHQEEYGFTRDNIKAILV 69185 (0)
69331 DMFEAGTDTSYLVLESAMVELMRKPHLLAKLKDEVRRVIPKGQEVVNEDNIVDMVYLKAV 69510
69511 IKETLRLHPPAPLYIPHLSREDCSISGYMIPTGIRVFVNAWALGRDAKFWDMPDEFLPER 69690
69691 FMDSNIDFKGHDFHYLPFGSGRRMCPGIHSATVTLEIMLANLMYCFNWKLPAGVKE 69858
69859 EDIDMTEVFGLTVHRKEKLFLVPQAA* 69939

>AP003909.1e $F CYP71C16 chromosome 8 clone OJ1300_E01 
78935 MELILQLEAKTAAQAVVTVFFFFLLPLALLFYFARAAISSRDSKTRELILSKLPSPPFK 79111
79112 LPVIGHMHLIGPLPYVSLRDLAAKHGRDGLMLVRLGSVPTLVVSSPRAAEAVLRTHDLAF 79291
79292 ASRPRSMVTDIIMYGALDSCFAPYSDHFRSVKKVVTVHLLNSKRVQAYRHVREEEVRLVM 79471
79472 ARLRGAAAAAAAVDLSQTLQFFANDLICRAVSGKFLCEQGRNKVFRDLMEANSNLLGGFN 79651
79652 LEAYFPGLARMPLISKLICARAIRIRRRWDQLLDMLIDDHVASARDRAKNDDDDFIHVL 79828
79829 LSLQDEYGFTRDHIKAISI 79885 (0)
80359 DMFEAGTDTSHLVLEYAMVELTRKPHILTKLQDEVRRITPKGQHMVTEDDIVGMVYLKAV 80538
80539 IKETLRLHAPGGFTIPHLAREDCNVDGYMIPAGTRVLINLWALSRDANYWDKPDEFLPER 80718
80719 FMDGSNKNTDFKGQDFQFLPFGSGRRMCPGIHSGKVTLEIMLANLVYCFNWKLPSGMKK 80895
80896 EDIDMTDVFGLAIHRKEKLFLVPQIANY* 80982

>AP003909.1f $F CYP71C17 chromosome 8 clone OJ1300_E01 
63826 MVVQLMLFFHDKFMAPMAEEPLPFVLIMIII
63733 LLLLVLLHYYLSASTRRSSAASKSNDDVLPPSPPRLPVIGHMHLVGSNPHV 63581
63580 SLRDLAEKHAADGFMLLQLGQVRNLVVSSPRAAEAVLRAHDHVFASRPRSAIADILAYGS 63401
63400 SNISFSPYGDYWRKARKLVAAHLLSPKKVQSLRRGREEEVGIAVAKLHEAAAAGAAVDMR 63221
63220 ELLGSFTNDVLCRAVCGKSSFRREGRNKLFMELAAGNADQYAGFNLEDYFPSLAKVDLLR 63041
63040 RVVSADTKKLKEKWDSVLGDIVSEHEKKSSLRRDDQVQMDDDRDDDQEEQESDFVDILLD 62861
62860 RQQEYNLTRHNIHAILM 62810 (0)
62626 DMFAAGTDTSYIALEFAMSELIRKPHLMTKLQDEVRKNTTTQMVSEDDLNNMPYLKAV 62453
62452 VKETLRLHPPVPLLLPRLSMAQCNANGYTIPANTRVIINVWALGRDAKCWENSEEFMPER 62273
62272 FMDSGDTIDNVDFKGTDFQFLPFGAGRRICPGMNFGMASVELMLSNLMYCFDWELPVGMD 62093
62092 KDDVDMTDQFALTMARKEKLYLIPRSHVIKIT* 61994

>AP004232.1 $F CYP71C18 chromosome 1 clone OSJNBa0051H17 like CYP71C4
56483 MEQAAGLVYQLFQNEMFPWILALFPFLLLALHYLATNHRTPTTCKETRNHLSPPSP 56650
56651 PRLPIIGHLHLIGDLPHVSLRELAHRYGPNLMLLHLGQVQNLVVSSPHAAEAVLR 56815
56816 THDHVFASRPHSLIGDILLYGPSDVGLSPYGEQWRRSRRIVTTHLLTNKKVRSYHVAREE 56995
56996 E 56998 (0)
57929 VHKVMTKVHELSTKGMGVDMFELFSTYSNDLICRLVSGKNFQGDKGRNKMFRQLFKANY 58105
58106 VLLAGFNLEDYYPGLARLKAVSWVMCAKARNTRKLWDELLDEIINDRMSKQPCEHDRGND 58285
58286 DQDEMDFVDVLLLQERGITRDHLKAILV 58369 (0)
58462 DMFQAGTETTSVVLVFAMAELMQKPHLMAKLQAELRTNIPK*GRELITECDQTNMTYLKA 58641
58642 VIKETLRLHPPSPLLVPHLAMADCDIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLPE 58821
58822 RFVDGGSAANVDFIGTDFQFLPFGAX 58896 
58899 RRICPGINFASASMEIILANLLYHFDWDVSAEAAIDKDGIDMAEAFGLSVQLKEKLLLVP 59078
59079 VEYKGSVQDSAVIL* 59123

>AP004233.1 $F CYP71C19 chromosome 1 clone OSJNBa0065J17 50% to CYP71C4
21862 MEQAAGLVYQLFQHEMFPWTFSVLALFPFLLLVLHYLATNHRTPTTCKETKNHHPP 
21694 PPSPPRLPIIGHLHLIGGLLHVSLRELAHRYGPDLMLLHLGQVPNLIVSSPRAAEAVLR 21518
21517 THDLVFASRPYSLIADILLYGPSDVGLSPYGE*WRRRIITTHLLTNKKVRSYRVAREE 21344
21343 E 21335 (0)
      VHKVMAKVHELSTKGMAVDMTELFSTFSNDLICRLVSGKNFQGEGRNKLFRQLFKAN
      SVLLAGFNLKDYYPGLARLKAVSMVMCAKARNTRKLWDELLDEIIDERMS
      KQQCEHDEGNDQDEMNFVNVLLLQEQGITREHLKAIL (0)
20004 DMYQAGTETSSVVLVFAMAELMQKPHLMAKLQAELRTTIPKQGHELITERDLTDMTYLKA 19825
19824 VIKETLRLHPPTPLLLPHLAMADCNIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLPE 19645
19644 RFVDDGSAANVDFIGTDFQFLPFGAGRRICPGINFASASMEIILANLLYHFDWDVSAEAA 19465
19464 IDKDGIDMAEAFGLSVQLKEKLLLVPVDYKDGMQDSAVILL* 19339

>AP004757.1a $F CYP71C20 52% to AF321858 Lolium rigidum 70% to AP003909
MAQMLAAFLLDGLISHEHGHESLGAPPQAGTMAWYSLVLMTS
79980 LLFPLLVLLVMRCYVTRSGAKLLDKLPSVPGRLPVIGHLHLIGSLPHISLRDLATKH 79810
79809 SPDMMLLHLGAVPTLVVSSSRVAQSILHTHDDIFASRPYSPIANILFYGATDVGFSPYNE 79630
79629 YWRQIKKITTTHLLTMKKVRSYVSARQREVRIVMARITEAASKHVVVDLTEMLSCYSNN 79453
79452 IVCHAVCGKFSLKEGWNQLLRELVKVNTSLLGGFNIEDYFPSFTRLAAVRRLLLSCAKA 79276
79275 HNINKRWDQLLEKLIDDHTTKHIRSSSMLNHYDEEAGFIDVLLSIQHEYGLTK 79117
79116 DNIKANLAAMLMAGMDTSFIELEYAMAELMQKPHVMGKLQAEVRRVMPKGQDIVTEEQLG 78937
78936 CMPYLKAVIKETLRLHPPAPLLMPHLSISDCNINGYTIPSGTRVIVNVWALARDSN 78769
78768 YWENADEFIPERFIVNTLGDYNGNNFHFLPFGSGRRICPGINFAIATIEIMLANLV 78601
78600 YRFDWELPADQAAKGGIDMTETFGVAVHRKEKLLLIPHLHLR* 78472

>aaaa01002989.1 $FI CYP71C21 (indica cultivar-group) 91% to AP004233.1 
6020 MEQAAGLVYQLFQQEMFPWTFSVLALFPFLLL frameshift
     SLHYLATNNRTPTTCKETKNHHPPPPSPPRLPIIGHLHLIGDLLHVSLRELA 5770
5769 HRYGPDLMLLHLGQVP (?)
5107 NLIVSSPRAAEAVLRTHDLVFVSRPYSLIADILLYGPSDIGLSPYGEQWRQSRRIVTTHL 4928
4927 LTNKKVRSYRVAREEE 4871 (0?)
4088 VHKVMAKVHELSTKGMAVDMTELFSTFSNDLICRLVSGKNFQGDDGRNKLFRQLFKANS 3909
3908 VLLAGFNLEDYYPSLARLKAVSRVMCAKARKTRKLWDELLDKIIDDRMSKQQCEHDRGND 3729
3728 DQDEMDFVDVLLLQERGITREHLKAIL 3648 (0?)
3552 DMFQAGTETTSVVLVFAMAELMHKPHLMAKLQAELRTNISKQGQELLTECDLTNMTYLNA 3373
3372 VIKETLRLHPPTPLLLPHLAMADCDIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLSE 3193
3192 RFVDGGSAANVDLTGTDFQFLPFGAGRRICPGINFASASMEIILANLLYHFDWDVPAEAA 3013
3012 IDKAGIDMAEAFGLSVQLEEKLLLVPIEYKDSM 2914

>AP003909.1g $P CYP2C22P chromosome 8 clone OJ1300_E01 lone pseudogene fragment
identical to Duplicated end of exon 1 on aaaa01000238.1a
61469 EQESDFVDILLDHQQEYNLTRHNIHAILM 61383

>AP004757.1b $P CYP71C23P chr 6 Pseudogene fragment last exon similar to AP003909
103765 FAIATIEIMLANLVYRFDWEILVDQAAKGGIDMTEAFGLAVHRKEKLLLVSWLPQD* 103595

>AC092559.2 $F CYP71E4 chromosome 3 clone OSJNBb0096M04, 45% to 71B37
same as AC096688.3 chromosome 3
96529 MATLLSKLLALPQQWQLLLLLLLLPIASLLLVIGRNTGGRRRRRHLR
96388 LPPGPARLPVLGNLLQLGALPHRSLRDLARRHGPVMMLRLGAVPAVVVSSPEAAQEVLR 96212
96211 THDADCCSRPSSPGPMRLSYGYKDVAFAPYDAYGRAARRLFVAELFSAPRVQAAWRARQDQ 96017 (0)
94678 VEKLIGKLTRPEPEPVELNDHIFALTDGIIGAVAFGSIYGTERFAGGGRKRFHHLLDDVMDMLASFSAEDFFPNA 
94454
94453 AAARLFDHLTGLVAHRERVFQQLDAFFEMVIEQHLDSDSSNAGGGGGNLVGALIGL 94286
94285 WKQGKQYGDRRFTRENVKAIIF 94220 (0)
94119 DAFIGGIGTSSVTILWAMAELMRSPRVMRKVQAEIRATVGDRDGGGMVQPDDLPRLAY 93946
93945 LKMVVKETLRLHPPATLLMPRETMRDVRIGGYEVAARTRVMVNAWAIGRDAARWEEAEVF 93766
93765 DPDRFEAKRVEFNGGHFELLPFGSGRRICPGIAMGAANVEFTLANLLHCFDWALPVGMAP 93586
93585 EELSMEESGGLVLHRKAPLVLVPTRYIQL* 93496 

>AL731888.1 CYP71E5 chr 12 
31348 MAISLITSLLFSLPQQWQPVVLTGLLPVIVSLVLLARKGRLKMPPGPEQVPLLGNLHQLA 31169
31168 GPQPHRALRDLARVHGPVMRLRLGKASAVVLTSAEAAWEALRGHDLDCCTRPVSAGTRRV 30989
30988 TYGMKNVAFAPYGAYWREVRKLLMVELLSARRVKAAWYARHEQ 30860
30546 VEKLLSTLRRAEGKPVALDEHILSLSDGIIGTVAFGNIYGSDKFSQNKNFQHALDDV 30376
30375 MEMLSGEGSSAEDLQLPAAVGRLVDRLTGFAARRERIFRQLDSFFEMVIEQHLDPNRAPP 30196
30195 ENGGDLVDVLIGHWKKNEPRGTFSFTKDNVKAIIF 30091
29601 STFVAGIDTNAATILWAMSELARKPRVLKKVQAEIRAAVGVNGRVQPDDITKLSYLRKVV 29422
29421 KETLRLHPPTPLLLPRETMRHIQISGYDVPAKTRIYVNAWAIGRDPASWPDEPEEFNPER 29242
29241 FEANEIDFKGEHPELMPFGTGRRICPGMAMAMANVEFTLANLLFAFQWSLPEGTTPDNVC 29062
29061 LEEEGRLVCHRKTPLVLVPTVYRHGLE 28981

>AC084319.5a CYP71E6 chr 3 Genbank translation is wrong at N-terminal
2204 MAASLLLELLPQQWQLSITSLIL
2273 LAVSVVLIFWSRRRRNPSSRLKLPPGPTRLPIIGNLHQIGRLPHRSLEALAGWHG 2437 (fs)
2437 LGTVSVVVLSSPKAAREALKVHDPECCSRSPS 2532
2533 AGPRMLSYGYKDVAFSPYSNYVRNMRKLFVVELLSMRRVQAA 2658
8170 VMLPDYYCCM 8199
8599 VEKLIEKLTRNGRNAVAINEHIFSTVDGIIGTFALGETYAAEEFKDISETMDLLSSSSAE 8778
8779 DFFPGSVAGRLVDRLTGLAARREAIFRKLDRFFERIVDQHAAADDDGPAAARRKADDKGS 8958
8959 AGSDLVHELIDLWKMEGNTKQGFTKDHVKAMLL 9057
9159 DTFVGGITTTSVTLHWAMSELIRNPRVMKKAQDEIRAVVGEKERVQHHDMPKLKYLKMVV 9338
9339 KETFRLHPPATLLVPRETTRHFKVGGYDIPEKTKVIVNA*AIGRDPNIWKDPEEFIPERF 9518
9519 EEMDIDFNGAHFELVPFGSGRRICPGLAMGVANIEFILASMLFCFDWELPHGVRKEDIDM 9698
9699 EEAGKLTFHKKIPLLLVPTPNKAPN* 9776

>AP002968 $F CYP71K1 40% to 71B24 complement(1875..2513,2584..3501)
MAELPLYLLLLALLVAVPFLCLTRWSLRHGGGGGGRLPPSPWAL
PVIGHLHHVAGALPHRAMRDLARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAF
ATRPITPTGKVLMADSVGVVFAPYGDGWRTLRRICTLELLSARRVRSFRAVREEEVGR
LLRAVAAAAAVAALTTPGATAAVNLSERISAYVADSAVRAVIGSRFKNRAAFLRMLER
RMKLLPAQCLPDLFPSSRAAMLVSRMPRRMKRERQEMMDFIDDIFQEHHESRAAAGAE
EDLLDVLLRIQSQDKTNPALTNDNIKTVIIDMFVASSETAATSLQWTMSELMRNPRVM
RKAQDEVRRALAIAGQDGVTEESLRDLPYLHLVIKESLRLHPPVTMLLPRECRETCRV
MGFDVPEGVMVLVNAWAIGRDPAHWDSPEEFAPERFEGVGAADFKGTDFEYIPFGAGR
RMCPGMAFGLANMELALAALLYHFDWELPGGMLPGELDMTEALGLTTRRCSDLLLVPA
LRVPLRDHER

>aaaa01009177.1a $P CYP71K2P (indica cultivar-group) AP002968 $F 97%
309 LYLLLLALLVAVPFLCLTRSSRRHGCGGGSRLPPSPWALPVIGHLHHVAGALPHRAMRDL 488
489 ARRHGPLMLLRLCELRVVVASTAEAAREVTKTHDLAFATRPITPTGKVLMADSVGVVFAP 668
669 YGDGWRTLRRICTLELLSARRVRSFRAVREEEVGRLLRAVAAAAAAAAAALTTPGATAAV 848
849 NLSERISAYVADSAVRAVIGSR 914

>AP003990.1h $F CYP71K3 chromosome 2 clone OJ1073_F05 
66403 MATELTEYLLLLPLLVVPLLYLAASSSRRSGRLRLPPGPWALPVIGHLHHLALAGAPTHR 66582
66583 AMRDMARRHGPLMLLRFCELPVVVASSPDAAREIMRTHDVAFASRPIGPMLRLVFQGAEG 66762
66763 VIFAPYGDGWRQLRKICTVELLSHRRVHSFRPVRADELGRLLRAVADQAASSSS 66924
66925 SPVNLTGMISAFVADSTVRAIIGSRSRHRDTFLRLVEDGLKIMPGMSLPDLFPSSRLAML 67104
67105 LSRVPAKIERRRRGMMGFIDTIIQEHQESRAAAEDEDLLDVLLRLQKDMDSQYPLTTMN 67281
67282 IKSILI 67299 (0)
67380 DMFGAGSETSATTLQWAMAELMRNPAVMRRAQDEVRRELAVAGNDRVTEDTLPSLHYL 67553
67554 RLVIKETLRLHPPAPLLLPRECGGACKVFGYDVPAGTMVLVNAWAIGRDAAAWGAAAEEF 67733
67734 SPERFERCERDFRGADFELIPFGAGRRICPGMAFGLAHVELALAALLFHFDWRLPGGMA 67910
67911 AGEMDMTEAAGITVRRRSDLLVFAVPRVPVPAQ* 68012

>AP003990.1i $F CYP71K4 chromosome 2 clone OJ1073_F05 
68586 MPLVVLLLATIPLLFFTIKRSAQRRGGGGGGEGRLPPGPWALPVIGHLHHLAGDLPHRA 68762
68763 LSALARRHGALMLLRLGEVQAVVASSPDAARDIMRTHDAAFASRPLSPMQQLAYGRDAEG 68942
68943 VIFAPYGDGWRHLRKICTAELLSARRVQSFRPVREAELGRLLRSVAEATSSSSSA 69107
69108 SLVNLTELISAFVADSTVRAIIGSRFEHRDAYLRMLQDGLKIVPGMTLPDLFPSSRLALF 69287
69288 LSRVPGRIEHHRQGMQRFIDAIIVEHQEKRAAAAANDDDDEDEDFLDVLLKLQKEMGSQH 69467
69468 PLTTANIKTVML (0) 
      DMFGAGSESSATVLQWT 69647
69648 MAELMRNPRVMQKAQDEVRRALAGHDKVTEPNLTNLPYLRLVIKETLRLHPPAPLLLP 69821
69822 RKCGSTCKILGFDVPEGVMVIVNAWAIGRDLTYWDKPEEFVPERFEHNGRDFKGMDFEF 69998
69999 IPFGAGRRICPGITFGMAHVELVLSALLYHFDWELPQGMAAKDLDMTEDFGVTTQRRSNL 70178
70179 LVRPIHRVSVPVE* 70220

>AP003990.1j $F CYP71K5 chromosome 2 clone OJ1073_F05 
70828 MAGELAFYLLLVGLVAVPLLILLGSERRTAARTRLPPGPWALPVVGHLHHLAGGLPPHRA 71007
71008 MRDLARRHGPLMLLRLGEVEAVVASSPDAAREIMRTHDVAFASRPVGPMSRLWFQGADGL 71187
71188 VFAPYGEAWRRLRRVCTQELLSHRRVQSFRPVREDELGRLLRAVDAAAAAGT 71343
71344 AVNLTAMMSTYVADSTVRAIIGSRRLKDRDAFLRMLDELFTIMPGMSLPDLFPSSRLAML 71523
71524 VSRAPGRIMRYRRRMRRIMDSIIHEHQERRAAADAAGDDDDDDDEDLVDVLLRLQKEVGA 71703
71704 QYPLTTENIKTVMM 71745 (0)
71837 DIFGAASETSSTTLEWVMAELMRSPSAMRKAQDEVRRALAAGAAGHDTVTEDILPNLSYL 72016
72017 KLVVKETLRLHPPAPLLAPRRCDSPREVLVLGHDVPAGATVLVNAWAIGRDTAAWGGAA 72193
72194 EEFSPERFERCERDFRGADFELIPFGAGRRMCPGMAFGLVHVELALAALLFHFDWSLPG 72370
72371 GMAADELDMAESSGLTTRRRLPLLVVARPHAALPTKYCN* 72490

>AP003523.1c $F CYP71K6 chromosome 6 clone P0416A11 six different genes
73% to AP003523.1d 64% to AP003523.1f
128476 MAAELVHLLRYLFSVPM
128425 LFFIVPLLFLVCSPRRRRGRGSCRLPPSPWALPVVGHLHHLAGALQHRAMRDIARRHGPL 128246
128245 VLLRLGRLPVVVASSADAAREVMRTSDVAFAARPVNRMIRVVFPEGSEGVIFAPYGETWR 128066
128065 QLRKICTAELLSARRVHSFRSVREEEAGRMLRAVASAAAQTTVNLSELMSA 127913
127912 YAADSSARAMIGRRLKDRDTFLAMVERGIKLFGEQSLPNLYPSSRLAVLLSTMPRRMKRH 127733
127732 RERMTAYLDAIIEEHQESRASREDDEDLLDVLLRM 127628 
       QREGDLEVSRESIRSTIG 
126439 DMFIGGSEPPAITLQWIMAELIRNPEVMQKVQDEVRQLLVGQHRVTEESLSKLGY 126275
126274 MNLVIKETLRLHPPGPRLLLRVCRTTCQVLGFDVPKGTMVLVNMWAINRDPKYWSQAEEF 126095
126094 IPERFENAGINFKGTNFEYMPFGAGRRMCPGMAFGLATLELALASLLYHFDWKLPDGV 125921
125920 EIDMKEQSGVTTRRVHDLMLVPIIRVPLPV* 125828

>aaaa01001026.1a $PI CYP71K7P (indica cultivar-group) 3 defects, probable pseudogene
MAEVVQLHHLILLLPLFILPSSSSVR 
3368 RRRGACGRLPPSPWALPVIGHLHHLAGALPHRAMRDIARRHGPLVLLRLGELPVVVIASS 3189
3188 ADAARNVMKTHDLAFATRPITHMMRLVFPEGSEGIIFSPYGETWRQLRKICTVELLSARR 3009
3008 VNSFRSVREEEVNRLLRAVAAAAASATSPAKMVNLSELMSAYAADSSVRAMIGRRCKDRD 2829
2828 KFLEMLERGIKLFVTPSLPDLYPSSRLAMVVSRMPRRMRRHREEVFAFLDAIIAEHQENR 2649
2648 ASGEDEEDLLDVLLRIQREGCMEST 2580
2572 PLLSTESIRTTIG 
1662 DLFNGGSETTATTLQWIMAELMRNPRVMQKAQDEVQRVFIGQHKVTEENLSNLSYMYLVI 1483
1482 KEALRLHPPGPPLLPRECRTTCQVLGFDVPKGTIVLVNMWAINRDPKYWDQSKEFIPERF 1303
1302 EHVDINFKGMNFEYMPFGAGRRMCPGMAFGLVNLELVLASLLYHFDWKLSDKIKVGDLDM 1123
1122 TEERGATTRRLHDLLLVPVIRVPLPLDSRS* 1030

>AP003523.1e $F CYP71K8 chromosome 6 clone P0416A11 six different genes AQ331067 
151229 MAGFPVYLLFLAALIILPMANLIRSARHRRLAGARRPPPGPWALPVIGHLHHLLAGKLPH 151408
151409 HHKLRDLAARHGPLMLLRFGELPVVVASSADAAREIAKAHDLAFATRPVTRTARLTLPEG 151588
151589 GEGVIFAPYGDGWRQLRKICTLELLSARRVLSFRAVREQEVRCLLLAVASPSPEGTTAT 151765
151766 ASVVNLSRMISSCVADSSVRAIIGSGRFKDRETFLRLMERGIKLFSCPSLPDLFPSSR 151939
151940 LAMLVSRVPGRMRRQRKEMMEFMETIIEEHQAARQASMELEKEDLVDVLLRVQRDGSLQF 152119
152120 SLTTDNIKAAIA 152155 (0)
166133 DLFIGGSETAATTLQWAMSELLNNPKVMQKAQDEIRQVLYGQERITEETISSLHYLHL 166306
166307 VIKETLRLHPPTPLLLPRECREPCQILGFDVSKGAMVLINAWSIGRDPSNWHAPEKFMPE 166486
166487 RFEQNNIDFKETSFEYIPFGAGRRICPGMTFRLANIELLLASLLYHFDWELPYGMQAGD 166663
166664 LDMTETLAVTARRKADLLVVPVVRVPIVG* 166753

>AP003523.1f $F CYP71K9 chromosome 6 clone P0416A11 six different genes
168538 MAAAASSVLAYLLVVALLAIVPLVYFGWVARRRGEGGRLPPSPWGLPVIGHLHHLAGALPHHAMRDLA 168741
168742 RRHGPLMLLRLGELPVVVASSAEAAREVMRTRDIEFATRPMSRMTRLVFPAGTEGIIFAP 168921
168922 YGDEWRELRKVCTVELLSARRVQSFRAVREEEVGRLLRAVAATSSSPSPAQAAVNL 169089
169090 SALLSAYAADSAVHAIIGSRFKDRDKYLMLLERGLKLFARHTLPDLYPSSRLAMWLSRMP 169269
169270 RRMMQHRREAYAFTDAIIREHQENRAAGAGDGDGDDKEDLLDVLLRIQREGDLQFPLSTE 169449 
169450 RIKTTVG 169470 (0)
169893 DMFAGGSETAGTALQWIMAELIRNPRVMHKVQDEVRQTLAGRDRVTEDAISNLNYMHL 170066
170067 VIKEALRLHPPVPLLLPRECRNTCQVLGFDVPKGAMVLVNAWAISRDPQYWDEPEEFIPE 170246
170247 RFEDSNIDFKGTNFEYTPFGAGRRMCPGIAFGLANVELMLASLLYHFNWQLPDGMDTAD 170423
170424 LDMTEEMVVSARRLHDLLLVPVVHVPLPVASS* 170522

>AP003571.1h $F CYP71K10 chromosome 6 clone P0458E02 continuation of contig AP003523.1
145371 MAAFLVYVLVLVPLAVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGALPH 145201
145200 VAMRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPEG 145024
145023 GEGIIFAPYGDRWRELRKICTVELLSGRRVQSFRPVREEEAGRLLRAVAAASPG 144862
144861 QAVNLSELLSAHAADSSVRAIMGDRFRDRDAFLAMLERGLKLFAKPALPDLYPSSRLAM 144685
144684 LLSRMPRRMKQHHRDMVAFLDAIIQEHQENRSAAADDDNDLLDVLLRIQREGDLQFPLS 144508
144507 SESIKATIG 144481 (0)
144297 DMLVGGSETAATTLHWIMAELVRNPKVMQKAQDEVRRELIGHRKVTEDTLCRLNYMHM 144124
144123 VIKEALRLHPPGSLLLPRECRRTCQVLGYDIPKGATVFVNVSAIGRDPKYWDEAEEFIPE 143944
143943 RFEHSDVDFKGTHFEYTPFGAGRRMCPGMAFGLANVELTLASLLYHFNWELPSGIHAENL 143764
143763 DMTEEMRFTTRRLHDLVLIPVVHVPLPTI* 143674

>AC118346.1a $F CYP71K11 Gene 1, 94448-96200, 3 exons 97% identical to gene 2 (12 
94448 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSMRRRDGGSVRLPPSPWALPVIGHLHHLMGA 94627
94628 LPPHHAMRDIALRHGPLVRLRLGGLQVI 94711
94712 LASSVDAAREVMRTHDLAFATRPSTRVMQLVFPEGSQ (0)
      GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLL 95071
95072 RAVAAASPARRAVNLSELISAYSADSTMRALIGSRFKDRDRFLMLLERGVKLFATPSLPD 95251
95252 LYPSSRLAELISRRPRQMRRHRDEVYAFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQR 95431
95432 KGDFPLSTDNIKTTIG (0) 95479
95574 DLFNGGSETTATTLKWIMAELVRNPRVMQKAQDEVRRALGKHHKVTEEALKNLSYLHL 95747
95748 VIKEGLRLHPPGLPLLLRESRTTSQVLGFDVPQGTMILVNMWAISRDPMYWDQAEEFIPE 95927
95928 RFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFDWELPDGTELGNL 96107
96108 DMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 96200

>AC118346.1b $F CYP71K12 (japonica cultivar-group) chromosome 11 clone Ba0039F06, 
113634 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSIRRRDGGSVRLPPSPWALPVIGHLHHLMGA 113813
113814 LPPQHAMRNIALRHGPLVRLRLGGLQVI 113897
113898 LASSVDAAREVMRTHDLAFATRPSTRVMQLVFPEGSQ (0) 114008
114127 GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNL 114300
114301 SELISAYSADSTMRALIGSRFKDRDKFLMLLERGVKLFATPSLPDLYPSSRLAELISRRP 114480
114481 RQMRRHRDEVYEFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG (0) 114663
       DLFNGGSETTATTLKWIMAELIRNPRVM 114840
114841 QKAQDEVRQVLGKHHKVTEEALRNLSYLHLVIKEGLRLHPPGLPLLLRESRTTSQVLGFH 115020
115021 VPQGTMILVNMWAISRDPMYWDQAEEFIPERFEHVNIDYYGTDVKYMPFGVGRRICPGIA 115200
115201 FGLVNLELVLASLLYHFNWELPDETELGNLDMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 115383

>AC118346.1c Gene 3 $P CYP71K13P pseudogene 56% to AC118346.1 genes 1, 2 no ortholog
117756 DAAREVMRTHDLAFATRPSTRVMQLVFLEGSQ 117661
117553 GDRFTPYGDIWRNLRRSAPLAVSAKRVQFFRPIHQEEVCRLLQAVAVASPA 117395
117394 RGPPETLTSSFRPTWATLQCAP**GARLRDRDKSLMLLYRGVKPIRHARACQIFTQSIAL 117215
117214 ADLIIKSLSPMRRASYPMSNLLDIIFK 117134
117108 SDNHMDLTLVAFLLRFHKKGACPLSFCYIRKQFG*AF 116998

>AL713951.1 $F CYP71P1 chromosome 12 clone Monsanto- 39% to 83B1
AF088221 BI305808.1 49% to 76C6 mRNA
44616 MSLALLVLSAAYVLVALRRSRSSSSKPRRLPPSPPGWPVIGHLHLMSGMPHHALAELART 44437
44436 MRAPLFRMRLGSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCSDVTFAPAG 44257
44256 PYHRMARRVVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSECFLNLAND 44077
44076 VLCRVAFGRRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGLRRRLKKCL 43897
43896 ADLREACDVIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNLKALVL (0)
      DMFVAGTDTTFATLEWVMTELVRHPRILKKA 43537
43536 QEEVRRVVGDSGRVEESHLGELHYMRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPA 43357
43356 RTRVFINTFAMGRDPEIWDNPLEYSPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGY 43177
43176 TFALATVQVSLASLLYHFEWALPAGVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFK 42997
42996 GEELSEV* 42973

>AP003544.1 $P CYP71P2P chr 6 clone P0599C12 same as AP003686.1 8668-8037 pseudogene 
107880 GSMPAVVISKPNLARPALTTNDAVLASRQHLLNG*FLSF 107764 frameshift
107762 GCSDVTFAPAGPYHRM 107715 frameshift
107713 QMARGVEVSELLSAHHVAMYGVVRVKELQRLLAHLTKNTSSAKPIDLSECFLNLANDVLCRVAF 107521
107520 GRRFPRDEGDKLSAVLANAQDLL 107452 frameshift
107452 AGFTISDFFLELEPVASTVTGLCHRLKKCLADLCEACDVIVDVHISGNRQRIPSDREEDFVDVLLRVQ 107249

>AP004346.1a $F CYP71Q1 two genes and a pseudogene
22020 MADDFLSSQPQPW 22058
22059 PPLLQLSAAVLFFLLPLLYLLFLRGSNGEVRGRQGNSASAPSLPGPCRQLPVLGNLLQIG 22238
22239 SRPHRYFQAVSRRYGPVVQVQLGGVRTVVVHSPEAAEDVLRTNDVHCCSRPPSPG 22405 (2)
26427 SYNYLDVAFAPYSDYWREMRKLFVVELTSVSRVRSFAYARAAEVARLVDTL 26577
26578 AASPPGVPVDLSCALYQLLDGIIGTVAFGKGYGAAQWSTERAVFQDVLSELLLVLG 26745
26746 SFSFEDFFPSSALARWADALAGVERRRRRIFRQVDGFLDSVIDKHLEPERLSAGVQED 26919
26920 MVDALVKMWREQQDRPSGVLTREHIKAILM 27009 (0)
28586 NTFAGGIDTTAITAIWIMSEIMRNPRVMQKARAEVRNTVKNKPLVDEEDSQNLKYLEMIIKEN 28774
28775 FRLHPPGNLLVPRQTMQPCLIGGYNVPSGTRVFINIWAMGRGPMIWDNPEEFYPERFE 28948
28949 DRNMDFRGSNFELVPFGSGRRICPGVAMAVTSLELVVANLLYCFDWKLPKGMKEEDIDM 29125
29126 EEIGQISFISFRRKVELFIVPVKHEQYQLMGHIN* 29221

>AP004346.1b $F CYP71Q2 two genes and a pseudogene 48% to AC092559.2 75% to 
69192 MATELLASQLLPWQPLVQLLAAGLFLLPLVYLLFFKGDGNGG 69317
69318 VMDSASAPSPPGPPRQLPVLGNLLQIGSRPHRYFQAVARRYVPVVQVQLGSIRTVVVHS 69494
69495 PEAAKDVLRTNDLQCCSRPSSPG 69565 (2) 
72047 NYNYLDVAVSPYS 72083 (frameshift)
72085 YWREMRKLLVIELTSIRRVQSFAYARAAEVARLVDTLAASPAGVPVDLSSALYTF 72249
72250 SDGVIGTVAFGKVYGSAAWSSWEWGASFQEAMDETMQVLGSFSFEDFFPSSALARWADALTGA 72438
72421 AGRRRRVFHRIDGFFDAVIDKHLEPERLSAGVQEDMVDAMVMVWREQKDEAFGLTRDHIKAILL 72630 (0)
84351 DAFVGGIDTTAVTVTWIMSELMRNPRVMQKAQAEVHNIVKNKSKVCEEDIQNMKYLKM 84524
84525 IIKENFRLHPPGTLLIPRQTMKTCTIGGYSVPSETRIYVNVWAMGRDPNIWDNPEQFY 84698
84699 PERFEDKGIDFRGSHFELLPFGSGRRICPGIAMGVANVELVVANLLYCFNWQLPKGMKEE 84878
84879 DIDMDEIGQLAFRKNFLF* 84935

>AP004346.1c $P CYP71Q3 probable pseudogene 89% to AP004346.1b
92865 DAFAGGIDTTVVTTTWIMSELMRNPRVMQK 92954 (frameshift)
92956 AQAEVHNIVKNKSKVYEENIQNMKYLKMIIKENCRLHPPGTLLIPRHTMKTCTIGGYSV 93132
93133 PSKRRIYVNVWAMWRDPNIWDNLEQFYLERFEDKGIDFRGSHFELLT 93273 (insertion)
93561 FGSGQRICPGIAMGVANVELVVANLLYCFDWQLPKGMKEEDTDMDEIG*LAFRKKLPLFI 93740
93741 VPMKH* 93758

>AC087599.11 $P CYP71Q4P chromosome 10 clone OSJNBa0057L21, pseudogene fragment like 
16812 GGGGRWTETLEWIMAELTANTRVMAKLQDEISRAADGK 16925 24 aa deletion and frameshift
16931 PAPILVPRQSTATAVVQG*EILAKTSLFINVWAMGRYPAAWNSSEEFWPEQFLASREAVD 17110
17111 FQGNNYQLILFITDRRIFPDINFAVPVLETALVGLLHPTNELLGGG 17248
17249 GGLMWLQRSCSRARRPRSTAHRRHRSGTHPAAIAAAAAT* 17368

>AK062293 CYP71R1 2395 bp    mRNA    linear   PLN 24-JUL-2003
56 MAAVQLDSGLLVGFLFLATCLAVAIRSYLRSGGAAIPSPPALPVIGNLHQLGRGRHHRAL 235
 236 RELARRHGPLFQLRLGSVRALVVSSAPMAEAELRHQDHVFCGRPQQRTARGTLYGCRDVA 415
 416 FSPYGERWRRLRRVAVVRLLSARRVDSFRALREEEVASFVNRIRAASGGGVVNLTELIVG 595
 596 LTHAVVSRAAFGKKLGGVDPAKVRETIGELADLLETIAVSDMFPRLRWVDWATGLDARTK 775
 776 RTAAKLDEVLEMALRDHEQSRGDDDDGGGGDGEPRDLMDDLLSMANDGGGDRGHKLDRID 955
 956 VKGLILDMFIAGTDTIYKSIEWTMAELIKNPAEMAKVQAEVRHVAAAAH 1102
1103 GDEDEDTVAVVREEQLGKMTLLRAAMKEAMRLHPPVPLLIPREAIEDTVLHGHRVAAGTR 1282
1283 VMINAWAIGRDEAAWEGAAEFRPGRFAGGGAAAGVEYYGGGDFRFVPFGAGRRGCPGVAF 1462
1463 GTRLAELAVANMACWFEWELPDGQDVESFEVVESS 1567

>AP003575.1 $P CYP71R2P chromosome 6 clone P0528B02, similar to 71A24 one in frame 
54816 MAAVQLDSGLLIGFLFLATCLVVAVRSYLRSGGADGGRGGAA
54690 ITSPPALPVIGNLHQLGRGRHHRALRELARRHGPLFQLRLGSVRALVVSSASMAEAVLRH 54511
54510 QDHVFCGRPQQHTARGTLYGCRDVAFSPYGERWRRLRRVAVVHLLSARRVDSFRALREEE 54331
54330 VASFVNRIRAASGGGGGVVNLTELIVGLTHAVVSRAAFGKKLGGVEPAKVRETVGEL 54160
54159 ADLLGTIAVSDMFPRLRWVDWATGLDARTKRTAAKLDEVLEMVLRDHEPSRGDDDDDDGD 53980
53979 GEARDLMDDLLSMANGGDDHGYKLDRIDVKGLLIL 53875 (0)
      DMFAAGTDTVYKSIE*TMAELIKNPAEMAKVQAEVRHVVAAAHGGEGDEDAVVIVKEEQAS 53616 (fs)
53613 LGKMTLLRAAMKEAMRLHPPLPLLIPREAIQDTVLHGHRVAAGTRVMINAWAIGRDEAAW 53434
53433 EDAGEFRPGRFADGGDNAGVEYYGGGGDFRFMPFGAGRRGCPGMAFATRLAELVVANMAC 53254
53253 WFEWELPDGQDVQSFEPSRSSSREVCRLGSSSGKIGNHVYVVQTTRM* 53110

>aaaa01059584.1 CYP71R3 (indica cultivar-group) 59% to CYP71R1
596 VAAKTRVIINTWAIGRDSIIRENAEEFLPERFIDNGIDYNSKDFSFIPFGAGRRGCPGIAFATRLA 793
794 ELALANLMYHFDWELQEGQDLESFQLVSPSVIQTWGSS 907

>AL606614.1b $F CYP71S1 chromosome 4 clone OSJNBb0011N17 40% to 71A25
23233 MSMASLQAPEFLASCLLLATILFFKQLLAPSSKQRAASPSLPRPRGLPLIGNLHQVGALPHRSLAALAAR 23096
23095 HAAPLMLLRLGSVPTLVVSTADAARALFRDNDRALSGRPALYAATRLSYGQKSISFAPD 22919
22918 GAYWRAARRACMSELLGPPRVRGLRDAREREAAALVAAVAAAGASPVNLSDMVAATSSR 22742
22741 IVRRVAFGDGDGDESMDVKAVLNETQALLGGLWVADYVPWLRWVDTLSGKRWRLERRFRQ 22562
22561 LDALYERVIDDHLNKRKHASDEEDDLVDVLLRLHGDPAHRSTFGSRSHIKGILT 22400 (0)
22059 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVVAAGDKVREADLPELHYLR 21889
21888 LVIKETLRLHPAAPLLVPRETTEPFRTAHGVEIPARTRVVVNAMAIHTDPGVWGPDAERF 21709
21708 VPERHRDDADGCAQQHDGFALVPFGIGRRRCPGVHFAAAAVELLLANLLFCFDWRAP 21538
21537 PGREVDVEEENGLAVHKKNPLVLIATKSKRNTGGH* 21427

>AL606614.1a $F CYP71S2 chromosome 4 clone OSJNBb0011N17 90% to AL606614.1b
19270 MASLQAPEFLASCLLLLATILLFKQLLAPSSKKRAASPSLPRPKGLPLIGNLHQVGALPHRSLAAL 19073
19072 AARHAAPLMLLRLGSVPTLVVSTADAARALFRNNDRALSGRPALYAATRLSYGQKNISF 18896
18895 APDGAYWRAARRACMSALLGAPRVCELRDAREREAAALIAAVAAAGASPVNLSDMVAAT 18719
18718 SSRIVRRVAFGDGDGDESMDVKAVLDETQSLLGGLWVADYVPWLRWVDTLSGMRRRLERR 18539
18538 FRQLDAFYERVIDDHINKRKHASDEEDDLVDVLLRLHGDPAHRSMFGSRTHIKGILT (0)18368
17337 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVIAGGGGGDKDGAMVREADL 17149
17148 PELHYLRLVIKETLRLHPASPLVQRETTEPFRTAHGVEIPARTRVVINAMAIHTDPGVWG 16969
16968 PNAERFLPERHRAHDADGEQQHEHDGFALVPFGIGRRSCPGVHFAAAAAELLLANLLFCF 16789
16788 DWRALPGREVDVEEENGLAVRKKNPLVLIATKSKSNRDAH* 16666

>AP003434.1a $F CYP71T1 chromosome 1, PAC clone:P0452F10, complete 41% to 71A24 = 
34853 MELSSSLAAVLHSPLFLLAAL
34916 LLLPVFTLLSFSSAKKPGDGGGWRLPLPPSPRGVPFLGHLPLLGSLPHRKLRSMAEAHGP 35095
35096 VMLLWFGRVPTVVASSAASAQEAMRARDAAFASRARVRMAERLIYGRDMVFAPYGEFWR 35272
35273 QARRVSVLHLLSPRRIASFRGVREQEVAALLDRVRRRCGVRGGGETVNLSDLLMSYANGV 35452
35453 ISRAAFGDGAYGLDGDEGGEKLRELFANFEALLGTATVGEFVPWLAWVDKLMGLDAKAA 35629
35630 RISAELDGLLERVIADHRERRRLSQPDGGDGDGDGDENVDHRDFVDVLLDVSEVEEGAG
      AGEVLLFDTVAIKAIIL (0) 
36458 DMIAAATDTTFTTLEWAMAELINHPPVMRKLQCEIRAAVGVPGASGGAEVTEDHLGELR 36634
36635 LLRAVVKETLRLHAPVPLLVPRETVEDTELLGYRVPARTRVIINVWAIGRDAAAWGDRAE 36814
36815 EFVPERWLDGGGEEVEYAAQLGQDFRFVPFGAGRRGCPGAGFAAPSIELALTNLLYHFDW 36994
36995 ELPPHADGAAAATAARLDMGELFGLSMRMKTTLNLVAKPWSSDV* 37129

>AP003434.1b $F CYP71T2 chromosome 1, PAC clone:P0452F10, complete = AA754300
39698 MELSSLAALLHSPLLLAVLLLVFSWLIVSSTKKRPPPPCGDGGRRLP
39839 LPPSPPGVPLLGHLPLLGTLPHRKLRSMAEAHGPVMLLRLGRVPAVVASSAAAAEEVMRT 40018
40019 RDLAFASRPRVRMSERLFYGRDM AFAPYGEFWRQARRVTVLHLLSPRRVLSFRGVREQE 40195
40196 VAALLDRVRRRCGGGGETVNLSDLLMSYAHGVISRAAFGHGGAHGFDGDEGGEKLRKLFA 40375
40376 DFEGLLGTMTVGEFVPWLAWVDKLTGLDAKVARTSAAMDGLLERVIADHRERRRSRGQA 40552
40553 VGDGEADADHR DFVDVMLDVSEAEEGAGAGAGGVLFDTVAIKAVIL (0) 
42074 DMMAAGTDSSFTTTEWVMAELINHPRVMRKL 42169
42170 QDEIRAVVGTSSASAAAAATGGGQVTEDHLGELPFLRAVIKEMLRLHAPGPLLLPRETVE 42349
42350 DTELLGYRIPARTRVIINVWAIGRDAAAWGDSAEEFVPERWLDGGGGGGVEYAQQLGKDS 42529
42530 RFVPFGAGRRGCPGAGFAALSVELALANLLYHFDWELPPPAASGIMATTRLDMDELFGLS 42709
42710 VRLKADLNLVAKPWSPGAS* 42769

>AP003434.1c $F CYP71T3 AU163704.1 chromosome 1, PAC clone:P0452F10, complete 44% 
48011 MAVSLVVVVVV
48044 VIAIVVPLLYLVLLPAWKPARRDDGDGGMRRRLPPSPPWGLPLLGHLHLLGALPHRALRS 48223
48224 LAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRTRDLEFASRPRVAMAERLLYGGRDVAFA 48403
48404 PYGEYWRQTRRICVVHLLSARRVLSFRRVREEEAAALVARVRAAGGAVDLVEHLTAY 48574
48575 SNTVVSRAVFGDESARGLYGDVDRGRVLRKLFDDFVELLGQEPMGELLPWLGWVDALN 48748
48749 GMEVKVQRTFEALDGILEKVIDDHRRRRREVGRQMDDGGGGDHRDFVDVLLDVNETDMD 48925
48926 AGVQLGTIEIKAIIL 48970 (0)
51142 DMFAAGTDTTTTVIEWAMAELITHPDAMRNAQDEIKAVVGITSHITEDHLDRLPYLK 51312
51313 AVLKETLRLHPPLPLLVPHEPSSDTKILGYSIPACTRIVINAWTIGRDQATWGEHAEEFI 51492
51493 PERFLESGLDYIGQDFVLVPFGAGRRGCPGVGFAVQAMEMALASLLYNFDWETRVVDRRS 51672
51673 EFGTSSLDMSEMNGLSVRLKYGLPLIAISRFP* 51771

>AP003434.1d $F CYP71T4 chromosome 1, PAC clone:P0452F10, complete like 71A
58119 MAVSLLPAVL
58149 VLLAIVAPLLYLVLLPAVKYTTRNGAARWEDDGGDGRRRRRLPPSPRGLPLLGHLHLLGA 58328
58329 LPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRSRDMEFASRPRMAMAELLLY 58508
58509 GGRDVAFAPYGEYWRQARRICVVHLLSARRVLSFRRVREEEAAALVGRVRAAAADVVVD 58685
58686 LSDLLIAYSNTVLTRIAFGDESARGGGGGGDRGRELRKVFDDFARLLGTEPMGELLPW 58859
58860 FWWVDALRGIDGKVQRTFEALDGILERVIDDHRRRREGGRRMDDDGGGDHRDFVDVLLD 59036
59037 VNETDKDAGIQLGTVEIKAIIM 59102 (0)
59562 DMFVGGSDTTTTMMAWTMAELINHPRAMRKAQNEIWAVVGNTSHVTKDHVDK 59717
59718 LPYLKAVFKETLRLHPPLPLLIPREPPADTQILGYTIPAHTRVVINAWAIGRDAAAWGQQ 59897
59898 PDEFSPEKFLNSTIDYKGQDFELLPFGAGRRGCPGIVFGVSAMEIALASLLYHFDWEAAA 60077
60078 TDHRRRGSQAWALPVDMSEVNGIAVHLKYGLHVVAKPRMP* 60200

>aaaa01006398.1b $FI CYP71T5 (indica cultivar-group) no ortholog
4560 MAVSLLPAVLVLLAIVAPLLYLVLLPAVKYTTSNGAARWEDDDGGDGRRRRRLPPSPRGLPLLGHLHLLGAL 4775
4776 PHRALRSLAAAHGPVLLLRLGRVPAVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLYG 4955
4956 GRDVAFAPYGEYWRHARRICVVHLLSARRVLSFRRVREEEAAALVARVRAAARAPGAR 5129
5130 GAVDLVEHLTAYSNTVVSRAVFGDESARGLYGDVDRGRALRKLFDDFVELLGQEPMGELL 5309
5310 PWLGWVDAVRGLDGKVQRTFEALDSIIEKVIDDHRRRRRRHEVGRQMDSDDDGG 5471
5472 GGGDHRDFVDVLLDVNETDKDAGIRLGTIEIKAIIL (0)
     DMFAAGTDTTTTAMEWAMAELITHRDAMHKVQDEIRAVVGVTG 5831
5832 CVTEDHIDRLPYLKAVLKETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIG 6011
6012 RDPVTWGEHAEKFIPERFLNNNVDYKGQDFGLVPFGAGRRGCPGMGFAVPTIEMALASLL 6191
6192 YNFSWETRPVDRRCKSGTSSLDMSEVNGISVHLKYGLPLMAKFYSS* 6332

>aaaa01006398.1a CYP71T6 (indica cultivar-group) (partialI)
1854 MVVVVVVVAIAIVVPLLYLVLLPPARRGGGDSARRRLPPSPRGLPLLGHLHLLGALP 2024
2025 HRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLY 2198
2199 GGRDVAFAPYGEYWR 2243 

>aaaa01002288.1 $FI CYP71T7 (indica cultivar-group) 13560 MDISLASLVLVLLAFVLPLLYLLLQLPGKKSGGGGGDGPRLPPSPAGCLPLLGHLHL 13390
13389 LGPLPHVALRSMAAAHGPVLRLRLGRVPTVVVSSAAAAEEVLRARDAAFSSRPRSAMAER 13210
13209 ILYGRDIAFAPYGEYWRQARRVCVVHLLSAQRVSSFRRVREEEAAALADAVRAAGRGGG 13033
13032 RAFDLSGLIVAYASAVVSRAAFGDESARGMYGGADGGRAVRKAFSDFSHLFGTKPVSDYL 12853
12852 PWLGWVDTLRGRERKARRTFEALDGVLDKVIDDHRRRRDSGRRQTGDADAGHRDFVDVL 12676
12675 LDVNEMDNEAGIHLDAIEIKAIIM 12604
12529 DMFVAGSDATSKPMEWAMAELVSHPRHMRRLQDEIRAVVGGGRVTEDHVDKLPYLRAAL 12353
12352 KEALRLHAPLPLLVARETVADTEIMGYHVAARTRVVINGWAIGRDTAVWGETAEEFMPER 12173
12172 FLAGGNGGGAAAADYKVQGFEMLPFGGGRRGCPGVTFGMATVE 12044
12041 SAVASLLYHFDWEAAAADGKGGREGTPLLDMSETSGISMGLKHGLPLVAKPRFP 11880

>aaaa01010398.1 CYP71T10P (indica cultivar-group) not an exact match 71 like 
2295 LMYLVLLPDVNRSNRPERWEDSDGWQRLPP*PRRLPLLRYLHLLSVPLHQAFHPLPR 2465
2466 HMAWCCYSSSNACRWWLSSFAATSRPKSAMAEQLLYGCDVAFAPYGEY* 2612
2613 S*ECRICVLFFRCIREEEVAVLVKHVRHPCR 2705

>aaaa01005635.1 $PI CYP71U1P (indica cultivar-group) one stop codon, one fs
8796 MDELSAGSLYLVVLGTLALALAFKRVLRGKETGVKLPPGPWNLPIIGSLHHLVGAHLPHRALLRVSR 8596
8595 RQGPLMLLRLGEVPAVVVSSPEAAMEFLRTRDPVFASRPRGALRSTSSASAVK 8437
8436 GSSWRHTASTGGRCARSAWWSCSAQGRCSGWSLSGRRRGGVPPRRGHRHDIA 8281
8280 CYSQHRHDPDASGAQ*RHHREGGVRRQVPTAGLRYLRVLKVVATLAGSFN 8131
8130 MVDLFPSSRLVRWLSCVERRLREHHAQTVRIVDSIIQDRKENEASASPGASAEDDDNDDL 7951
7950 LDVLLRLQREDNLTFPITAEIIGALIS (0) 7852
7202 DIFGAATDTTGSTLEWAMAELMRNPRTMEKAKQEVQNALGQGRAMVTGADIGDLHYLQMV 7023
7022 IKETLR  7005
7000 LHPSIPLIVRASEESTLVMGYDIPQGTNIFINAFAVARDPRYWKDADEFMPERFEKN 6830
6829 GDDIKATTVHMGFIPFGAGR 
6669 NLLYHFDWTLINGESPESLDMGEVWGISIHRRSDLRLHAALSVSSGFLRHSDRDS* 6496

>aaaa01000843.1 $FI CYP71U2 (indica cultivar-group) 63% to AAAA01005635.1 37% to 71B2
21357 MDELSIENHSPISMDELSFG
21297 SLCLVAMATLALALALMVVMGAHRRGGEKGATTGAKNLPPGPWNLPVTGSLHHLLGASP 21121
21120 PPHRALLRLSRRHGPLMLVRLGEVPTVIVSGSDAAMEGWVLKAHDPAFADRARSTTVDAV 20941
20940 SFGGKGIIFAPYGEHWRQARRVCLAELLSARQVRRLESIRQEEVSRLVGSIAGSSNA 20770
20769 AAVDMTRALAALTNDVIARAVFGGKCARQEEYLRELGVLTALVAGFSMADLFPSSRV 20599
20598 VRWLSRRTERRLRRSHAQMARIVGSIIEERKEKKASDDGVGAKDEDDDLLGVLLRLQEED 20419
20418 SLTSPLTAEVIGALVI (0) 20371
17791 DIFGAATDTTASTLEWVMVELMRNPRAMEKAQQEVRNTLGHEKGKLIGTDISELHYLRMV 17612
17611 IKETLRLHPSSALILRQS 17558
17558 QGNCRVMGYDIPQATPVLINTFAVARDAKYWDNAEEFKPERFENSGADIRTSTAHLGFVP 17379
17378 FGAGCRQCPGALFATTTLELILANLLYHFDWALPDGVSPESLDMSEVMGITLHRSSSLHL 17199
17198 HATLSRLGFVSHSGQ* 17151

>AP004872.1 $F CYP71U3 (japonica cultivar-group) chr 2 = AP005536.1  92% to 
98325 MDELSIENHSPISMDELSFGSLCMVAMATLALALALMVMGAHRRGGEKGATTGAKNLPP 98149
98148 GPWNLPVIGSLHHLLGASPPHRALLRLSRRHGPLMLVRLGEVPTVIVSGSDAAMEVL 97978
97977 KARDPAFADRARSTTVDAVSFGGKGVIFAPYGEHWRHARRVCLAELLSARQVRRLESIRQ 97798
97797 EEVSRLVDSIIAGSSNAAAVDMTRALAALTNDVIARAVFGGKCARQEEYRRELGVLTTLV 97618
97617 AGYSMVDLFPSSRVVRWLSRRTERRLRRSHAEMARIVGSIIEERKEKKGSDAGVGAKDED 97438
97437 DDLLGVLLRLQEEDGLTSPLTAEVIAALV 97351
94360 XDIFGAATDTTASTLEWIMVELMRNPRAMDKAQQEVRNTLGHEKGKLIGIDISELHYLCMV 94181
94180 IKETLRLHPASALILRQSRENCRVMGYDIPQATPVLINTFAVARDPKYWDNAEEFKPE 94007
94006 RFENSGADIRTSIAHLGFIPFGAGCRQCPGALLATTTLELTLANLLYHFDWALPDGVSPK 93827
93826 SLDMSEVMGITLHRRSSLHLHTTLTRSGFFSHSGR 93722

>AC096855.1 $F CYP71V1 chromosome 3 clone OJ1365_D05 54% to AC087550 frameshift before 
87309 MDDYFFLQSLLLCVAAVALLQLAKVAATMRRRPRTPPGPWRLPVIGSMHHLVNALPHR 87136
87135 AMRDLAGVHGPLMMLRLGETPVVVASSRGAARAVLKTHDANFATRPRLLAGEIVGYGW 86962
86961 ADILFSPSGDYWRKLRQLCAAEILSPKRVLSFRHIREDEVTARVEEIRAAAAPSTPVNLS 86782
86781 VLFHSTTNDIVARAAFGRKRKSAPEFMAAIKAGVGLSSGFKIPDLFPTWTTALAAVTGMK 86602
86601 RSLRGIHKTVDAILQEIIDERRCVRGDKINNGGAADDQNADENLVDVLIALQEKGGF 86431 (1)
86339 GKSVTTPWVIVTHMICTLDVQDMFAGGTGTSASALEWAMSELMRNPAVMKKLQGQIREAFH 86157
86156 RKAVVTEADLQASNLRYLKLVIKEALRLHPPAPLLVPRESIDTCELDGYTIPAKSRVIVN 85977
85976 VWAIGRDPK Y*Y*E DAEEFKPEQFDDDAIDFMGGSYEFIPFGSGRRMCPGFNYGLASMEL 85797
85796 VLVAMLYHFDWSLLVGVKEVDMEEAPGLGVRRRSPLLLCATPFVPAAVSADY* 85638

>aaaa01006345.1 CYP71V2 (indica cultivar-group) 77% to AC096855.1 $F 
10460 MDELFYQSLLLSVAAVT 10410
10409 VLQLLKLLLVRHRRPRTPPGPWRLPVIGSMHHLVNVLPHRKLRELAAVHGPLMMLQLGET 10230
10229 PLVVATSKETARAVLKTHDTNFATRPRLLAGEIVGYEWADILFSPSGDYWRKLRQLCAAE 10050
10049 ILSPKRVLSFRHIREDE 9999
9730 VNLSVMFHSVTNSIVSRAAFGKKRKNAAEFLAAIKSGVGLASGFNIPDLFPT 9575
9574 WTGILATVTGMKRSLRAIYTTVDGILEEIIAERKGIRDEKISGGAENVDENLVDVLIGL 9398
9397 QGKGGFGFHLDNSKIKAIILQDMFA 9218
9217 GGTGTSASAMEWGMSELMRNPSVMKKLQAEIREVLRGKTTVTEADMQAGNLRYLKMVI 9044
9043 REALRLHPPAPLLVPRESIDVCELDGYTIPAKSRVIINAWAIGRDPKYWDNPEEFRPERF 8864
8863 EDGTLDFTGSNYEFIPFGSGRRMCPGFNYGLASMELMFTGLLYHFDWSLPEGVNEVDMAE 8684
8683 APGLGVRRRSPLMLCATPFVPVVSAN* 8603

>AL732378.3 $F CYP71V3
      MAWLDDVLSLCNNNTRMCNALVLSVVVVSFLQLLKHVLLTPSRLP
64951 LPPGPRNLPVVGSAHRLVNTLAHRVLRDLADVHGPLMHLRVGQVPVVVVTSKELARDILK 64772
64771 THDANFATRPKLVAGGIVAYDWTDILFSPSGDYWRKLRRLCIQEILSAKRILSFEHIRED 64592
64591 EVRMLADEIRAVGPSVAVDLSARLHRITNTIVSRAAFGNKRSNAADFLVAIKQSVIMASG 64412
64411 FYVPDLFPRFSVLLCWLTGMRRTLHGIRDTIDSILEEIISEKEEAKQQQDNNLVDVLLSL 64232
64231 KDKGDFGFPITRDTIKAIVL 64172
63964 DIFAGGSGTSANAMEWAMSELMMNPRVMNKVQAEIRDAFHGKQSIGEADLRARDLKYLKL 63785
63784 VMKETLRLHPPAPLLVPRESIDACEINGYMIPAKARVIVNSWAISRDPRYWEDAEEFKPE 63605
63604 RFAEGGIDFYGSNYEYTQFGSGRRMCPGYNYGLASMELTLAQLLHSFDWSMPDGATEVDM 63425
63424 TEAPGLGVRRKTPLLLCAAPYVASHIYA* 63338

>aaaa01006105.1a $FI CYP71V4 (indica cultivar-group) similar to Lolium rigidum 
MDELLYRALLLSVLAVALLQIIEAFLIIIRAKPAAPPLPPGPWRLPVIGSMHHLAGKLPHRALRD 3196
LAAAHGPLMMLRLGETPLVVASSREMAREVLRTHDANFATRPRLLAGEVVLYGGADILF 3019
SPSGEYWRRLRQLCAAEVLGPKRVLSFRHIREQE (0) 2914
MESQVEEIRAAGPSTP
VDLTAMFSFLVISNVSRASFGSKHRNAKKFLSAVKTGVTLASGFKIPDLFPTWRKVLAAV 1750
TGMRRALEDIHRVVDSTLEEVIEERRSAREDKARCGMVGTEENLVDVLIGLHEQGGC 1579
LSRNSIKSVIFDMFTAGTGTLSSTLGWGMSELMRSPMVMSKLQGEIREVFYGKATVGEED 1399
IQASRLTYLGLFIKETLRLHPPVPLLVPRESIDTCEIKGYMIPARSRIIVNAWAIGRDPR 1219
YWDDAEEFKPERFEKNIVDFTGSCYEYLPFGAGRRMCPGVAYGIPILEMALVQLLYHFDW 1039
SLPKGVVDVDMEESSGLGARRKTPLLLCATPFVVPVL* 925

>aaaa01006105.1b $FI CYP71V5 (indica cultivar-group) 
6903 MDGLLYQALLLSALAVAVLQIVKLAVVNRGKKQAAAAAPTPPGPWRLPVIGSMHHLAGKLAHRALRD 6703
6702 LAAVHGPLMMLQLGETPLVVVSSREVAREVLRTHDANFATRPRLLAGEVVLYGGADILF 6526
6525 SPSGEYWRKLRQLCAAEVLGPKRVLSFRHIREQE (0) 6421
     MASRVERIRAVGPSVP
5914 VDVSALFYDMAISIVSCASFGKKQRNADEYLSAIKTGISLASGFKIPDLFPTWRTVLAAV 5735
5734 TGMRRALENVHRIVDSTLEEVIEERRGAARECKGRLDMEDNEENLVDVLIKLHEQGG 5564
5563 HLSRNSIKSVIFDMFTAGTGTLASSLNWGMSELMRNPRVMTKLQGEIREAFHGKATV 5393
5392 GEGDIQVSNLSYLRLFIKETLRLHPPVPLLVPRESIDMCEVNGYTIPARSRIVVNAWAIG 5213
5212 RDPKYWDDPEEFKPERFEGNKVDFAGTSYEYLPFGAGRRICPGITYALPVLEIALVQLIY 5033
5032 HFNWSLPKGVTEVDMEEEPGLGARRMTPLLLCATPFVVPVL* 4907

>aaaa01006105.1c $PI CYP71V6P (indica cultivar-group) 79% to AAAA01006105.1b
12642 (0) IASRVDLICAVGPLTL
12594 VDVSALFYDITISIASCASFGKKHRNVDEYLSSIKTRVSLASRFKIPDLFPSWRTMLAMV 12415
12414 TGMRRALEEVHGIVDSTLEDVIEERQGEKEDKTRPDMVDTKENLVDVLIGLHENGA 12247
12246 HLSRDSIKAVIFDMFTAGTGTLASALNWGMSKLMRNPRVMTKLQGEIRKAFHGKVTVG 12073
12072 EDDIQAANLPYIRLFIEETLLLHPVVPLLVPRESIDVCEVNGYTILARSRIVVNAWAIGR 11893
11892 DPKYWDNPEEFKPEWFEGNIVDFPGSSYEYLPFGAG*RMCPGIAYGLPVLEMALVQLLYH 11713
11712 FD*SLPNGVMKVDMEEEPGLGARRKTPLLLNLFVIPVLQGQQ*  11578

>aaaa01023722.1 $FI CYP71W1 (indica cultivar-group
71  MELTTLLLLALISFFFLVKLIARYASPSGRESALRLPPGPSQLPLIGSLHHLLLSRYGDL 250
251 PHRAMRELSLTYGPLMLLRLGAVPTLVVSSAEAAAEVMRAHDAAFAGRHLSATIDILSC 427
428 GGKDIIFGPYTERWRELRKVCALELFNHRRVLSFRPVREDEVGRLLRSVSAASAEGGA 601
602 ACFNLSERICRMTNDSVVRAAFGARCDHRDEFLHELDKAVRLTGGINLADLYPSSRLVRR 781
782 LSAATRDMARCQRNIYRIAESIIRDRDGAPPPERDEEDLLSVLLRLQRSGGLKF 943
944 ALTTEIISTVIF (0) 979
1125 DIFSAGSETSSTTLDWTMSELMKNPRILRKAQSEVRETFKGQDKLTEDDVAKLSYLQLVI 1304
1305 KETLRLHPPAPLLIPRECRETCQVMGYDVPKGTKVFVNVWKIGREGEYWGDGEIFRPERF 1484
1485 ENSTLDFRGADFEFIPFGAGRRMCPGIALGLANMELALASLLYHFDWELPDGIKSEELDM 1664
1665 TEVFGITVRRKSKLWLHAIPRVPYYSTY* 1751

>AC120537.1a CYP71W2 chromosome 3 clone pseudogene fragment
2543 ARRVQSPRHVR*D*QAGYLVHAVVGECAPGGAGAVVPISEKISRMVNDSVVRPAIGSRCA 2364
2363 RRDEFLHVQARGLRQARGRVQLGRPVPIVVASELAQRRAAVGRPSVAAGAFARCGRPAET 2184
2183 FFNMDNLRTHDTYRKKNHSGNSQHCTAFSALSFSELQLKMTIWQSHHYKLPINLREIFS   
2006 SAGSETLNDTLVGNI*ANEKYPQVMQKAQTEVREKFRG*DKLIKDDMNRLSYLHL 1846
1845 VIQETLRLH 

>AC120537.1b $F CYP71W3 chromosome 3 clone 
80150 MEVSLPLLIGVVLAFLLLFVLVNIKNSCRSWWPPPEKEKKKLRLPPGPWQLPLVGSLHHV 80329
80330 LLSRHADLPHRALRELAGKYGPLMMLRFGAVPTLVVSSAEAAREVLKTYDAAFASRYL 80503
80504 TPTLAVLSRGGRDILFSPYCDLWRQLRRICVHELLSARRVQSLRHGREDEAARLVRSVAA 80683
80684 ECAARGGAAVVNVGELISRAVNDSVVRSAVGARSARRDEFVRELDESVRLSGGFNLADLY 80863
80864 PSSWLARRLSGAMRETERCNRSLMAIMDDIIREHGDGEEDLLGVLLRLQRNGDVQCPLTT 81043
81044 DLITNVVL (0) 81067
81865 DMFAAGSETSSTTLEWALTELVRNPHIMEKAQSEVREIFRGENKLTEEMMDKLSYLRLVI 82044
82045 RETLRLHLPVPFLLPRQCREPCSVMGYDIPVGTKVLVNAWAIARDNQYWDDPEVFKPERF 82224
82225 ENNRVDFKGIDFEFIPFGAGRRICPGIALGLANIELMLASLLYHFDWEFLDRDRNDEIDL 82404
82405 SETFGITAKRKSKLMVYATQRIPCLG 82482

>AC120537.1c $F CYP71W4 chromosome 3 clone OSJNBb0042N11
103769 MEMTLPLLGAAVVLAAFLLFFLVKNNRCCWSPAAERR
103880 LRLPPGPWRLPLVGSLHHVLLSRHGDLPHRALRELAGRYGALMLLRFGAVPTLVVSSAE 104056
104057 AAREVLKTHDACFASRHMTPTLAVFTRGGRDILF SPYGDLWRQLRRICVLELFSARRVQS 104236
104237 LRHVREDEAARLVRAVAEECAIGGGGGAVVPIGDMMSRMVNDSVVRSAIGGRCARRDEFL 104416
104417 RELEVSVRLTGGFNLADLYPSSSLARWLSGALRETEQCNRRVRAIMDDIIRERAAGKDDG 104596
104597 DGEDDLLGVLLRLQKNGGVQCPLTTDMIATVIM (0) 104695
105190 EIFSAGSETASTTLEWAISELVRNPKVMDKAQSEVRKLFEGQDNLTEDDMSRLS 105351
105352 YLHLVIRETLRLHAPAPFLLPRECREQCNVMGYDITEGTRVLVNAWAIARDTRYWEDPEI 105531
105532 FKPERFNANLVDFKGNDFEYIPFGSGRRVCPGITLGLTSMELVLASLLYHFDWELPGGKR 105711
105712 CEEIDMSEAFGITVRRKSKLVLHATPRVPCLH* 105810

>AC078894.1 $P CYP71W5P chromosome 10 clone OSJNBa0096G08 12 unordered pieces starts 
51119 LRRICVLELFSAHRV*SLHHVREEEAAPLVRVVADIRSPLGP 50994

>AP004175.1 $P CYP71W6P chromosome 2 clone OJ1006_B12 pseudogene fragment 
64520 LRRICMLELFSAHRV*SLHHVREEEAARLVRVVA 64419

>AP003990.1g $P CYP71X1P chromosome 2 clone OJ1073_F05 pseudogene
42530 MDHVLACVGILVAFTPLFLLAVLPLKLTNGGDGVKLPPGPWRLPVIGSMHHLMGESLVHRAMAD 42721
42722 LARRLDAPLMYLKLGEVPVVLASSPCAAREIMRAHDVAFASRPLSPTVRRMR 42877
42878 PPPPRRRQLRKICVVELLSARRVRTFRRVREEEVARLVGALVCLAHVA 43021 gap
      AMIGARFERRDEFLE
43862 DLFSGGSETSATVIQWAMSELMKNPRVMRKVQAELRDKLAGKPRVTEDDLSDLKYLKL 44035
44036 VIKETLRLHPAAPLLVPRQCREPCKIMGYDIPKGTTVFVNAW 44161 
44161 AIGRDPNYWDDAEVFRLERFANSTIDFKGMDMEFIPFGAGRRMCSGLAFAEAIIDLLFS 44337
44338 TLLFHFDWELPCGMTASELDMIEEMALTVRRKNDLHLRPILRVPQTQTSSALLF* 44502

>AP003990.1f $F CYP71X2 chromosome 2 clone OJ1073_F05 
38238 MYDAVACVVAVVVVVVFAMLWVKLARSGDGGGGGSGGVRLPPGPWRLPVIGSLHHVVGDRLLHRSMA 38438
38439 RIARRLGDAPLVYLQLGEVPVVVASSPGAAREVTRTHDLAFADRALNPTARRLRPGGAGV 38618
38619 ALAPYGALWRQLRKICVVELLSARRVRSFRRVREEEAGRLVGALAAAAASPGEEA 38783
38784 AVNFTERIAEAVSDAALRAMIGDRFERRDEFLQELTEQMKLLGGFSLDDLFPSSWLASAI 38963
38964 GGRARRAEANSRKLYELMDCAIRQHQQQRAEAAVVDGGAGVEDDKNQDLIDVLLNIQKQG 39143
39144 ELETPLTMEQIKAVIL 39191 (0)
39428 DLFSGGSETSATTLQWAMSELIKNPMVMQKTQAELRDKLRRKPTVTEDDLSGLKYVKL 39601
39602 IIKETLRLHPVVPLLVARECRESCKVMGYDVPKGTTVFVNAWAIGRDPKYWDDAEEFRPE 39781
39782 RFEHSTVDFKGIDLEFIPFGAGRRICPGMAFAEAIMELLLAALLYHFDWELPNGMAASE 39958
39959 LDMTEEMGITVRRKNDLHLRPHPPCVVRSNFRSFVERERERHFV* 40093

>AP003990.1e $F CYP71X3 chromosome 2 clone OJ1073_F05 
33613 MEQVSCFAAAAAAVLVVLSLARMLLAPRREWD
33709 GLNLPPSPSRLPFIGSFHLLRRSPLVHRALADVVRQLGAPPLMYMEIGEVPAIVVSCADA 33888
33889 AREIMKTHDINFASRPWPPTVQKLRAQGKGIFFEPYGALWRQLRKICIVKLLSVRRVSSF 34068
34069 HGVREEEAGRLVAAVAATPPGQAVNLTERIKVAIADTTMRPMIGERFERRE 34221
34222 DFLEVLPEIVKLASGFSLDDLFPSS 34296 
      GSPAPSAARGEAVNRASYELVDSAFRQRQQQKEAMAAPPPDIAKEE
      EDDLMDELIRIHKEGSLEVPLTAGNLKAVIL 34528 (0)
34777 ELFCAGSETSSNAIQWAMSELVRNPKVMEKAQNEVRSILKGKPTVTEADMVDLTY 34941
34942 VKMIVKETHRLHPVLPLLTPRVCQQTCQIMGYDVPQGSVIFIKSWAIMRDPKHWDDAETF 35121
35122 KPERFEDSEIDLKGTNYEFTPYGAGRRICPGLALAQVSIEFILTMLLYHFNWELPNGAA 35298
35299 PEELDMTEDMGLTIRRKNDLYLLPTLRVPLTA* 35397

>AP003990.1d $F CYP71X4 chromosome 2 clone OJ1073_F05 no ortholog
27391 MEQVSCFAAAAAVVVVVLLLARMLLAPRGEWDGLNLPPSPPRLPFIGSFHLLRRSPLVHRALADVARQL 27597
27598 GSPPLMYMRIGELPAIVVSSADAAREVMKTHDIKFASRPWPPTIRKLRAQGKGIFFEPYG 27777
27778 ALWRQLRKICIVKLLSVRRVSSFHGVREEEAGRLVAAVAATPPGQAVNLTE 27930
27931 RIEVVIADTTMRPMIGERFERREDFLELLPEIVKIASGFSLDDLFPSSWLACAIGGSQRR 28110
28111 GEASHRTSYELVDSAFRQRQQQREAMAASPPDIAKEEEDDLMDELIRIHKEGSLEVPLTA 28290
28291 GNLKAVIL 28314 (0)
28577 DLFGAGSETSSDALQWAMSELMRNPRVMEKAQNEVQSILKGKPSVTEADVANLKY 28741
28742 LKMIVKETHRLHPVLPLLIPRECQQTCQIMGYDVPQGSVIFINSWAIMRDPKHWDDAETF 28921
28922 KPERFEDGEIDLKGTNYEFTPFGAGRRICPGLALAQASIEFMLATLLYHFDWELPNRAA 29098
29099 PEELDMTEEMGITIRRKKDLYLLPTLRVPLTA* 29197

>AP003990.1c $F CYP71X5 chromosome 2 clone OJ1073_F05 one in frame stop at W 
16507 MEKVAWCACFLLLALMVVRLTAKRRGDNGAERLPPGPWRLPLVGNLHQVMARGPLVHRTMADLARRLD 16710
16711 APLMSLRLGEVPVVVASSADAAREIMRTHDVAFATRPWNPTTRRLRCDGEGVVFATYGAL 16890
16891 WRQLRKLCVVELLGARRVRSFRRVREEEARRLVAAVAASPRGEAVNVSERI 17043
17044 TAVITDATMRAMIGDRFGRRDEFLELLADIVKIGSGFSLDDLFPSWRLAGAIGGMARRAE 17223
17224 ANHRRTYELMDSVFQQHEQRRVHVAAPADGAMDDAEEDLVDVLFRIQKDGGLEVPLTIGN 17403
17404 IKAIIL 17421 (0)
17795 DLFNAGSETSANTLQWVMSELMRNPKVMRKAQAELRNNLQGKTTVTEDDLTNLKYLKL 17968
17969 VIKETLRLHPVLPLLLPRECREACNVIGYDVPKYTTVFINV*AINRDPKYWDMAEMFKPE 18148
18149 RFDNSMIDFKGTDFEFVPFGAGRRICPGIAFAQSNMELVLATLLYYFDWELPSGMSPEE 18325
18326 LDMTEDMGLSVRRKNDLYLHPTVCVPL* 18409

>AP003990.1b $P CYP71X6 chromosome 2 clone OJ1073_F05 
11020 MEKVAWCACFLFLALMVVRLRTKRRGDNNGGVKLPPGPWRLPLVGNLHQVMARGPLVHRTMADLA 11214
11215 RRLDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTIRVMMSDGVGLVFAP 11394
11395 YGALWRQLRKIAMVELLSARRVQSFRRIREDEVGRLVAAVAAAQPGEAVNV 11547
11548 SERIAALVSDAAVRTIIGDRFERRDEFLEGLAEGIKITSGFSLGDLFPSSRLASFIGGTT 11727
11728 RRAEANHRKNFELMECALKQHEEKRAAAAAAAAGAVEDDEDIVDVLLRIQKEGSLQVPLT 11907
11908 MGNIKAVVL 11934 (0)
12556 DLFGAGSETSANTLQ*AMAELIMNPRTMLKAQAELRDALQGKQIVSEYDLVKLKYLKL 12729
12730 IIKETLRLHPVVPLLLPRE 12786 
      CQETCKVMDYDVPIGTIVLVNMWVIGRDPKYWEDAKTFRPERFEDGHIDFKGMNF 12955
12956 EYLPFGAGRRMCPGVAFAEAIMELALASLLYHFDWEFPDGISPAKMDMMEVMGSTVRKKN 13135
13136 DLYLVPNAHVPVAP* 13180

>AP003990.1a $F CYP71X7 chromosome 2 clone OJ1073_F05 42% to 71B24
7359 MADLELEKVASFLLAALLPLVLFKLAAAKRGGGDGGMRLPPGPWRLPVIGNLHQIMAGGQ 7538
7539 LVHRTMAGLARGLGDAPLLSLRLGEVPIVVASSADAAREIMSRHDAKFATRPWSPTVRVQ 7718
7719 MVDGEGLAFAPYGALWRQLRKITMVELLSPRRVRSFRRVREEEVGRLVVAVATAA 7883
7884 TRRPGEAAVNVGERLTVLITDIAVRTIIGDRFERREDFLDAAAEWVKIMSGFSLGDLFPS 8063
8064 SRLASFVSGTVRRAEANHRKNFELMDYALKQHEEKRAAAAAAGAGAVEDDEDIVDVLLRI 8243
8244 QKEGGLEVPLTMGVIKGVIR 8303 (0)
8551 DLFGAGSETSANTLQWTMSELVRNPRVMQKAQTELRDCLRGKQSVSEDDLIGLKY 8715
8716 LKLVIKETLRLHPVVPLLLPRECQETCNIMGYDVPKGTNVLVNVWAICRDPRHWENAETF 8895
8896 IPERFEDSTVDFKGTDFEFIPFGAGRRMCPGLAFAQVSMELALASLLYHFDWELPSGVA 9072
9073 PSNLDMEEEMGITIRRKNDLYLVPKVRVPL* 9165

>AP004000.1a $F CYP71X8 chromosome 2 clone OJ1115_B01
95316 MAMVQDITGYLCLSLALLLLTLVLHKVARKATGNGAGKPRLPPGPWRLPVIGNLHQVAMGGPLVHRTMADLA 95101
95100 RRLDAPLMSLRLGELRVVVASSANAAREITKTHDVAFATRPWTSTIRVLMSDGVGLVFAP 94921
94920 YGALWRQLRKIAVVELLSARRVQSFRRIREDEVGRLVAAVAAAPAAQPVNV 94768
94767 SERIAALISDSAVRTIIGDRFERRDEFLEGLAEAIKITSGFSLGDLFPSSRLASFVGGTT 94588
94587 RRAEANHRKNFELIECALRQHEERRAAGAVDDDEDLVDVLLRVQKDGSLQMPLTMGNIKA 94408
94407 VVL 94399 (0)
93945 ELFGAGSETSANTLQWAMTELIMNPRVMLKAQAELSNVIKGKQTISEDDLVELKYLKL 93772
93771 IIKETLRLHPVVPLLLPRECRETCEVMGYDIPIGTTVLVNVWAIGRDPKYWEDAETFIPE 93592
93591 RFEDGHIDFKGTNFEFIPFGAGRRMCPGMAFAEVIMELALASLLYHFDWELPDGISPTK 93415
93414 VDMMEELGATIRRKNDLYLIPTVRVPLSTVL* 93319 

>aaaa01030108.1 CYP71X9P orth of AP004000.1b
1684 RVIASSTGAACREFTETHDVKFATRPWSSTVRVLMADGLG 1565
1556 GLVFAPYGALWRQLRKIAMVELLSARRVQSHRRYRRRGDAAR 1431

>AP004000.1c $F CYP71X10 chromosome 2 clone OJ1115_B01
109813 MAMVQYVTGYLCLLSLALLLLTLVLHKVARKATGNGAGKPRLPPGPWRL
       PVIGNLHQVAMGGPLVHRTMADLA 109595
109594 RRHDAPLMSLRLGELRVVVASSADAAREITKTHDVAFATRPWSSTIRVMMSDGVGLVFAP 109415
109414 YGALWRQLRKIAVVELLSARRVQSFRRIREDEVCRLVAAVAAAQPGEAVNV 109262
109261 SERITALISDSAVRTIMGDRFEKRDEFLEGLAEGDRIASGFSLGDLFPSSRLASFVGGTT 109082
109081 RRAEANHRKNFGLIECALRQHEERRAAGAVDDDEDLVDVLLRVQKEGSLQVPLTMGNIKAVIL 108893 (0)
107479 ELFGAGSETSASTLHWAMTELIMNPKVMLKAQDELSNVIKGKQTISEDDLVELRYLKL 107306
107305 VIKETLRLHPVVPLLLPRECRETCEVMGYDIPIGTTMLVNVWAIGRDPKYWEDAETFRPE 107126
107125 RFEDGHIDFKGTDFEFIPFGAGRRMCPGMAFAEAIMELVLASLLYHFDWELPDGISPTK 106949
106948 VDMMEELGATIRKKNDLYLVPTVRVPMSTAL* 106853 

>AP004000.1d $F CYP71X11 chromosome 2 clone OJ1115_B01
123850 MEEPTSCYGYYHYLALAVAVLVLVRVTRTRGGGSDGVRLPPGPWRLPVIGSLHHLAGKPLVHRALAD 124050
124051 LARRMDAPLMYLRLGEVPVVVATSPGAAREVMRTHDVAFATRPVSPTVRIMTADGEGLVF 124230
124231 APYGALWRQLRRIAILELLSARRVQSFRRVREEEAARLAAAVAAAAPHGEAAV 124389
124390 NVSERIAVLIADSAVRAMIGDRFKKRDEFLEALAEGLKLVSGFSLADLFPSSWLASFVTG 124569
124570 AARRAQENHRKNFELMDRAIEQHQERRAAAAAASGDVVEDDDLVDVLLRIQKGGGLDVPL 124749
124750 TMGIIKAVIL 124779 (0)
124917 DLFSAGSETSATTIQW AMSELMRNPRVMKRAQAELRDNLQGKPKVTEEDLTDLNYLKL 125090
125091 IIKETLRLHLPAPLLLPRESRESCKIFGYDVPKGTTVLVNAWAIGRDPKYWDDPEEFKPE 125270
125271 RFEDSKIDFKGLDFEFLPFGSGRRMCPGIMFAQPNIELALATLLYHFDWSLPAGVKPSE 125447
125448 LDMTEEMGITVRRKNDLYLHAVVRVPLHATTP* 125546

>AP004000.1e $F CYP71X12 chromosome 2 clone OJ1115_B01
127153 MAQDVAEYLSIFLALVVAPLLLLRVARRARGNGAGRPRLPPGPWRLPVIGSLHHLMGKPHVHRAMA 127350
127351 DLARRHGAPLMYLRLGEVPFVVASSPDAAREVLRAQDANFASRPWSPTLRVMMADGEGLA 127530
127531 FARHGAHWRLRKICVLELLGPRRVRSFRRVREEEVARLLAAVAAAAAAGADAV 127689
127690 VNVSERAAVLVTDTX 127731 
127734 VRAMIGDRFEMRDEYLEGVAEVGKLLLGLSLGDLFPSSRLASLVSGTARRAAASHRKMFE 127913
127914 LMDCAIRHHQERKAAMDADEDILDVLLRIQKEGGHDAPLTMGDVKDTIL 128060 (0)
128189 DLFAAGTETSTATLQWAMSEVVRNPRIMQKAQAELRNKLQGKPSVTEDDLVGLTYLKL 128362
128363 VIKETLRLHPAAPMLVPRECGESCKVLGYDVPRGTNVLINAWAIGRDPNYWDDTETFKPD 128542
128543 RCENNKYNFRGTDFEYIPFGSRRKICPGPAFTHAILELALAALLYHFDWELPCGVAPGE 128719
128720 VDMAEETGVVVRPKNDLYLRPVVRVPPGAASSGNGGT* 128833

>AP005385.1b $P CYP71X13P (japonica cultivar-group) chr 2 = aaaa01012992.1
146254 MDQVACWSICAFLALLLLVRIGGKRGRGGDGARLRQPPPGPWRLPVIGNLHQLMLRGP 146427
146428 LVHRTMADLARGLDDAPLMRLQLGGVPVVVASSPDAAREVTCTHDAAFASRPWPPTVRRL 146607
146608 RPHREGVVFAPYGAMWRQLRKVCIVEMLSARRVRSFRRVREEEAANLAAAVAASLSSPPA 146787
146788 RRDAVNVSALVAAAVADATMRVVIGDRLERREEFLESMTEAVRSFTGFSLDDLFP 146952
146953 SSRIAAAVGGMTRRAEASHRKGNELIESAIRQHEQVRDAMAAQGGGGAMEEDLLDTLL 147126
147127 RIQKEGALDMPLTMDNIKAVI 147189
147557 DIFGAGSDTSSNIIQW 
147612 RNTLQGKHPVKEDDLVNIKYLKLIIKETLRLHPVVPLLLPRECLHACKVMGYDVPKGTTV 147791
147792 FVNIWAINRDPKHWDDPEVFKPERFDDGKIDFKGANFEYIPFGAGRRSCPGVTFGHATVE 147971
147972 LMLATLLYHFKWELLEGVAPNELDMTEEIGINVGRKNPLWLCPIVRVPLQ* 148124

>AP005385.1a CYP71X14 (japonica cultivar-group) chr 2
142591 MEQVAYWFICACAFLALVLLVRLGAARRDVVRLPPGPWRLPVVGNLHQLMLRGPLVHRTM 142770
142771 ADLARGLDDAPLMRLQLGGVPVVVASSADAAREVTRTHDLDFASRPWPPTVRRLRPHREG 142950
142951 VVFAPYGAMWRQLRKVCVVEMLSARRVRSFRRVREEEAARLVASIASSSSSSPTGHDGGA 143130
143131 APAVNVSAPIAAAVADATMRAVIGDRFERREEFLESITEAVRSFTGFSLDDLFPSSRLAA 143310
143311 AVGGMTRRAEASIRKGHQLMDSAFRQHQQLRDAMAAQPHLDDCAMEEDLLDTLLRIQKED 143490
143491 NLDVPLTTGNIKAVLL (0)
143668 DIFGAGSDTSSHMVQWVLSELMRNPEAMHKAQIELRSTLQGKQMVSEDDLASLTYLKLVIK 143850
143851 ETLRLHPVVPLLLPRECRQTCKVMGYDVPQGTTVFVNVWAINRDPRHWDEPEVFKPERFH 144030
144031 SGKIDFKGANFEYIPFGAGRRICPGMTFGHATVELMLAMLLYHFDWELPKGVAPNELDMT 144210
144211 EEMGITVGRKNALYLHPIVRVPLEQATMS 144297

>aaaa01008333.1a $FI CYP71X15 (indica cultivar-group) very similar to AP003990.1
6914 MAMVQDATGYLSLFLALLSITLVLHKVARKASGDGAGKPRLPPGPWRLPVIGNLHQIAMGG 6732
6731 PLVHRTMADLARRHDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTVRVL 6552
6551 MSDGVGLVFAPYGALWRQLRKIAMVELLSARRVQSFRGIREDEVGRLVAAVAAASAAQ 6378
6377 PGEAVNVSERIAVLIA DSVVRALMGDRFDRRDEFLDQLAERVKITSGFSLGDLFPSSRL 6201
6200 ASFIGGTTRRAEANHRKNFELIECALRQHEERRAARAGAAAAGAVDDDEDLVDVLLRIQK 6021
6020 EGKLEVPLTMGNINAVIY (0) 5967
5378 DLFGAGSETSANTLQWVMSELILNPRVMLKLQAELRGILQGKQRVTEDDLVELKYLKLVI 5199
5198 KETLRLHPVVPLLLARECQDTCKIMGYDIPVGTIVFVNVWVICRESKYWKDAETFRPERF 5019
5018 ENVCVDFKGTHFEYIPFGAGRRMCP 4944
4945 PGVAFAEASMELVLASLLYHFDWKLPNDILPTKLDMTEEMGLSIRRKNDLYLIPTICVPPLAA* 4754

>aaaa01008333.1b CYP71X16 (indica cultivar-group) runs off end of clone (partialI)
11117 EMFGAGSETSANTLQWLMSELILNPRVMSKAQVELSDTLRGKQTVTEDDLAGLKYLKLII 10938
10937 KENLRLHPVVPLLLPRECQKTCKVMMYDVPVGTTVLVNVWSINRDPKYWEDPETFKPERF 10758
10757 EDGHIDFKGTDFEFIPFGAGRRMCPGITFAEAIMELALASLLYHFDWKLLGNGISSTKLD 10578
10577 MTEELGATVRRKNDLYLVPTIRVPLPADS* 10488

>aaaa01001712.1 $PI CYP71X17P (indica cultivar-group) missing C-terminal exon 
6693 MAMAQDVTGYLCLFVALLVLLKVVRKASGNGAAGRLRLPPGPWRLPVIGNLHQVAMGG 6866
6867 PLVHRTMADMARRLDAPLMSLRLGEIPVVVASSADAAREITKTHDVAFATRPLSSTIRVM 7046
7047 VSDGEGLVFTPYGALWRRLRKIAMLELLSARRVQSFRRVREEEVGRLVAAVAAAAAAR 7220
7221 PGEAVNLSQLIAELISDTAARTIIGDRFEKRQELLEGLTEGIRISSGFSLGDLFPSSRL 7397
7398 ANLIGGTTRRAEANHRKNLALIECALRQHEERRAAGDEEDDEDLVDVLLRVQKEGG 7565
7566 GEVPLTMGNVKVVIR (0) 7610

>AP003571.1g $F CYP71Y1 chromosome 6 clone P0458E02
139036 MEDATHGYVYVGLALVSLFVVLLARRRRSPPPAAHGDGGLRLPPGPWTLPIIGSLHHLVGQIP 139224
139225 HRAMRDLARRHGPVMLLRIGEVPTLVVSSRDAAREVTKTHDTAFAMRPLSATLRVLTN 139398
139399 GGRDLVFAPYGDYWRQVRKIAVTELLTARRVHSFRSIREEEVAALLRAVAVA 139554
139555 AGTVEMRAALSALVSDITARTVFDNRCKDRGEF
       LVLLERTIEFAGGFNPADLWPS 139719 (?) bad exon boundary
140222 SRLAGRLSSVVRRAEECRNSVYKILDGIIQEHQERTSAGGEDLVDVLLRIQKEGG 140386
140387 LQFPLAMDDIKSIIF 140428 (0)
       DIFSAGSETSATTLAWAMAELIRNPTAMHKVMAEVRRAFAAAGAVSEDALGE 140655
140656 LRYLQLVIRETLRLHPPLPLLLPRECREPCRVLGYDVTRGTQVLVNAWAIGLDERYWPGG 140835
140836 SPEEFRPERFEDGEATAAVDFRGTDFEFLPFGAGRRMCPGMAFGLANVELPLASLLFHFD 141015
141016 WEVPGLADPAKLDMTEAFGITARRKADLHLRPCLLVSVPGV* 141141

>AP003571.1f $P CYP71Y2P chromosome 6 clone P0458E02 pseudogene fragment
136961 VSEDALGELRYLQLVIRETLRLHPPLPLLLPRECTIGR 137074
137075 DERYWPGGSPEEFRPERFDDGEATAAVDFRGADFELLPFGGGRRMCPGMAFGLANVELPL 137254
137255 SSLLFHFDWEVPGMADPTKLDMTEAFGITSRRKENLHLRPLLRVSVPG 137398

>AP003571.1e $F CYP71Y3 chromosome 6 clone P0458E02 
128926 MADDYFYLGLALASLLVVLFARRRRSAAHGDGGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLA 129120
129121 RRHGPVMMLRLGEVPTLVVSSRDAAREVMRAHDAAFASRPLSATVRVLTSGGRGIIFAP 129297
129298 YGGSWRQLRKIAVTELLTARRVASFRAIREEEVAAMLRAVAAAAAAGRAVELRAA 129462
129463 LSALVAETTVRAVIGDRCKDRDVFLRKLQRTIELSAGFNPADLWPSSRLAGRLGGA 129630
129631 VREAEECHDTVYGILDGIIQEHMERTSSGSCGAGDGDGDGEDLLDVLLRIQKEGGLEFPV 129810
129811 DMLAIKQVIF 129837 (0)
132964 DIFGAGSETSATTLEWVMAELIRNPKAMRKATAEVRRAFAADGVVLESALGKLHYMHLVI 133143
133144 RETFRLHTPLPLLLPRECREPCRVLGYDVPRGTQVLVNVWAIGRDERYWPGGSPEEFRPE 133323
133324 RFEDGEAAAAVDFRGADFELLPFGAGRRMCPGLAFGLANVELALASLLFHFDWEAPDVAD 133503
133504 PAEFDMTEGFGITARRKADLPLRPTLRVPVLVSVG* 133611

>AP003571.1d $F  CYP71Y4 chromosome 6 clone P0458E02
118418 MADGYFYLGLALVSLLVVLFARRRRSAAAAHGDAGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLA 118618
118619 RRHGPVMMLRLGEVPTLVVSSRDAAREVMRTHDAAFASRPLSASVRAATKGGRDIAFAP 118795
118796 YGDYWRQLRKIAVTELLSARRVLSFRPIREEEVAATLRAVAAAAADGRTVELRAA 118960
118961 LCALVADSTVRAVVGERCAGLDVFLRQLDRAIELAAGLNVADLWPSSRLAGRLSGAVRQ 119137
119138 AERCRDTMFGVLDGIIQAHLEKTGGAGEDILDVLLRIHKEGGLEFPLDMDA 119290
119291 VKCVVV 119308 (0)
119451 DVISGGCETSATTLGWAFAELIRNPAAMKKATAEVRRDFEAAGAVSESALAVGELPYLRL 119630
119631 VVRETLRLHPPLPLLLPRECREPCRVLGYDVPRGAQVLVNAWAIGRDERYWPGGSPEEFR 119810
119811 PERFGDGEAAAAVDFKGADFELLPFGGGRRMCPGMAFGFANVELPLASLLFHIDWEASGV 119990
119991 ADPTEFDMTEAFGITARRKANLLLRPILRVPVPGV* 120098

>AP003571.1c $F CYP71Y5 chromosome 6 clone P0458E02
106935 MADLHTYLYLGLALVSLLAVQLARRRRSSAAHGSGALRLPPGPWQLPVIGSLHHLVGKL 107111
107112 PHQAMRDLARRHGPVMMLRLGEVPTLVVSSPEAAREVTKTHDVSFATRPLSSTTRVFS 107285
107286 NGGRDIVFAPYGDYWRQLRKITVTELLSARRVASFRAIREEEVAAMLRAVGGYAA 107450
107451 AGCAVEIRPLLAALVSDSTVRAVMGDRFPHRDVFLRELDRSIELTAGFNPADLWPSSRL 107627
107628 AGCLTGTIRQAKKCWDTMSSVLESTIQEHLQKNGSSGGGAGATDEDLIDVLLRIQKEGGL 107807
107808 QFPFDMDVIKSVIH 107846 (0)
110756 NVFGAGSETSATTLGWAIAELIRNPMAMKKATAEVRQAFAAAGVVSEAALSELRYLHLVI 110935
110936 KETLRLHPPGPLLLPRECREQCKVLGYDVPRGTQVLVNVWAIGRDPRYWPGGSPEEFRPE 111115
111116 RFGDGEPAAALDFKGTDYELLPFGAGRRMCPGLAFGLANVELPLASLLFHFDWEVPGMAD 111295
111296 PTKLDMTEAFGIGVRRKADLIIRPILRVPVPGV* 111397

>AP003571.1b $F CYP71Y6 chromosome 6 clone P0458E02
80945 MEDASHGYVYLAMAVVALLGVLLTKRSRKATAQRLPPGPWQLPVIGSLHHLAGKLPHHAMRDLARRHG 81148
81149 PVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAATMGGRDIAFAPYGDR 81325
81326 WRQLRKIAATQLLSARRVASFRAIREEEVATMLRAVAAAAADGRAVEMRAALCVV 81490
81491 VADSTARAMVGESCQERDAFLREIDRSMELVSGFNPEDLWPSSRLAGRLSGAVRKIEAS 81667
81668 LHTVLGILDRIIQKRLQEKIGGAGAAAASEDILDVLLRIHKDGGAGGLQVPLDMDDITLV 81847
81848 IT 81853 (0)
83437 SMQLQNAHACALFLTIVSSTYSYSLFNDPPSLHMQDLFSGGGETVATLLVWAMAELIRN 83613
83614 PMAMQKATAEVRRAFALPGVVSEGEGALGELRYLHLVIRETFRLHPPGPLLLPRECSEPC 83793
83794 QVLGYDVPRGTQVLVNVWAIGRDERCWPAAAGGGSPEEFWPERFEDGAEAVDLRGNNFEL 83973
83974 LPFGAGRRMCPGVAFALANIELTLASLLFHFDWEVPGMADPAKLDMAEALGITARRKGDL 84153
84154 LLRPVLRMPVPGV* 84195

>AP003571.1a $F CYP71Y7 chromosome 6 clone P0458E02
67847 MADVLSQGYVYLAMALVALLGVLLTKCSRTATAQRRLPPGPWQLPVIGSLHHLIGKLPHHAMRDLTRRHG 68056
68057 PVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAGTMGGRDIAFAPYGDY 68233
68234 WRQLRKIAATELLSAPRVASFRAIREEEVAATLRTVAAAAADGRAVELRAALCAL 68398
68399 VTDSTSRAVVGDRCKESDALIRAFDRSMELASGFNPAADLWPSSRLAGLLSGGVREIEA 68575
68576 NLHTVFGILDRLIEKRLQQKKTAPSSAAGEDILDALLRIHKEGGGLQFPLDMDSIKLIIA 68755 (0)
73915 DLFSGGGETVATLLVWAMAELIRNPMAMQKATTEVRRAFALAGAVSEGKGALGELRYLHL 74094
74095 VIKEASRLHPPAPLLLPRECSEPCQVLGYDVPRGTQVLVNAWAIGRDERCWTGGSGDGSS 74274
74275 PEEFRPERFEDGAEAVDLRGNNFELLPFGAGRRMCPGMAFALANIELTLASLLFHFDWEV 74454
74455 PDMADPAKLDMTETLGITARRKGDLLLRPVLRMPVPGVY* 74574

>aaaa01011521.1b $FI CYP71Y8 (indica cultivar-group) 
6071 MADTSHGYVYIGLALVSLFVVLLDRRRRSPPPPAAH
6179 GDGGLRLPPGPWTLPIIGSLHHLVGKLPHHAMRDLARRHGPVMLLRIGQVPTLVVSSRDA 6358
6359 AREMMKTHDMAFATRPLSATLHVITCDGRDLVFAPYGDYWRQLRKIAVTELLTARRVNS 6535
6536 YRAIREEEVAAMLRAVAAAAEGSGAAAGTVEMRAALTALSTDITARAVFGNRCKDREEYL 6715
6716 AQVDHTIELTAGFNPADLWPSSRLAGRLSGIVRRAEECRDTAFKILDRIIQERLE 6880
6881 MARSDGAAGEYLIDVLLRIQKEGGLQFPLAMDDIKANIF (0) 6994
7066 DIFGAGSETSGTALAWAMAELIRNPTVMRKATAEVRRAFAAAGAVSEDGLGELPYLHLVI 7245
7246 RETFRLHPPLPLLLPRECREPCRLLGYDVPRGTQVLVNAWALGRDERYWPGGSPEEFRPE 7425
7426 RFEDGEATAAVNFRGADFEFLPFGGGRRMCPGIAFALATVELPLASLLFHFDWEVPGMAD 7605
7606 PTKLDMTEAFGITARRKADLHLRPLLRVSVPGV* 7707

>aaaa01011521.1a $PI CYP71Y9P (indica cultivar-group) 
1377 MADASDGYVYVG
1413 LAVVSLFVVLLAWRSRSPAAHGVGDGGLRLPPGPWTLPVIGSLHHLAGQLPHRAMRDLAR 1592
1593 RHGPLMLLRIGEVPTLVVSSRDAAREVMKTHDMAFATRPLSATLRVITCDGRDLVFAPY 1769
1770 GDYWRQVRKIAVTELLTVRRVSSFRSIREEEVAAVLRAVAAAAAVEEATPAMATVEMRAA 1949
1950 LSALVTDITARTAFGNRCKDREEYLVLLERIVEIAGGFNPADLWPSSRLAGRLKRCRAPR 2129
2130 RGVPQLGVILDGIIQEERTGAGSEDLVDVLLRIQKEGELQFPLAMDD 2270
2271 IKSIDIFNAGIETSGTTLQWAMAELIRNPTVM 2450
2451 HKATAEVRHAFAAAGDVSEDALGELRYLQL 2540 (deletion of about 104 aa)
2539 FDWEVPGMADLTKLDMTEAFGITARRKENLHLRPLLRVSVPAASS 2673
2674 RLRWTTTAFSICCHDTHLV*

>AL606625.1 $F CYP71Z1 chromosome 4 clone OSJNBa0032I19 similar to 71B28 = AQ858445.1
82576 MGASILLVVVVSKLMISFAAKPRLNLPPGPWTLPLIGSIHHVVSSRESVHSAMRRLARRHGAPLM 82770
82771 QLWFGEVGTVVASSPEAAREVLRSHDLAFADRHLTAAAAAFSFGGRDVVLSPYGERWRQL 82950
82951 RKLLTQELLTASRVRSFRRVREEEVARLMRDLSAAATAGAAVNLSEMVTRMVNDTVLRCS 83130
83131 VGSRCEHSGEYLAALHAVVRLTSGLSVADLFP 83226
83227 SSRLAAMVSAAPRAAIANRDKMVRIIEQIIRERKAQIEADDRAADSKSC 83373
83374 ACSLDDLLRLQKEGGSPIPITNEVIVVLLM 83463 (0)
84970 DMFAGGTDTSSTTLIWAMAELIRSPRVMAKVQSEMRQIFDGKNTITEDDLVQLSY 85134
85135 LKMVIKETLRLHCPLPLLAPRKCRETCKIMGYDVPKGTSAFVNVWAICRDSKYWEDAEEF 85314
85315 KPERFENNDIEFKGSNFEFLPFGSGRRVCPGINLGLANMEFALANLLYHFDWKLPNGMLH 85494
85495 KDLDMREAPGLLVYKHTSLNVCPVTHIASSCA* 85593

>AP003805.1 $F CYP71Z2 chromosome 7 clone OJ1080_F08, similar to AC087550.2
39% to 71B23
10416 MEDKVLLAVGASLVLVFLSKLISSYAKKPRLNLPPGPWTLPLIGSAHHLVSWSESVHSVIGKLAREHGPVMQ 10201
10200 LWLGEVPTVVASSPEAAQEILRDHDLIFADRHLTSTTAAITFGGTDVVMAQYGERWRHLR 10021
10020 KLLTQELLTVARVRSFRRVREEEVARLVRDLSAAAASGATVNLTDMVNRLVNDTVLRCSV 9841
9840  GSRCKYREEFLAALHAILHQTSALSVADLFPSSKLASMVATGPRNVLANRNKVERI 9673
9672  IEEIIQERKNQIETDMMSGNDDVGDKAAVESKSCSLDVLLRLQKEGGTPIPITNQVITVLLW (0)9487
3785  DMFGAGTDTSSTTLIWTMAELMRSPRVMAKVQAEMRQAFQGKNTITEDDLAQLSYLKMVL 3606
3605  KESFRLHCPVPLLSPRKCRETCKIMGYDVPKGTSVFVNVWAICRDSMYWKNAEEFKPERF 3426
3425  EDNDIELKGSNFKFLPFGSGRRICPGINLGWANMEFALANLLYHFDWNLPDGMLHKDLDM 3246
3245  QESPGLVAAKCSDLNVCPVTHISSSCA* 3162

>AC087550.2a $F CYP71Z3 chromosome 10 clone nbeb0016G17 74% to AC087554 seq 14167
132002 MDDKLLQLLLLALAVSVVSIVTISKLVYRATNKPRLNLPPGPWTLPVIGSLHHLVMRSPS 131823
131822 IHRSMRALAEKHGPLMQVWLGEVPAVVVSSTEAAEEVLKNQDARFADRFITTTLGAITF 131646
131645 GGGDLAFAPYGERWRHLKMLCTQQLLTAARVRSFRRIREEEVARLVRDLAASAAGGGEVA 131466
131465 VNLSERVARLVNDIMVRCCVGGRSKHRDEFLGALCTALSQTSWLTVADLFPSSRLARML 131289
131288 GTAPRRALASRKKMELILEQIIQEREEMTTDRSGDGEAGPTNECFLDVLLRLQK 131127
131126 EGDTPIPITMELIVMLLF 131073 (0)
       DIVSGGTETSTIVLNWTMAELIRTPRVMTKAHAEVRQTFQAKSTITEDDDISGL 129741
129740 TYLKMVIKESLRMHCPVPLLGPRRCRETCKVMGYDILKDTTVFVNAWAMCRSSIYWNDAE 129561
129560 EFKPERFENKCIDYKGSNFEFIPFGSGRRMCAGMNLGMADVEFPLASLLYHFDWKLPDGM 129381
129380 SPEDIDMQEAPGLFGGRRTSLILCPITRVAPSDLQVIV* 129264

>AC087550.2b $F CYP71Z4 chromosome 10 clone nbeb0016G17 same as seq on AC087544 from 
139422 MEDKLPLALTVLSVSVLIAVVISKLVSYATKPRLNLPPGPWKLPVIGSLHHLVGSHAIHR 139243
139242 SMRALAEKHGRHHLMQISLGEVFAVVVSSPEAAEEILRNQDVTFADRFLSTTIGVITFGG 139063
139062 NDMAFAPYGERWRQLRKLCTLELLSAARVRSFRRIREEEVARLVRDLAASAAAGEAVNLS 138883
138882 GRIAKLINDVVVRCCVGGRSEHRDEFLDALRTALDQTTWLTVADVFPSSKLARMLGTAP 138706
138705 RKALASRKKIEHILEQIIQERKRIMDRSSHGGDGDGEAMNTSECFLDVLLRLQKDGNT 138532
138531 PIPITNEVIVVLLF (0)
136455 DMFSGGSETSSSTLIWTMAELIRKPKVMAKAHVEVRQAFQGKNTITEDDGVNELTYLKMV 136276
136275 IKESLRMHCPVPLLGPRKCRETCKVMGYDIPKDTTVFVNAWAICRDPKYWDDAEEFQPER 136096
136095 FENKSIDFKGSNFEFLPFGSGRRMCAAMNLGIANVELPLASLLYHFDWKLPDGMMPEDVD 135916
135915 MQDAPGILVGKRSSLIMCPVTRVAPSNPQVIAS* 135814

>AP004790.1 $F CYP71Z5 (japonica cultivar-group) chr 2 
51668 MEDKTILLSLALSMLLAILLSKLVSISKKPRLNLPPGPWTLPVIGSIHHLASNPNTHRAL 51847
51848 RALSQKHGPLMQLWLGEVPAVVASTPEAAREILRNQDLRFADRHVTSTVATVSFDASDIF 52027
52028 FSPYGERWRQLRKLCTQELLTATRVRSFSRVREDEVARLVRELAGGGGAAVDLTERLGRL 52207
52208 VNDVVMRCSVGGRCRYRDEFLGALHEAKNQLTWLTVADLFPSSRLARMLGAAPRRGLASR 52387
52388 KRIERIIADIVREHEGYMGSGGDGGDEAAAAAAGKDCFLSVLLGLQKEGGTPIPITNEII 52567
52568 VVLLF 52582
55179 DMFSGGSETSATVMIWIMAELIRWPRVMTKVQAEVRQALQGKVTVTEDDIVRLNYLK 55349
55350 MVIKETLRLHCPGPLLVPHRCRETCKVMGYDVLKGTCVFVNVWALGRDPKYWEDPEEFMP 55529
55530 ERFENSDMDYKGNTFEYLPFGSGRRICPGINLGIANIELPLASLLYHFDWKLPDEMASKD 55709
55710 LDMQEAPGMVAAKLTSLCVCPITRVAPLISA 55802

>aaaa01000393.1 $FI CYP71Z6 (indica cultivar-group) 89% to AP005114.1b
9756 MEDKLILALCLSALFVVVLSKLVSSAVKPRLNLPPGPWTLPLIGSLHHLAMTKSPQTHRSLRALS 9562
9561 EKHGPIMQLWMGEVPAVVVSSPAVAEEVLKNQDLRFADRHLTATTEEIFFGGRDVIFGP 9385
9384 YGERWRHLRKICMQELLTAARVRSFRGVREGEVARLVRELAASAAGAGAGAVGAAAGVNL 9205
9204 NERISKLANDIVMVSSVGGRCSHRDEFMEALEVAKKQITWLSVADLFPSSKLARMVAVAP 9025
9024 RKGLASRKRMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVP 8848
8847 VTDEIIVVLLF (0) 88315
4681 DMISGASETSPTVLIWTLAELMRNPRIMAKAQAEVRQAVAGKTTITEDDIVG 4526
4525 LSYLKMVIKETLRLHPPAPLLNPRKCRETSQVMGYDIPKGTSVFVNMWAICRDSRYWEDP 4346
4345 EEYKPERFENNSVDYKGNNFEFLPFGSGRRICPGINLGVANLELPLASLLYHFDWKLPNG 4166
4165 MAPKDLDMHETSGMVAAKLITLNICPITHIAPSSA* 4058

>AP005114.1b $F CYP71Z7 (japonica cultivar-group) chromosome 2 
120645 MEDNKLILALGLSVLFVLLSKLVSSAMKPRLNLPPGPWTLPLIGSLHHLVMKSPQIHRSL 120824
120825 RALSEKHGPIMQLWMGEVPAVIVSSPAVAEEVLKHQDLRFADRHLTATIEEVSFGGRDVT 121004
121005 FAPYSERWRHLRKICMQELLTAARVRSFQGVREREVARLVRELAADAGAGGDAGVNLNER 121184
121185 ISKLANDIVMVSSVGGRCSHRDEFLDALEVAKKQITWLSVADLFPSSKLARMVAVAPRKG 121364
121365 LASRKRMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVPVTDE 121544
121545 IIVVLLF (0) 121565
122803 DMFTGASETSPTVLIWILAELMRCPRVMAKAQAEVRQAAVGKTRITENDIVGLSYLKMVI 122982
122983 KEALRLHSPAPLLNPRKCRETTQVMGYDIPKGTSVFVNMWAICRDPNYWEDPEEFKPERF 123162
123163 ENNCVDFKGNNFEFLPFGSGRRICPGINLGLANLELALASLLYHFDWKLPNGMLPKDLDM 123342
123343 QETPGIVAAKLTTLNMCPVTQIAPSSAEDAS* 123438

>AC087544.2 $F CYP71Z8 chromosome 10 clone nbxb0046P18, 
14167 MEDKLLLLLALAVSVLVAVVISKLVSYATKPRLN
14065 LPPGPWTLPVIGSIHHLVGSHPIHRSMRALAEKHGRDLMQVWLGELPAVVVSSPEAARDV 13886
13885 LRSQDLAFADRYVSTTIAAIYLGGRDLAFAPYGERWRQLRKLCTQRLLTAARVRSFRCVR 13706
13705 EEEVARLVRDLAASAAAGEAVDLTARVAELVNDVVVRCCIGGRRSRYRDEFLDALRTALD 13526
13525 QTTWLTVADVFPSSKLARMLGTAPRKALASRKKMERILEQIIQERKQIKERSTGAGAGAD 13346
13345 DEAAAAGNECFLDVLLRLQKEGDTPIPITNETMMLLLH 13232 (0)
10760 NMFSAGSETSSTTLNWTMAELIKSPRVMAKVHDEVRQAFQGKNTITDDDVAKLSYLKMVT 10581
10580 KESLRMHCPVPLLGPRRCRETCKVMGYDVPKGTIVFVNAWAICRDSKYWKSAEEFKPERF 10401
10400 ENISIDYNGNNFEFLPFGSGRRICPGITLGMANVEFPLASLLYHFDWKLPNQMEPEEIDM 10221
10220 REAPGLVGPKRTSLYLHPVTRVAPSSV* 10119

>aaaa01088222.1 CYP71Z9/10 two seqs. joined see Zea mays ortholog
247 MEENKALLAAVSLSILLVILSKLKSFLATKPKLNLSPGPWTLPVIG
SLHHLVRSPNIYRAMRALAQKHGQLMTLRLGEVQCM 2
623 AIAMAF RQTSVLTLADLFPSSRLMQALGTAPRKVLACRDKIQRILEQVIQEKAQEMGRGDEATAGNEGFV 414
413 GVLLRLQKEGSTPVQLTNDTIIAVLY (0) 351
207 DMFSAGSETSSTTLNWCMTELVRSPVVMAKAQ AELRDAFKGKNTITENDLEGLSYLKLVI 28
27  KEALRMHAP 1

>Zea mays ortholog of CYP71Z9/10 Note 71Z9 and 71Z10 probably from the same gene. 
MEQKVLVAVGVAVLLVVVLSKLKSVLVTKPKLNLPPGPWTLPLIGSTHHLVTS
PSIYRAMRDLAQKYGPLMMLRLGEVPTL VVSSPEAAQAITKTHDIAFADRHMNTTIGVLTFNGT
DLVFGPYGERWRQLRKICVLELFSVARVQSFQRIREEEVARFMQSLAASAGTVNLSK
MISRFINDTFVREFIGSRCKYQDEYLD AFDTAVRQTSVLTVADLFPSSRLMQAVGT
APRNALKCRNRITRILEQIIREKVEAMGRGEKTAHEGLIGVLLRLQKEANLPTLLTNDTIVALMF (0)
DLFGAGSDTSSTTLNWCITELIRHPAAMAKAQAEVREAFKGKARIISEDDLAGAGLSYLK
LVIKEALRMHCP
LPLLLPRLCRETCQVMGYDIPKGTAVFINVWAVCRDAKYWEDPEEFRPERFEDTNLEYN
YKGTNYEFLPFGSGRRMCPGANLGLGNIELALASLLYHYDWKLPDGVKPQDVQVWEGPGL
IAKKKTGLLLRPVTCIAFACSSG*

>AP004326.2d $P CYP71AA1P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete 
81031 DFFFCGLETTTTATIWAI*EFIKNPHAVEKAQSDIRKILGGKSIVEEADIEGQLHYFQMVN 81213 frameshift
81213 QETLRLHPPVPLLLPRLWSEPCKIMGYDIP 81302 frameshift
81304  KNTAIFVNTWALGR 81345 frameshift 
81344 KIKNTGLMQVSSGLKY
81393 SRMGIVDFNGLDFRFLPCGAGRRICLGLMFELSDIELTLASLLYHSSWRLPTRSYSNK 81566
81567 LDMTEANGITTHRRIDIWLEATPFVPR 81647

>AP004326.2c $F CYP71AA2 genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete 
77487 MAGIMDSTTASYYTTLLCG
77544 ALLLAAVVFKLKTAAAFSRHNAGVNLPPGPWALPVIGSIHCLLGSLPHHAMRELSRRY 77717
77718 GPVMLLRLGHVRTLVLSSPEAAREVMKTHDVAFANRAVTPTASIDIVFAPFG 77873
77874 KHLRELRKLCALELLSPRRVRSFRHVREEEAARLARSVAAAASASSAVNVSELVKIM 78044
78045 TNDVTMRAIIGDRCPQREEYLEALDKTMDLLAGFNLVDLFPGSPLARVLGGRSLRTTKRV 78224
78225 HEKLHQITEAIIQGHGIKDTVGDEHHECEDILDVLLRFQRDGGLGITLTKEIVSA 78389
78390 VLF 78398 (0)
78554 DLFAGGSETTSTTILWAMSELMRSPHVMEQAKYEIRQVLQGKAMVSEADIEGRLHYLQLV 78733
78734 IKETLRLHPPVPIVIPRLCSKPNSKIMGYDIPQGTSVLVNVSAIGRDEKIWKDVNEFRPE 78913
78914 RFKDDIVDFSGTDFRFIPGGSGRRMRPGLTFGVSNIEIALVTLLYHFDWKLPSETDTHEL 79093
79094 DMRETYGLTTRRRSDLLLKATPSYARLGWSTNMQIYSVKCLVYE* 79228

>AP004326.2b $F CYP71AA3 genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete 
71860 MAGIVDTAAFCT
71896 LLCLLLTLVVFKLKTATSSRHNAGVNLPPGPWALPVIGSIHCLLGSLPHHAMRELSRR 72069
72070 YGPVMLLRLGHVRTLVLSSPEAAREVMKTHDAAFATRAVTPTASILTYGARDIVFAPF 72243
72244 SKHLRELRKLCTLELLSPRRVRSFRHVRDEEAARLARSVAAAAPAVVNVSELVKI 72408
72409 MANNIIMTAIIGDTCPQRDEYLEALDKTMDLMNGFNLIDLFPGSRLARVLGARSLRATKR 72588
72589 VHQKLHQITDTIIQGHEIIKDGSVGDDTIQETVGTHNMHGHGHKCEDILDVLL 72747
72748 RFHRDGGLGITLTKEIVSAVLF 72813 (0)
73327 DLFAAGSETTSTTIIWAMSELVRTPHVMERAQSEIRQVLQGKTVVSEADIEGRLHYL 73497
73498 QLVIRETLRLHPPVPFLIPRLCSEANSKIMRYNIPQGAMVLVNISAIGRDEKIWKNANEF 73677
73678 RPERFKDDMVDFSGTDFRFIPGGAGRRMCPGLTFGLSNIEIALASLLYHFDWKLPNDASS 73857
73858 CKLDMRETHGVTARRRTELLLKATPLYT* 73944

>AP004326.2a $P CYP71AA4P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete 
67989 LPPVPWPLPVIGSMH*LLGSLPHH 68060 
68060 RPACAVELLSPRRARSFRRVREAEPARLVRAVAASPAWPLVNVVGGEHVAAMMTAV 68227
68228 GARP 68239 
68238 RCPRQEEYLEELGKVAKLAAGFNLVDLFPESRLVRAAQAAHGKIHSIMDAMVQ 68396
68397 DHLKAMEERREEVADGVVDDGDGDGADRDEELLSILLRFQRDGGLGITLTNGNHQRDS 68570 (0)
68886 GILAGGSDTTTTTVMWAMSELLRCPRAMQ 68972 
69023 YMQLVIKETLRLHLPFPLLFPRLCTETCKIMGFDVPKGTIVIVNNWAISRDERCWEDAED 69202
69203 F*PERFEHDDTDYNGTYFQFLSGGFGRRMFPDFIFAQFNIEIALANLLYHFDWELPCSEN 69382
69383 RMELDMTESAGLTASRLTDLFG* 69451

>aaaa01051575.1 CYP71AA5 (indica cultivar-group) 69% to AP004326.2b
855 DVFAAGSETTATATIWAMSELVRTPRLMERAQAEIRQLLQGKTRVAEEDIQGRLPYLQMV 676
675 IKETLRLHPPAPLILPRLCAESTKILGFDVPEGTTVFVNAWALGRDDKSWVDANEFKPER 496
495 FEDDDRVDFSGADFRFIPGGSGRRMCPGLTFGLANIETTLANLLYHFDWKLPGGANPYEL 316
315 DMAESYGITARRTTDLLLEATPYVPHGSVS* 223

>Zea mays/ Saccharum officinarum possible ortholog of 71AA5 CG055548, CG372667
AETTPAVWYTLLCLLAGVAVLLKLKT KPSPSRHGAGASA
LPLYLLPPGPRPLPVIGNLHCLLGALPHH
AMRALARRYGDVVLLRLGHVPTVVVSSPEAAREVMRTHDAVVSNRPLYVTADVLSYGGQN
IAFAPSGSPHWKELRRLCAAELLSPRRVLSFRPVREEEAACLVRSVDAASPPPFLVNVSE
RVKALMNDVLMRCAVGDTCRMRDEYIAELDEALRLLAGFNLVDLFPGSRLARALGAGSLR
AAREVHGRVHRIVQAIIQDHASKAADDGAGSRDEDILDVLLRLQRDGGLETVLTTQVLCGVLF (0?)
DVFAAGSETTATTTIWAMSELAKNPGVMRRAQSEVRRVLEGKTRVAEADIQGRLPYLQAV
IREALRLHPPLPLILPRSCAEPITILGHHVPKGTTVFVNAWAIGRDERWWPDASQFKPER
FEGEGVVDFSGADFRFLPGGGGRRMCPGLTFGVANVEIALASLLYHFDWELPGGADPGAL
DMGEAYGITARRKTDLVLKATPFVPTN*

>AC113337.1 $F CYP71AB1 (japonica cultivar-group) cultivar Nipponbare clone 
23542 MANLIYYSLLIILPFLLLINFYKAMFSSRKQAGRLPPCPWQLPIMGSIHHLIGDLPHRSL 23721
23722 HDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFAMRPQSEIMKIITKRGQGLV 23901
23902 FAPYDDQWRQLRKICIRELLCAKRVQSFCAIREEEAARLVKSISSDQAHLVNLSKKLADY 24081
24082 ATDAAIRIITGTRFENQEVRDKFQYYQDEGVHLAASFCTANLCPSLQLGNTLSRTARKAE 24261
24262 IYREGMFAFIGGIIDEHQERRAQDMYHKEDLIDVLLRIQQEGSLESPVSMETIKFLIF (0)
      DILAGGSETVTTVLQWAMTELMRNPTVMSKAQ 24621
24622 DEVREVFKWKKMVSNDDINKLTYLQFVIKETVRLHTPGPLFMRECQEQCQVMGYDVPKGT 24801
24802 KFLLNLWSISRDPKYWDDPETFKPERFENDARDFKGNDFEFIPFGAGRRMCPGMLFGLAN 24981
24982 IELALANLLFYFDWSLPDGVLPSELDMTENFGVTVRKKEDLLLHASLYAQLSC* 25143

>AP004684.1b $F CYP71AB2 chromosome 6 clone P0012H03, Length = 163117
New seq similar to AP004000 57% to AP003523.1 78% to AP004688.1  
36% to 41% with 71A and 71B sequences possibly new subfamily in 71
117908 MDAAVFCCLLALLPLLHYLITLFLHGSRDSDLRLPPGPWRLPLIGSLHHLF 118060
118061 FGALPHRALRDLARRHGPLMLLAFGDAPVVVVASTAGAAREILRTHDDNFSSRPLSAV 118234
118235 VKVCTRRGAGITFAPYGEHWRQVRKICRLELLSPRRILAFRAIREEEAARLVRAIGVASP 118414
118415 PLVTNLSELLGNYVTDTTVHIVMGERFRERD ALLRYVDEAVRLAGSLTMADLFPSSRLAR 118594
118595 AMSSTTLRRAEAFVESLMEFMDRVIREHLEKKRSCQGGEREEDLIDVLLRLQAEGSLHFE 118774
118775 LTMGIIRAVIF 118807 (0)
118932 DLFSGGSETATTTLQWAMAELMRNPGVMSRAQAEVREAYKDKMEVTEEGLTNLTYLQCII 119111
119112 KETLRLHTPGPLALPRECQEQCQILGYDIPKGATVLVNVWAICTDNEFWDESEKFMPERF 119291
119292 EGSTIEHKGNNFEFIPFGAGRRICPGMQFGIANIELALANLLFHFDWTLPEGTLHSDLDM 119471
119472 TETMGITARRKEDLYVHAIPFVQLP* 119549

>AP004688.1 $F CYP71AB3 chromosome 6 clone P0036C11, Length = 137929
57304 METAELCCLLALLPLVYCLLTLFHGSRESDLRLPPGPWRLPLIGSLHHLFGRTLPHRA 57477
57478 LRDLARLHGPLMLLSFGQAAPVVIASTAIAAREIMRTHDDNFSTRPLSTVLKVCTRYGA 57654
57655 GMTFVPYGEHWLQVRKICSLELLSPRRILKFRSIREEEVARLVLAIASSSTPTPTPPAPV 57834
57835 NLSKLLSNYMTDATVHIIMGQCFRDRDTLVRYVDEAVRLASSLTMADLFPSWRLPRVMCA 58014
58015 TTLHRAEVFVESVMEFMDRVISEHLEKRSCQGGDREEDLIDVLLRLQAEGNLEFELSTSI 58194
58195 IKAIIF 58209 (0)
58290 ELLAGGSEAPITTLQWAMAELMRNPDVMSRAQAEVREAYKEKMKVTEEGLTNLPY 58469
58470 LHCIIKETLRLHTPGPFVLPRKCQEQCQILSYDVPKRATVVVNIWAICRDAEIWDEPEKF 58649
58650 MPDRFEGSAIEHKGNHFEFIPFGAGRRICPGMNFALANMELALASLLFYFDWSLPEDVLP 58829
58830 GDLDMTETMGLTARRKEDLYVCAIPFVQLP* 58919

>AP003523.1b $F CYP71AC1 chromosome 6 clone P0416A11 six different genes
118132 MDLMKSNPLQGSPWSL
118084 LNLLVLIIVAAMICGELCRRRRRRRGDENGGATRLPPGPWRLPFVGSLHHLAVMRPRGVV 117905
117904 VHRALAELARRHDAPVMYLRLGELPVVVASSPEAAREVLKTHDAAFATRAMSVTVRESIG 117725
117724 DKVGILFSPYGKKWRQLRGICTLELLSVKRVRSFRPIREEQVARLVDAIAAAAASS 117557
117556 TAEAAAVNISRQITGPMTDLALRAIMGECFRWREEFLETLAEALKKTTGLGVADMFPSSR 117377
117376 LLRAVGSTVRDVKLLNAKLFELVECAIEQHREQIRAAHDNGGDDDDAHGHGDKECFLNTL 117197
117196 MRIQKEGDDLDD 117161 LTMATVKAVIL (0)
       DMFAGGSESTSTTLEWALSELVRNPHVMQKAQAEIRHALQGRTRV 115967
115966 TEDDLINLKYPKNIIKETLRLHPVAPLLVPKECQESCKILGYDVPKGTIMFVNAWAIGRD 115787
115786 PRYWNDAEVFMPERFEKVAVDFRGTNFEFKPFGAGRRMCPGITFANATIEMALTALLYH 115610
115609 FDWHLPPGVTPDGLDMEEEFGMSVSRKRDLYLRPTLHMGLETI* 115478

>AP005610.1 $F CYP71AC2 (japonica cultivar-group) chr 6 = AP005192.1
115277 MDMEMGKLLHRPWKWSLNSPLLLLLIVPVMIHVQLKLRRRRKNAAAGTRLPPGPWRLPVI 115456
115457 GSLHHLAMNPKAVHRALADLARRCGGGGGVMYLRLGELPVVVASSRDAAREVLRTHDAAF 115636
115637 ATRAMSVTVRDSIGDTVGILFSPYGERWRRLRGICSLELLNARRVRSFRPIREEQVARLV 115816
115817 GAIAAAAAAPGGDQPPPVNVSWQIAGALTDLTLRAIMGECGFRWREEFLETLGEAQRKAS 115996
115997 RFGVADLFPSSRLLRAVGSTAVRDVRALNAKLFELVDRAIEQHREAAATTAAGGDHDDGG 116176
116177 DDDARDDNECLLNTLMRIQKEGGGTLSMSTVKAVIL 116284
118153 DMFAGGSETTSTILEWAMSELVKNPQVMQKAQAQIRLALQGRSRITEDDLINLSYPKNII 118332
118333 KETLRLHPVAPLLMPKECQESCKILGYNIPKGSIMLVNVWAIGRDHRYWDDAEVFLPKRF 118512
118513 EEITVDFGGTNYEFIPFGGGRRICPGITFAHATLELALTALLYHFDWHLPPSVTPDGLDM 118692
118693 EEEFGMNVRRKRDLHLHPVIHVGVEKGIMS 118782

>aaaa01007044.1 $PI CYP71AC3P/AC4P (indica cultivar-group) seq gap at 5222 no Nterm MDKSGTDELNLLWSCSLNLTLLLLLLVPAGIHIVSLKLRRRRENASTDGLRLP 
160156 AMNR*VVHRALADLVRRCDDLAPLMYLCLSELRVVVASTPDAAREVLKTHDAAMSTAVSANF 159971
159950 FAPYGKRWRHLRGICTLELLSAKRVRSFRPIREEQDTRLVGAVVAAAAPSGEPVNVRRLI 159771
159770 GRPMTDLALRAIMGE 159726 
159714 VRTAATSAVRDVKLLSAKLYDMVGRAIEQHQEHADDGGTHGNRECLLS
TLLRIPKEGDNNDDGGDLTMANVKAVIL 
DMFAGGSETTSTTLEWAL 
PEVMQKAQAEIRHALQGKSRVTEDDLINLKYPKNIIKETMRL
HPLASLLVPRKCQESCKILGYDIPKGTILIVNVWTIGRDHRYWDDAEVFIPERFEDTT
IDFKGTHFEFISFGAGRRMCLGMTFAHATIELALTALLYHFDWHLPHGVTHDGMDMEE
QFSVTVSRKRDLYLHPIQHVGVEEI*

>AL606658.1 $P CYP71AC5P chromosome 4 clone OSJNBb0016D16 lone pseudogene fragment
120987 SALNVSWQITGTLTDLTLHAIMGECGFRWHEEFLETLGEAQKKATRFGVADLFPSSRLLPAVGSRSGD 120784

>AP004571.1 $P CYP71AC6P (japonica cultivar-group) chr 6 94% to AAAA01013200.1
60465 ALNVSRQITGTLTDLTLRAIMWECGFRWREEFLETLGEAQKKATRFGVADLFLSSRLLPA 60286
60285 VGSRSGD 60265

>aaaa01017762.1 $PI CYP71AC7P (indica cultivar-group) 89% to AL606658.1
4196 ALNVSRQITGTLTDLTLRAIMGECGFRWREEFLETLGEAQKKATRFGVADLFPLSRLLPV 4017
4016 IRSRSGD 3996

>AC109595.1 $F CYP71AD1 chr 5 39% to 71As 40% to 71Bs 
72095 MEIELSPVLLLLPFLLLGFLYLTGGVLRSGGNARRRLAPAPRGLPVIGNLHQVGALP 71925
71924 HRALRALAAATGAPHLLRLRLGHVTALVASSPAAAAAVMREHDHVFATRPYFRTAEILTY 71745
71744 GFKDLVFAPYGEHWRHARRLCSEHVLSAARSHRYGPMREQEVALLVNAIRTEAAAAAV 71571
71570 DVSKALYAFTNAVICRAVSGRLSREDEGRSELFRELIEENATLLGGFCVGDYFPALAWA 71394
71393 DAFLSGFAARACRNLRRWDELLEEVIAEHEARLRGGDDGGGEEHREEDFVDVLLALQE 71220
71219 ESQRHDGSFKLTRDIIKSLLQDMFAAGTDTSFITLEWAMSELVKNPAAMRKLQDEVRRGG 71040
71039 GATTAATPYLKAVVKETLRLHPPVPLLVPRECARDTDDDATVLGYHVAGGTRV 70881
70880 FVNAWAIHRDAGAWSSPEEFRPERFLPGGGEAEAMDLRGGHFQLVPFGAGRRVCPGMQFA 70701
70700 LATVELALASLVRLFDWEIPPPGELDMSDDPGFTVRRRIPLRLVAKPVGSEDDK* 70536

>aaaa01019060.1 $FI CYP71AE1 (indica cultivar-group) one stop in exon 2
4042 MASLATVPNLPLLLLLHYALATFTASRARKNNKDRLPPSPLALLVIGHLLHLMGSLPRTSPSAASPHG 3839
3838 TGPTCSSGLAPCRCSLRRRRVPAAEAILRTHDHVFASRPRTVLLANIVFYRSRDVRFAPY 3659
3658 GDHWRQARKLVTTHLLSAKKVRSLRLAREEE (0) 3584
2413 VSLVMTKISKAATASAVVDIGQILRSFTNDMICRTVSGKCPRDDR*KRIFQELANETSLL 2234
2233 LGGFDIEEYFPVLARVGLVGKMMCLKAERLKKRWDELLEELINDHENDDHSCNLISDQND 2054
2053 EDFVDILLSVRQEYGFTREHVKAIL (0) 1979
1622 DVFFGGIDTSALVLEFTIAELMQRPRMLKKLQDEVRACIPKGQKIVSEVDINNMAYLRAV 1443
1442 IKEGIRLHPVAPVLAPHISMDDCNIDGYMIPSGTRVLVNVWAIGRDPRFWEDAEEFVPER 1263
1262 FIDSMSSAAANVNFTENDYQYLPFGYGRRMXPGMKFGIAVVEIMLANLMWKFDWTLPPG 1086
1085 TEIDMSEVFGLSVHRKEKLLLVPNNMSSC* 996

>AC132003.1 $F CYP71AE2 (japonica cultivar-group) chr 11 65% to aaaa01019060.1
MDEMAARTWLWLLLSPLI
LLLLHYALALLTARRARKNPLPPSPPALPFIGHLHLIGALPHVSLCCLATKHAPDLMFLR
LGTSLPVLVASSPCAAEAILRTHDDVFASRPRTVLADIIFYGSRDIGFAPYGEDWRQARK
LVNTHLLSVNKVQSLWLAREEE
34501 VKIVMEKISKAAFAREAVDIGQILCSFTNDLACRVVSRKLVGDDRQKKLLQELVNKTIKL 34322
34321 LSIFNVEEYFSILARIGVIGKVMCARAERLKKKWDMLLKKLIADHESKCDSYLVCGRNKD 34142
34141 DFVDILLSVRKEYGLTEEHVKAILE 34067 (0)
33575 DVFIAGTQSSARVIEFTFAELMRKPHMLKKVQDEVRACIPNGQAIVSEVQVNNMTYLRA 33399
33398 VVKEVLRLHPVAPLLATHVSMADCNINGYMIPSGMRVLVNAWAIGRDERFWYDPEKFMPE 33219
33218 RFVESVNGSATASVNFWVNNYQYLPFGSGRRMCLGMNFAMAVIEITLANLLWKFDWALPA 33039
33038 HAMEVDMSEEFGLSVRLKEKLLLVPKQHV* 32949

>AP003523.1a $F CYP71AF1 chr 6 clone P0416A11 six different genes 
112855 MEQYLFLATLLILSLAFVKLRPRNNGENPPPGPWQLPVIGSLHHLAGALPHRALRDLA 113028
113029 TRHGELMLLRLGELPVVVASSPAAAREVMRTHDAAFATRPQTATLRALTRDGLGVAFAPQ 113208
113209 GEHWRCLRKLCVTELLGARRVRCLRRAREAEAAALVASLSTTTPEPVNVS 113358
113359 SLVARYVTDAVVRAVVGDRISDRDAFLERLEEGVKVAAGFTLADVFPSSRLARALSGTAR 113538
113539 RAEAHSREMTRLMDGVIEEHRQRRAATGWRDEEDEDLLDVLLRIQKDGGLQIPLDMGTIRAIII 113730 (0)
113831 DLFSAGSETTGTTLQWAMAELMRNPAALRKAQAEVRGVLAGHSHVTEDALPDLHYLHL 114004
114005 VIKETLRLHVAVPLLLPRECQEPRLRVLGYDVPERAMVLVNAWAICRDTAVWGPDAEEFR 114184
114185 PERFDGGAVDFKGTDFEFVPFGAGRRMCPGVAFAVAIMELGLASLLFHFDWELAGGTAA 114361
114362 GELDMAEGLGITARRKSDLWLHATVSVPVPNTETS* 114469

>aaaa01066426.1 CYP71AG1 (indica cultivar-group) 39% to AP003434.1
APHGPYWX 
809 RARKASVRHLLSPPRVRAYRAVREQEVAALLRRVTEQACGGGVVRLSELLSGFAKDVA 636
635 GRIVLGVRAGAGGDGGGWR ARMDALLEESNVLLGAFHAGDYVPWLSWVSAVDGT 474
473 DARVRTAFEKIDRILDEIVDAAAARDTPSSSPGPGNG TDGDSDAFIHLLLSLQREGTEEW 294
293 RLTRDNVKALLE (0)
    DLFGAGTEATIIVLEWAMAELLRDKGAMGNLQREVR 57

>Triticum aestivum ortholog of 71AG1 CK207340 FGAS: 
MEDAILLFLLPV
ATTMSILLLLRAARSNPQKRPHRSKLATVPPPSPGGGALVGNLHXLAGGRLPHRALAALA
AAHGPVMLLRLGQVPAVVLSSPDAAREVMLAQDHVFATRPSLAIPSKLFYGCTDVAF APH
GPYWLRARKTCVLHLLSPARVRAYRAVREEEVGALLDKVRRQARVVPLSELLAGFGKDVI
GRIVFGASAATRADGWGARXQVDALLEEGKALLGTFHGGEYFPTWRGLAPWDGR
EAQVGKGFDRIHGVLEEMADPGERPMGGAQRGKGLG

>AK120767 CYP71AK1      2904 bp    mRNA    linear   PLN 29-OCT-2003
869 MSSYVVVAAALLVFVVVVVAAIKNLGKGKLPPSPPSLPFVGHLHLVGELPHRSLDALHRR 690
689 YGSDGGLMFLRLGRAGALVVSTAAAAADLYRGHDLAFASRPPSHSAERLFYGGRNMSFAP 510
509 LGDAWRRTKKLAVAHLLSPRRAR 441 
439 RAQRGAGAVQPRELRTPNKK
GVITRVAAGGSGATAERFRKMMADTSELLAGFQWVDRLPEAAGWAARKLTGLNK
KLDDMADESDRFLGEILAAHDDEKAEGEEEDFVDVLLRLRRQGAAAAGGLELAEDNVKAIIK (0)
DIMGAATDTSFVTLEWIMTELIRNTQVMSKLQNEIIQVT
GSKPTVTEEDLTKLDYLKAVIKEVLRLHPPAPLLIPHHSTMPTTIQGYHIPAKTIAFINV
WAIGRDPAAWDTPDEFRPERFMGSAVDFRGNDYKFIPFGAGRRLCPGIILALPGLEMVIA
SLLYHFDWELPDGMDVQDLDMAEAPGLTTPPMNPVWLIPRCRTI*

>AK120674 CYP71AK2 = OLD CYP71Z12 mRNA    linear   PLN 29-OCT-2003
44 MYHYVFLAAVALLAVVGY 97
  98 GVKNRRRRSAKLPPSPPSVPFLGHLHLLGPLLHRSLHELHLRYGTDGGLLLLQLGRRRTL 277
 278 VVSTAAAAADLYRNHDLAFASRPLVAAAHKLSYGSKNITFAPFGEQWRRAKKTAVVHALS 457
 458 PRRVEAFAPVRAAEAAALVAATRRAADAAADGGAVELRDLLYSYTNAVVTRAATG 622
 623 AAGTTAEKLKQLLGNATSLVAGVQADDLLPGMAAKAVRWATGLEKQYDASMEEWDKF 793
 794 LSPIMAEHAEKKKKKREDIGAGEEDFIDVLLRLKEEDTELTDTHVKSRVVDLI 952
 953 AAATETTSVTLEWTMAELAANPRVMAKLQEEIARATGGKPAITEAEVGGMEYMKAVVKEV 1132
1133 LRLHPPAPILVPHESTAAAAVQGYEIPARTSLFVNAWAIGRDPAAWGSPEEFRPERFLA 1309
1310 GGPAVDFRGNDYQLVPFGAGRRICPGISFAVPVLEMALVALLHHFDWELPAGMR 1471
1472 AAELDMSEAPGLTTPLRVPLRLVPKRKAPLA* 1567

>CYP72A17 $F AP002839 Oryza sativa genomic DNA, chromosome 1 36553-39431
MGIGIGIGIGIGIGTGTGAALPFGEASPWSLLGGAVAALLLVWAAQMLEWAWLAPRRMERALR
AQGLRGTQYRFLHGDLTEDLRLVTAARSKPVPMDRPHDFIPRVAPLLHRALEEH 
GRVSFTWFGPMPRVTITDPDLVREVLSNKFGHF
EKTKLATRLSKLLVGGLVILHGEKWVKHRRIMNPAFHAEKLK 
RMLPAFSASCSELIGRWENAVAASVGKAELDIWPDFQNLSGDVISRAAFGVRHHEGRQ
IFLLQAEQAERLVQSFRSNYIPGLS 
LLPTENNRRMKAIDREIKSILRGIIEKRQKATKNGEASKDDLLGLLLQSNMDYYSDEDGKS
SKGMTVEEIIDECKLFYFAGMETTAVLLTWTMVALSMHPEWQDRAREEILQVFGRNKPDI
NGVSRLKV 
VTMVLHEVLRLYPPVVMMNRRTYKEIELGGVRYPAGVMLSLPVLFIHRDAAAWGHDAGEF
DPGRFAEGVARACKDPGAGAFFPFSWGPRICIGQNFALLEAKVALGMILQRFAFELSPAY
AHAPYTVLTLHPQHGVPVRLRRL*

>CYP72A18 $F AP002839 Oryza sativa genomic DNA, chromosome 1 44993-41630
MLMMLGAASQWILAAAAAAAVAALLWLAVSTLEWAWWTPRRLERALRAQG 
IRGNRYRLFTGDVPENVRLNREARKKPLPLGCHDIIPRVLPMFSKAVEEH 
GKPSFTWFGPTPRVMISDPESIREVMSNKFGHYGKPKPTRLGKLLASGVV 
SYEGEKWAKHRRILNPAFHHEKIK 
RMLPVFSNCCTEMVTRWENSMSIEGM 
SEVDVWPEFQNLTGDVISKTAFGSSYEEGRRIFQLQAESAERIIQAFRTIFIPGYW 
FLPTKNNRRLREIEREVSKLLRGIIGKRERAIKNGETSNGDLLG 
LLVESNMRESNGKAELGMTTDEIIEECKLFYFAGMETTSVLLTWTLIVLS 
MHPEWQERAREEVLHHFGRTTPDYDSLSRLKI 
VTMILYEVLRLYPPVVFL 
TRRTYKEMELGGIKYPAEVTLMLPILFIHHDPDIWGKDAGEFNPGRFADG 
ISNATKYQTSFFPFGWGPRICIGQNFALLEAKMAICTILQRFSFELSPSY 
IHAPFTVITLHPQHGAQIKLKKI*

>CYP72A19 $F AP002839 Oryza sativa genomic DNA, chromosome 1 comp(53699-51708)
MDPTSVPWSSMVYGLLGLALLWQVHRLLVRLWWQPRRLERALRAQGVRGTSYRFLTGDLKDYGRLS
KEAWARPLPLRCHDIAPRVAPFVHRTIAEHGKACLSWFGPIPKVTIADAEIAKDVLSNKMGHFEKLKFPVLS
KLLADGVANYEGEKWAKHRRILNPAFHLEKLK 
LMLPAFSACCEELVGRWAASLGSDGSNEIDVWPEMQSLTGDVISRTAFG
SSYLEGRRIFQLQAEQQELFMGAIQKISIPGYM 
SLPTKNNRRMYQIKNEVESIIRDLVQKR
MHAMKDGERTKDDLLGILLESSTRHADENGHSGPGMTIEEVMEECKVFYFAGMETTAILL
TWTMVVLSMHPEWQHRAREEV LSLFQKNKLDYEGLSKLKT 
VTMILYEVLRLYPPGIGFVRQTYKEMEIGGVKYPAG
VMIELPLLFIHHDPDIWGSDVNEFKPERFAEGISRASNDHGAFFPFGWGPRICMGQNFAL
LEAKMALCMILQRFEFELAPSYTHAPHIVLMLRPMHGAPIKLRAI

>CYP72A20 $F AP002839 Oryza sativa genomic DNA, chromosome 1 56581-59004
MEVGVSLEAGKPAAAPWGMLYYGVPALLVLGALYRAAERCWLGPRRVAGALQGQGLRGTAYRFPAGDL
PENARRSKEARAKPMPPCHDIVPRVAPLLQDIVKEY 
GNVCITWFGTTPRVVIAEPELVKDILSNKFGHFEKFTLKSLGKLIALGLASYEGEKWARH
RRILNPAFHLEKLK 
HMLPAFSTCCSEMIDRWDSKLAGSDGPFELDIWQEFQNLTGDVISRTAFGSSFMEGRRI
FQLQEEQADRIIKTIQYIYIPGYL 
VSCRYFPTENNRRMKENSREIEGLLRGIIEKRSRAVENGELSGDDLLGLMLKSNMDSGE
PSNLRMSTEDVIEECKLFYFAGMETTSVLLTWTLVVLSMHPEWQHRAREEVLSAFGRDKP
NFDGLSRLKT 
VTMILHEVLRLYPPAVTLSRRTFKEIQIGGITYPAGVGLELPIILIHHNTDVWGKDAHEFKPERFADGISKAT
KTNQQAFFPFGWGPRICIGQNFAMLEAKMALCVILQNFEFQLSPSYTHAPYASVTLHPQH
GAQIILTRL*

>CYP72A21 $F AP002839 Oryza sativa genomic DNA, chromosome 1 61993-63890
MVLGAWLMSPASVPWSLLAYGVLGLVLLWQAGRLLHSLWWRPRRLELALRAQGLRGTRYRFLTGD
LGEHGRLNREAWARPLPLRCHDIAPRVAPFLHNAVREHGSACFTWFGPTPKVTITDPDLA
KGVLSNKFGHFEKPKFPTLTKLFSDSLANHEGEKWVKHRRILNPAFHLEKLK 
LMLPAFSACCEELVSKWMESLGSDGSYEVDVWP
EMQILTGDVISRTAFGSSYLEGRRIFQLQAEQTERLLKCMQKIVIPGYM 
SLPTKNNRKMHQIKKETDSILRGLVDKRMQA
MKEGECTKDDLLGLLLESNMRHTEEDGQSNHGLTIEEVIEECKLFYFAGMETTSVLLTWT
ILLLSMHPEWQDRAREEILGLFGKNKPEYEGLSRLKI 
VTMILYEVLRLYPPAVTFTRKTYKQMEIGGVTYPAGVIVELPVLLIHHDPNIWGSDAHEF
KPDR FVEGISKASKNPGAFLPFGWGPRICIGQNFALLEAKMALCMILQCFKLELMPSYTH
APYSMVTLRPMHGAQIKLRAI* 

>CYP72A22 $F AP002839 Oryza sativa genomic DNA, chromosome 1 66435-68424
MVLGAGLRCPASVPWSSLAYGLLGLVLLWQGGRLLHRLWWRPRRLELALRAQGLRGTRYRFLTGDL
GEHGRLNREAWARPLPLRCHDIAPRVAPFLHSSVREHGKACFSWFGPIPKVTIANPDLAKDVLSNK
FGHLEKHKFQGLTKLLSDGVASHEGEKWVKHRRILNPAFHLEKLK 
RMLPAFSTCCEELISRWMESLGSEGSYEVDVWPEMQSL
TGDVISRTAFGSSYLEGRRIFQLQAEQAERLLKCVQKIIIPGYM 
SLPTKNNRKMHQIKKEIDSILRGLIGKRMQAMREGESTKDDLLGLLLESNMRHTAEHGQSS
QGLTIEEVIEECKLFYFAGMETTSVLLTWTMLLLSMHPEWQDHAREEILGLFGKNKPEYE
GLSRLKI 
VTMILYEVLRLYPPAVTLTRQTYKQIEIGGVTYPAGVIIELPLLLIHSDPDIWGSDVHKF
NPERFAEGISKASKDPGAFLPFSWGPRICIGQNFALLETKMALCMILQHLELELALSYTH
APQSIITLRPTHGAQIKLRAI*

>CYP72A23 $F AP002839 Oryza sativa genomic DNA, chromosome 1 72149-74091
MVFGELFSRASLPPPWSLLAYGLVGPV
LLWQAGRLLDRLWWRPRRLERALRAQGLRGTAYRFLLGDLREFGRLNEEAWSSAPLPLGC
HDIVPRVTPFVHRNVRDNGRPCCFSWFGPIPSVTITDPAQVRDVLSNKLGHFEKPKLPAL
TKLLADGLTSHDGEKWVKHRRIMNPAFHLEKLK 
LMLPAFSTCCEELVGKWMDSLGPDGSCELDVWPEMQSLTGDVISRTAFGSSYSEGR
RIFQLQTEQAELFIGAIQKFVIPGYM 
YLPTKKNRRMRRINSEVESILRGIIGKRMQAIAEGESTNDDLLGLLLESNMRHADENGRS
SPGMTTEDVIEECKLFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLGLFGRDKPEY
EGLSRLKT 
VTMVLYEVLRLYPPAIVFSRKTYKEMEIGGVVYPRGVILELPVLFIHH
DREIWGRDVHEFRPERFAEGISRASNDRGAFLPFGWGPRVCIGQNFALLEAKMALCMILQ
RFEFELAASYTHAPHTVMTLHPMHGAQMKLRMI*

>CYP72A24 $F AP002839 Oryza sativa genomic DNA, chromosome 1 109970-113787
MVVFAAGDERPLMLVWAAVAGAVLAWCAVRAMEWAWWRPRRLERALRAQGLRGTPYRSPA
GDAPLNVQLSAEARARTMPLGCHDVVPRAMPLFHQAMKEH 
GKVSITWFGPVPRVTITKPELVREVLSNKFGHFEKLKFGRFQRLLHNGLGSHEGEKWAKH
RRIINPAFHLEKLK
RMLPAFAACCTELVDK
WEGLAKGGDEPYEVDVWPEMQSLTGDVISRAAFGSSYLEGKRIFQLQGEQIELIVATMNK
IHIPGYI 
HLPTKSNRRMKQIAAEIEGMLKRIIAKRESALKAGEASSDDDLLGLLLESNLDHSKGNGGA
ASSGISIDDVIGECKLFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLHVFGSRAPD
YDGLSRLRI 
VTMVLYEVLRLYTPLTALQRKTYKPMELGGVRYPAGVVLTLPLLCVHHDKDVWGADADEF
RPERFAEGISKASREAPAFFPFGWGPRICIGQNFALLEAKMGLSMILQRFSFDLSPSYTH
APFPVGLLQPEHGAQVRLTRLN*

>CYP72A25 $F AP002839 Oryza sativa genomic DNA, chromosome 1 115472-117492
MEIVDGASPPLHPWSLLLYALGALAALWWAWRALDRFWLRPRRLGRALRSQGLRGTDYRFPSGYLKEFARLL
AAALAAPMPPLSHDVASRALPFELAAIKQH 
GNVCVTWFGPEVRVIVSDPKLFREILANKNGRFGKQKSILWVQNLLADGLTSHQGEKWVA
HRRIMNHAFHLEKLK 
VQRMLPAFAACSSELISRWQDSVGADGAQEIDVWPEFQNLTGDVISRSAFGSSFSEGRRI
FQLQSEQARNVMKMAKALYFPGYR 
FLPTELNRRTKANAREVRELLKGIITKRESAMKDGHAVNDDLLGLLLETNIKESQEAGSS
KPTMTTKDIIEELKLLYFAGSDTTAVLLTWTMVLLSMHPEWQDRAREEVLRVFGKNSPDF
EGINHLKV 
VTMILHEVLRLYPPILLLGREAYEETELGGVTYPPGVTFALPIAGIHHDPDVWGEDV
GEFKPERFAEGVSRASKDSPALVPFSWGPRICVGQNFALLEAKMALSMILQRFSFGLSPS
YTHAPFPIPTLQPQHGAQIKLTKL*

>AP003278 $P CYP72A31P chromosome 1, PAC clone:P0518F01, similar to 72A22 missing N-
31539 SLPIENNRKMHQINKEIESILRGLIGKRMQAMKEGESTKDDLLGILLESNTKHMEENGQSS 31718
31719 QGLTIKDIVEECKLFYFAGAETTSVLLTWTMLLLSIHPEWQDHAREEIMGLFRKNKPDYE 31898
31899 GLSRLKI
32030 VTMIFYEVLRLHPPFIEIGWKTYKEMEIGGVTYPAGVSIKIPVLFIHHDPDSWGSDVHEF 32209
32210 KPERFSEGISKASKDPGAFLPFGWGPRICIGQNFALLESKMALCLILQRLEFELAPSYTH 32389
32390 APHTMVTLHPMHGAQMKVR 
      SYMIISDYSVFYYYNSWL* 

>AP003278a $F CYP72A32 19863-22437 chromosome 1, PAC clone:P0518F01, similar to 72A22
50023 MVLGGWLLMWAPASSPTILVAFGLLFG
49942 LVLAWQ AGLQLHRLWWRPRRLEKALRARGLRGSSYRFLTGDLAEESRRRKEAWARPLPLR 49763
49762 CHDIAPRIEPFLHDAVVRPEQHYGKPCITWLGPTPEVHVTDPELAKVVMSNKFGHFEKIR 49583
49582 FQALSKLLPQGLSYHEGEKWAKHRRILNPAFQLEKLK 49472 (0)
49071 LMLPVFSACCEELISRWMGAIGSDGSYEVDCWPELKSLTGDVISRTAFGSSYLEGR 48904
48903 RIFELQGELFERVMKSVEKIFIPGYM 48826 (2)
48363 YLPTENNRKMHQINKEIESILRSMIGKRMQAMKEGESTKDDLLGILLESNMRHT 48202
48201 EENSQSSQGLTIKDIMEECKLFYFAGADTTSVLLTWTILLLSMHPEWQDRARKEILGLFG 48022
48021 KNKPEYDGLNNLKI (0) 
      VTMILYEVLR 47842
47841 LYPPFIELKRRTYKEMKIGGVTYPAGVIINLPVLFIHHDLKIWGSDVHEFKPERFSEGIS 47662
47661 KASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELAPTYTHAPHTMITLHP 47482
47481 MHGAQIKIRAI* 47446

>AP003278b $F CYP72A33 chromosome 1, PAC clone:P0518F01, 82% to 72A22
MVLGGGWLSMWAPASSPTILAAFGLVGLVLAWQ 
AGLQLHRLWWRPRRLEKALRARGLRGSRYRFL
      TGDLAEEGRRRKEAWARPLPLRCHDIAPRVEP 59284
59283 FLHGAVGVGAAHGKPRITWFGPTPEVHVADPELARVVLSNKFGHFEKVSFPELSKLIPQG 59104
59103 LSAHEGEKWAKHRRILNPVFQLEKLK 59026 (0)
58537 LMLPV FSACCEELISRWMGSIGSDGSYEVDCWPEFKSLTGDVISRTAFGSSYLEG 58373
58372 RRIFELQGELFERVIKSIQKMFIPG 58298 (2)
57483 YLPTENNRKMHQMNKEIESILRGMIGKRMQAMKEGESTKDDLLGILLESN 57334
57333 TRHMEVNGQSNQGLTIKDIMEECKLFYFAGADTTSVLLTWTMLLLSMHPEWQDRAREEIL 57154
57153 GLFGKNKPDYDGLSRLKI (0) VTMIL 56977
56976 YEVLRLYPPFIELTRKTYKEMEIGGITYPAGVIINLPVMFIHHDPEIWGSDVHEFKPER 56800
56799 FSEGISKASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELATSYTHVPHT 56620
56619 IISLHPMHGAQIKVKSYMTISDYSVFY* 56536

>AC119289.1 $F CYP72A34 (japonica cultivar-group) chromosome 5 clone
50424 MLIMLGLGLVPAGAAAALAVALVCLAAAAWWTVERAPRRLERALRAQGVGGGRY
      QLLLGGDVAENGRLNREAWSRPLPLGCHRIAPRVLPLLWNAVRDH (1) 50720
54713 GKLSFIWFGPVPRVMIPDPELVREVFNKFDQFGKPKMIRVGKLLATGVVSYEGEKWAK 54886
54887 HRRILNHAFHHEKIK (0) 54931
55175 RMLPVFANCCTEMVTRWENSISLEAASEIDVWPEFRNLTGDVISRTAFGSSYQEGRRIF 55351
55352 QLQEELAQYLTEALQKLFIPGYW (2?) 55420
56034 YRYLPTKNNRRMREIDREVRKILLEIIGNKERAITNGENSNDDMLGLLVESNTKQPELRM 56213
56214 STDDIIEECKLFYFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLHHFGRTTTPDYDSL 56393
56394 SRLKI 56417 (0?)
56923 VTMILYEVLRLYPPVVLLNRRTFKETNLGGIKFPADMNLILPILFIHHDPEIWGKDASEF 57102
57103 NPGRFADGISNASKYHDASFFPFGWGPRICIGQSFALLEAKMALSMILQRFSLELSPSYI 57282
57283 HAPYIVLTLRPQHGAQIKLKRI* 57351

>AP002899 $F CYP72A35 52% to 72A14 = AQ161379
MLGEAASPWSLAGAGAAVALLWLCAWTLQWAWWTPRRLERALRA
QGLRGTRYRLFIGDVAENGRLNREAASRPLPLGSHDVVPRVMPFFCNVLKEHGKLSFV
WTGPKPFVIIRDPDLAREILSNKSGNFAKQTTAGIAKFVVGGVVTYEGEKWAKHRRIL
NPAFHQEKIKRMLPVFLACCTKMITRWVNSMSSEGISELDVWDEFQNLTGDVISRTAF
GSSYQEGWRIFQLQEEQAKRVLKAFQRIFIPGYWYLPIENNRRIREIDQEIRTILRGI
IVKRDKAVRNGEGSNDDLLGLLVESNMRQSNEKEDVGMSIEDMIEECKLFYAAGSETT
SMLLTWTLILLSMHPEWQEQAREEVMHHFGRTTPDHDGLSRLKIVTMILHEVLRLYPP
VVFLQRTTHKEIELGGIKYPEGVNFTLPVLSIHHDPSIWGQDAIKFNPERFANGVSKA
TKFQTAFFSFAWGPRICLGQSFAILEAKMALATILQSFSFELSPSYTHAPHTVLTLQP
QYGSPIKLKKL

>AP003142.2 $P CYP72A36P chromosome 1, PAC clone:P0435H01 probable pseudogene 
5354 YLPIENNRRIREIY*EIRKILRGLIVKGDKAIRNGENTNDDLLGLLVESNMRQSNERE 5181
5180 EVGMSIED 5157
1115 IIEECRLFYFAGSETTS 
1065 MLLT*TLIMLSMHPEWQERAREEVMHHFRRTTPDHDGLSRLKIVHM 928

>AP004019.1b $P CYP72A37P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice 
37945 LSLMSLAFPTCNEELVWR*TE 37883 frameshift 
37883 NPFNDEGLCVLLDVWPEIQRFH*DAISRTASGGGYRERRRIFQLQSEQSE 37734

>AP004019.1a $P CYP72A38P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice 
19871 FSTRKNSLLGYKTESLGDDGLCELLDIWREMQRLNGCHFPHSIRQPSYCEMRRIF 19707

>CYP73A35P   $P Oryza sativa (rice)  GenEMBL AP003446.1 March 29, 2001
MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAA
LARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 175 RRRLQLMMYSNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF
LRGYLRICEEVKETRLKLFKDFFLEERK (2?)
NGLKCAIDHILEAQQKGEINEDNVLYIVENINVA (1)
AIETTLWSMEWAIAEL 
VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNLRD
AELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNVEANGNDFRYLPSGA
GRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF*

>aaaa01002376.1 $FI CYP73A38 (indica cultivar-group) ortholog to AQ256364.1
899  MDALLVEKVLLGLFVAAVLALVVAKLTGKRLRLPPGPAGAPIVGNWLQVGDDLN 1060
1061 HRNLMALARRFGDILLLRMGVRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKG 1240
1241 QDMVFTVYGDHWRKMRRIMTVPFFTNKVVAQNRAGWEEEARLVVEDVRRDPTAATSGVVI 1420
1421 RRRLQLMMYNDMFRIMFDRRFDSVDDPLFNKLKAFNAERSRLSQSFEYNYGDFIPVLRPF 1600
1601 LRRYLARCHQLKSQRMKLFEDHFVQERK 1684 (2)
3697 RVMEQTGEIRCAMDHILEAERKGEINHDNVLYIVENINVA 3816 (1)
4917 AIETTLWSIEWGIAELVNHPSIQSKVREEMASVLGGAAVTEPDLERLPYLQAVVKETLRLRMAIP 5093
5094 LLVPHMNLADGKLAGYDIPAESKILVNAWFLANDPKRWVRPDEFRPERFLEEEKAVE 5264
5265 AHGNDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQSFDLLPPPGMDKVDTT 5423 (fs)
EKPGQFSTQILKHATVVCQ (fs)
PIDA*

>AP004850.1b $F CYP73A39 (japonica cultivar-group) chromosome 2 clone OJ1342_D02
48977 MAASAMRVAIATGASLAVHLFVKSFVQAQHPALTLLLPVAVFVGIAVGAKGGSGGDGKAP 49156
49157 PGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ 49336
49337 GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM 49516
49517 DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS 49696
49697 RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRR 49840
      NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAI 50094
50095 ETTLWSIEWALAEVVNHPAVQSKVRAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLH 50274
50275 SPIPLLVPHMNLEEAKLGGYTIPKGSKVVVNAWWLANNPALWENPEEFRPERFLEKESGV 50454
50455 DATVAGKVDFRFLPFGVGRRSCPGIILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKG 50634
50635 GQFSLHIAKHSVVAFHPISA 50694

>AP004850.1a $F CYP73A40 (japonica cultivar-group) chromosome 2 clone OJ1342_D02
32815 MAASVVRVAIATGASLAVHLFVKSFLQAQHPALTLLLPVAVFAGIAVGAKGGNGGDGKAP 32636
32635 PGPAAVPVFGNWLHVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ 32456
32455 GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM 32276
32275 DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS 32096
32095 RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRR 31952
31797 NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSK 31621
31620 VRAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIP 31441
31440 KGSKVVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCP 31261
31260 GIILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA 31090

>AC099043.1 $F CYP74A4 chromosome 3 clone OSJNBa0079B15, Length = 155583
62290 MATAAACISFASPSPARVVIR
62227 RQTRASASASATDRQEVVSPKRRLPLRKVPGDYGPPVVGAIRDRYEYFYGPGGRDGFFAA 62048
62047 RVRAHRSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSLVDKTDLFTGTFMPSTD 61871
61870 LTGGYRVLSYLDPSEPNHAPLKTLLFYLLSHRRQQVIPKFREVYGDLFGLMENDLARVGK 61691
61690 ADFGVHNDAAAFGFLCQGLLGRDPAKSALGRDGPKLITKWVLFQLSPLLSLGLPTLVED 61514
61513 TLLHSLRLPPALVKKDYDRLADFFRDAAKAVVDEGERLGIAREEAVHNILFALCFNSF 61340
61339 GGMKILFPTLVKWLGRAGARVHGRLATEVRGAVRDNGGEVTMKALAEMPLVKSAVYEAL 61163
61162 RIEPPVAMQYGRAKRDMVVESHDYGYEVREGEMLFGYQPMATKDPRVFARPEEYVPDRFL 60983
60982 GEDGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLVELFLRYDSFDVEV 60812
60811 GTSTLGSSVTVTSLKKATF* 60752

>AC107226.1 $F CYP74A5 chromosome 3
MELGVPLPRRPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRA
ERYGSTVVRINVPPGPFMARDPRVVALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSL
TGGYRVCAYLDPSEPNHAKIKQLLLSLLVSRKDAFVPVFRSNFGALLDTVESQLASGG
GKSDFTALNDATSFEFIGEAYFGVRPSASSSLGTGGPTKAALWLLWQLAPLTTLGLPM
IIEDPLLHTLPLPPFLISSDYKALYAYFAAAASQALDAAEGLGLSREEACHNLLFATV
FNSYGGFKLLLPQILSRVAQAGEKLHERLAAEIRSAVADAGGNVTLAALEKMELTRSV
VWEALRLDPPVRFQYGRAKADLEIESHDASFAIKKGEMLFGYQPCATRDPRVFGATAR
EFVGDRFVGEEGRKLLQYVYWSNGRETENPSVDNKQCPGKNLVVLVGRLLLVELFLRY
DTFTAEAGKKVVITGVTKASTSAVNRTA

>AP004996.1a $F CYP74E1 (japonica cultivar-group) chr 2 
62616 MAPPPVNSGDAAAAATGEKSKLSPSGLPIREIPGGYGVPFFSPLRDRLDYFYFQ 62777
62778 GAEEYFRSRVARHGGATVLRVNMPPGPFISGNPRVVALLDARSFRVLLDDSMVDKADTLD 62957
62958 GTYMPSRALFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAM 63122
63143 GXGAXXEFNKLNMRDMLDFTCAALFGGEPPSKVVGDGAVTKAMAWLAFQLHPIASKVVKP 63322
63323 WPLEELLLHTFSLPPFLVRRGYADLKAYFADAAAAVLDDAEKSHTGIPRDELLDNLVFVA 63502
63503 IFNAFGGFKIFLPHIVKWLARAGPELHAKLATEVRATVPTGEDDGITLAAVERMPLVKSV 63682
63683 VWEALRMNPPVEFQYGHARRDMVVESH 63763
      DAAYEVRKGEMLFGYQPLATRDEKVFDRAGEFVADRFVAGGAAGDRPLLEHVVWSNGPETRAPSE
      GNKQCPGKDMVVAVGRLMVAELFRRYDTFAADVVEAPVEPVVTFTSLTRASSG*

>AP004181.1 $F CYP74E2 chromosome 2 clone OJ1136_G09, AU184424.1 45% to 74A of 
6988 MAPPRANSGDGNDGAVGGQSKLSPSGLLIREIPGGYGVPFLSPLRDRLDYYYFQGADEFFRS 7173
7174 RVARHGGATVLRVNMPPGPFLAGDPRVVALLDARSFRVLLDDSMVDKADTLDGTFMPSLA 7353
7354 LFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAMFDEVDAGLVAGGP 7533
7534 VEFNKLNMRYMLDFTCAALFGGAPPSKAMGDAAVTKAVKWLIFQLHPLASKVVKPWPLED 7713
7714 LLLHTFRLPPFLVRREYGEITAYFAAAAAAILDDAEKNHPGIPRDELLHNLVFVAVFNAY 7893
7894 GGFKIFLPHIVKWLARAGPELHAKLASEVRAAAPAGGGEITISAVEKEMPLVKSVVWEAL 8073
8074 RMNPPVEFQYGRARRDMVVESHDAAYEVRKGELLFGYQPLATRDEKVFDRAGEFVPDRFV 8253
8254 SGAGSAARPLLEHVVWSNGPETGTPSEGNKQCPGKDMVVAVGRLMVAGLFRRYDTFAADV 8433
8434 EELPLEPVVTFTSLTRAADGDGAARRGV* 8520 

>aaaa01034814.1 CYP74E3P (indica cultivar-group) 76% to AP004181 $F 
820 AVAWLVFQLHPIASKVVKPWPLEDLLLHTFSLPPFLVRRGYATLKAYFADAAEKNHPGIP 641 (fs)
641 RDVLLDNLVFVAIFNAFGGFKIFLPHIVKWLARASPELHAKLATEVRATVPTGGAHEPAG 462
175 LVWEALRMNPPVEFQYGHARRDM 
102 VVESHDAAYEVRKGEMLFG 43

>AP004752.1 $F CYP74F1 (japonica cultivar-group) chr 2 
32688 MVPSFPQPASAAAAT
32733 RPIPGSYGPPLLGPLRDRLDYFWFQGPDDFFRRRAADHKSTVFRANIPPTFPFFLGVDPR 32912
32913 VVAVVDAAAFTALFDPALVDKRDVLIGPYVPSLAFTRGTRVGVYLDTQDPDHARTKAFSI 33092
33093 DLLRRAARNWAAELRAAVDDMLAAVEEDLNRAPDPAAASASYLIPLQKCIFRFLCKALVG 33272
33273 ADPAADGLVDRFGVYILDVWLALQLVPTQKVGVIPQPLEELLLHSFPLPSFVVKPGYDLL 33452
33453 YRFVEKHGAAAVSIAEKEHGISKEEAINNILFVLGFNAFGGFSVFLPFLVMEVGKPGRDD 33632
33633 LRRRLREEVRRVLGGGDGGEAGFAAVREMALVRSTVYEVLRMQPPVPLQFGRARRDFV 33806
33807 LRSHGGAAYEVGKGELLCGYQPLAMRDPAVFDRPEEFVPERFLGDDGEALLQYVYWSNGP 33986
33987 ETGEPSPGNKQCAAKEVVVATACMLVAELFRRYDDFECDGTSFTKLDKRELTPS* 34151 

>AC125784.1 $F CYP75A11 ortholog of AAAA01085971.1 100% AAAA01009188.1 1 aa diff
93834 MELAALCTDPVVLSAAFLCLLLHLSLRSYRPPSPGGGRRLPPGPPGLPVLGALPLVGPAP 94013
94014 HAGLASLARKYGPVMYLKMGTCGVVVASSPCAARSFLKALDARFANRPAVASAVDITYNY 94193
94194 QNMVFANYGARWKLMRKLASVHLLGARALADWAAVRRDEARRLLRGVAEASAAGRP 94361
95165 YKDMIVSLLTGAGLFNISDFVPALAWLDLQGVQAKLRRIHDQFDVLITKLLADHAATAAD 95344
95345 RARAGRTDFVDRLRAAVGVDDEDGETISEVNIKGLIF 95455
99273 DMFTAGTDTSSIIVEWAMAEMMKNPAVMARAQEEMDRVVGRGRRLEESDIASLPYLQAVC 99452
99453 KEAMRLHPSTPLSLPHFSFDECDVDGYRIPANTRLLINIYAIGRDPSAWEDPLEFRPERF 99632
99633 MPGGAAERVDPLGNYFELIPFGAGRRICAGKLAGMVFVQYFLGTLLHSFDWRLPDGEDKV 99812
99813 DMSETFGLALPKAVPLRALVTPRLAPAAYA 99902

>AC021892.5 $F CYP75B3 chromosome 10 clone OSJNBa0053D03 21 unordered pieces
62759 MDVVPLPLLLGSLAVSAAVWYLVYFLRGGSGGHAA
      RKRRPLPPGPRGWAVLGNLPQLGDKPHHTMCALGRQYGPLFRLRFGCAEVVEAATS 62487
62479 AAQFLRGHDANFSNRPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDL 62300
62299 RAVREGEVALMVRNLARQQAASVALGQEANVCATNTLARATIGHRVFAVDGGEGARE 62129
62128 FKEMVVELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYDNMMNGFINER 61967
61966 KAGAQPDGVAAGEHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLL
61786 NLFTAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVG 61607
61606 RGRLVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVW 61427
61426 AIARDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTL 61247
61246 MTATLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGV* 61085

>AC119149.2 $F CYP75B4 Nipponbare strain, clone OSJNBb0079E01, from ch 10
74682 MEVAAMEISTSLLLTTVALSVIVCYALVFSRAGKARAPLPLPPGPRGWPVLGNLPQLGGK 74503
74502 THQTLHEMTKVYGPLIRLRFGSSDVVVAGSAPVAAQFLRTHDANFSSRPRNSGGEHMAYN 74323
74322 GRDVVFGPYGPRWRAMRKICAVNLFSARALDDLRAFREREAVLMVRSLAEASAAPGSSSP 74143
74142 AAVVLGKEVNVCTTNALSRAAVGRRVFAAGAGEGAREFKEIVLEVMEVGGVLNVGDFVPA 73963
73962 LRWLDPQGVVARMKKLHRRFDDMMNAIIAERRAGSLLKPTDSREEGKDLLGLLLAMVQEQ 73783
73782 EWLAAGEDDRITDTEIKALIL (0) 73720
65761 NLFVAGTDTTSTIVEWTMAELIRHPDILKHAQEELDVVVGRDRLLSESDLSHLTFFHAII 65582
65581 KETFRLHPSTPLSLPRMASEECEIAGYRIPKGAELLVNVWGIARDPAIWPDPLEYKPSRF 65402
65401 LPGGTHTDVDVKGNDFGLIPFGAGRRICAGLSWGLRMVTMTAATLVHAFDWQLPADQTPD 65222
65221 KLNMDEAFTLLLQRAEPLVVHPVPRLLPSAYNIA* 65117

>AC118672.1b $F CYP76H4 (japonica cultivar-group) chromosome 3 (3 frameshifts)
29723 MELLLLCTPCVILLLSSLYLLRLFVDARRNLPPGPRPQPLIGNILDLGSQPHRSLARLAG 29902
29903 RYGPLMTLRLGTVTTVVASSPGAARDILQRHDA 30001 
30003 AFSARSVPD 30029 
30031 AARACGHDGFSMGMLPPTSALWRAL 30105 
30107 RRVCAAELFAPRSLDAHQRLRRDKVRQLVSHVARLARDGAAVDVGRAAFTA 30259
30260 SLNLLSSTIFSADLADFGDARAESSVGDLRDLISEFTIVVGVPNVSDFFPAVAPLDPQRL 30439
30440 RRRVARVFERLQAVFDGHIERRLRDRAAGEPPKNDFLDALLDYRSPEDGRGFDRPTLQFLFT (0) 30625
      DLFSAGSDTSAVTVE 30799
30800 WAMAQLLQNPPAMAKAREELARVIGSKQEIEESDISQLKYLEAVVKETLRLHPPAPFLLP 30979
30980 HQAETTTQVGGYTVPKGTRVLVNVWAIGRDSKVWSDPDKFMPERFLQSEVDLRGRDFELI 31159
31160 PFGSGRRICPGLPLAVRMVYLMLASLLHRFEWRLLPEVEKNGVDMAEKFGMILELATPLR 31339
31340 AVAIPV* 31360

>AC118672.1a $F CYP76H5 (japonica cultivar-group) chromosome 3 45% to 76C2
20322 MELLLLYAPCVILLVSSLYLLRLFSDARRNLPPGPRPLPLVGNLLELGAKPHRSLARLAE 20501
20502 RHGPLMTLRLGAVTTIVASSPDAARDILQRHDAAFSTRPVPDIVRACGHDRFAMPWLPPS 20681
20682 SPQWRALRKVCSAELFAPRRLDAQQRLRREKARRLVSHVARMAREGAAVDVRRVVFTTLL 20861
20862 NMLSCTLFSADLADLDEGRAGSAGELADTVAEFAGTVGVPNVVDYFPAVAAFDPQRLRR 21038
21039 WLSRVFTRLFAEFDEQIERRMRERDAGEPPKNDFLDVLLDYRTTEDGRQFDRQTLRSRFT 21218
21879 DLFSAGSDTSAVTVEWAMAQLLQSPSSMMKAREELTRVIGSKPEIDESDIDSLEYLQAVV 22058
22059 KETFRLHPPAPLLLSHRAETDTEIGGYTVPKGATVMVNIWAIGRDSKVWFEPDKFIPERF 22238
22239 LQKEVDFRGRDFELIPFGSGRRICPGLPLAVRMVHLMLASLLHRFEWRLLPEVERNGVNM 22418
22419 EEKFGIVMTLATPLQAIATPI* 22484

>AC116603.1a $F CYP76H6 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10 
9135 MAALFLWLSWLVL 9097 
9094 SLLSVYLLDLLAQSRRRLPPGPHPLPLIGSLHLLGDQPHRSLAGLAKTYGPLM 8936
8935 SLRLGAVTTVVVSSPDVAREFLQKHDAVFATRSAPDASGDHARNSVALLPNSPRWRELRK 8756
8755 IMATELFSTSRLDALHELRQEKVVELVDHVARLAREGAAVDVGRVAFTTSLNLLSHTIFS 8576
8575 RDLTSLDDHGASKEFQQVVTDIMGAAGSPNLSDFFPALAAADLQGWRRRLAGLFERLRRV 8396
8395 FDAEIEHRRRVVGKEHGKVKDDFLRVLLRLAARDDDTAGLHDDALQSIFT (0) 8246
6711 DLFAAGSDTSSSTVEWAMAELLRNPLPMAKACDELQRVIGSTRRIEESDIGRLPYLQ 6541
6540 AVIKETFRLHPPVPFLLPRQATTTIQILGYTIPKGAKVFINVWAMGRDKDIWPEAEKFMP 6361
6360 ERFLERATDFKGADFELIPFGAGRRICPGLPLAVRMVHVVLASLLINFKWRLPVKVERDG 6181
6180 VNMTEKFGVTLAKAIPLCAMATST* 6106

>possible Zea mays ortholog of 76H subfamily CG052632 CG208675 CG328504 CG328491
MGALLPWLAWLLVSLVGVYLLGHLVQARRRRGLPPGPHPLPIIGSLHLLGNQPHRSLARLAKT
HGPLVSLRLGSVTTVV
ASSPAAAREILQRHDAAFSNRSVPDAPGAHARNSTVWLPNAPRWRALRKIMGTQLFAPHR
LDALQHLRRDKARELVDHVRRLARRGEPVNVGRVAFTTSLNLVSRTIFSRDLASLEDDGA
SRKFQEVVTDIMEAVGSPNVSDFFPALAVADLQGCRRRLARLFARLHRIFDEEIDARLRG
RDAGEPKKNDFLDLLLDAAEDDDNTAGLDRDTLRSLFT (0)
381 DLFSAGSDTSSSSVEWAMVELLRSPGSMAKACDELATVIGPRKDIEESDIGRLPYLQ 211
AVVKETFRLHPAAPLLLPRRAQADVKMMGYVIPEGSRVFVNVWAMGRDEETWPEPEKFLPERFLGKKT
QQAVDLRGGDFDLIPFGGGRRICP
GMPLAIRMVHLLLASLLNQFAWRLPAELERNGVDMAENFGITLTKAVPLCAIATEI*

>AC116603.1b CYP76H7 (partial) alternative exon 1 for 76H6 ? Nipponbare strain
12428 MASALFLWLSWLVLSLLSIYLLDLLAHSRRRLPPGPRPLPLIGSLHLLGDQPHRSL 12261
12260 AGLAKTYGPLMSLRLGAVTTVVVSSPDVAREFLQKHDAVFATRSAPDAAGDHTRNSVPWL 12081
12080 PPGPRWRELRKIMATELLATHRLDALHELRQEKVSELVDHVARLARDGAAVDVGRVAFTT 11901
11900 SLNLLSRTIFSRDLTSLDDRGASKEFQQVVTDIMGAAGSPNLSDFFPALAAADLQGWRRR 11721
11720 LAGLFERLHRVFDAEIEHRRRVAGEEHGKVKDDFLRVLLRLAARDDDTAGLDDDTLRS 11547
11546 VFT (0) 11538

>AC116603.1c $F CYP76H8 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10, 
AQ869312.1 70% to AC078944.1 168857-163366 same as AQ913628.1
41763 MAALLLWLSWLLLSLLSIYLLDLLAHSRRCLPPGPRPLPLIGSLHLLGDLPHRSL 41605
41604 AGLAKTYGPLMSLRLGAVTTVVASSPEVAREFLQKHDAVFATRSTPDATGDHARNSVAWL 41425
41424 PPGPRWRELRKIMATELFSTRRLDALHELRQEKVAELVDHVAGLARDGTAVDIGRVAFTT 41245
41244 SLNLVARTIFSHDLTSLDDHGASKEFQRLITDVMEAVGSPNLSDFFPALAAVDLQGWRRR 41065
41064 LSGLFARLHRLFDAEMDHRRLHGMKEKDGDFLEVLLRLAARDDDTARLDGDTLRSLFT 40891
39623 DLFTAGSDTSSSTVEWAMAELLQNPISMAKLCDELRRVVGSRRRIEESEIGQLPYLQAVI 39444
39443 KETFRLHSPAPLLLPRQATRTIQIMGYTIPKGTRVLINVWAMGRDEDIWPEAGKFIPERF 39264
39263 LERTIDYKGGDLELIPFGAGRRICPGMPLAVRMVHVLLASLLIHFKWRLPAEVEGNRIDM 39084
39083 TEKFGVTLAKANHLCAMAAPT* 39018

>AC078944.5b $F CYP76H9 clone OSJNBa0089D15 
145298 MATWILGWLLWLPVFLISLYLVDILAHSCRRLPPGPRPLPFIGSLHLLGDQPHRSLAGLAKKYGP 145492
145493 LMSLRLGAVTTVVVSSPEVAREFVQKHDAVFADRSIPDSIGDHTKNSVIWLNPGPRWRAL 145672
145673 RRIMATELFSPHQLDALQQLRQEKVAELVDHVARLAREGAAVDVGRVAFATSLNLLS 145843
145844 RTIFSRDLTSLDDRGASREFKQVITDIMEAAGSPNLSDFYPAIAAVDLQGWRRRCARLFT 146023
146024 QLHRLFDDEMDHRKLHSRHGGPGENGKEKDDFLEVLLRLGARDDDIAGLDGDTLRSLF 146197 (0)
150187 DLFAAGSDTSSSTIEWAMVELLKNTLSMGKACDELAQVVGSRRRIEESEIGQLP 150348
150349 YLQAVIKETLRLHPPVPLLPHRAKMAMQIMGYTIPNGTKILINVWAIGRD 150498
150499 KNIWTEPEKFMPERFLDRTIDFRGGDLELIPFGAGRRICPGMPLAIWMVHVVLASLLIH 150675
150676 FKWRLPVEVERNGIDMTEKFGLTLVKAIPLCALATPT* 150789

>AC078944.5a $P CYP76H10 clone OSJNBa0089D15 2 large insertions probably make this a 
92923  MASFLPWLPWLLAALLSVYLLDLLAHSRRLLPPGPRPLPLIGSLHLLGDQPHRSLAGLAK 93102
93103  MYGPLMSLRLGAVTTVVVSSPDVAREFLQRHNAAFASRSVPDATGDHATNSVAWLPNSPR 93282
93283  WRALRRIMAAELFAPHRLDALRRLRREKVQELVDHVARLAEREGGAAAVDVGRVAFATSL 93462
93463  NLLSSTIFSRNLTSLDDHGESMEFKEVVVEIMEAGGCPNVSDFFPAIAAADLQGWRRRMA 93642
93643  GLFARLHRVFDAVVEERLSERDAGEARKGDFLDVLLDVAARDNDSAGLDRDTLRSLFT   93816 (0)
103281 DLFAAGSDTSPSIVEWAIAELMRNPLCMIRAC 103376 
113843 DELSQVIGSGTNIEESDIGQLPYL 113914
113915 QAVVKETFRLHPPVPLLLPRQAETTTNIAGYTIPKGARVFVNVWAIGRHK 114064
114065 DTWSQPEKFMPERFFERNIDFRGVHFELIPFGAGRRICPRMPLANRMVHLVLGSLLNQFK 114244
114245 WNLPVDIERNGIDMSEKFGLTLVKAIPLCALVTPISVESGDH* 114373

#307
>aaaa01012542.1 CYP76H11 (indica cultivar-group) orth AP004183.1 $P chr 8 99%
     MAFLFPSLLLPWLP
5820 WLLGSLLSVYLLDLLAHSRRRLPPGPRPLPFIGSLHLLGDQPHRSLAALAMAYGPLMSLR 5641
5640 LGAVTTVVASSPAVARELLHRHDAAFASRSSPDSTGDHARSSVAWLPSSAPRWRALRR 5467
5466 IMATELFAPHRLDAAAPRRLRREKVRELVAHVARLAAGEGGKPAVVDVGRVAFATSLNLL 5287
5286 SRTIFSRDLTSLDDHGGSKGFQEAVARIMEAGGRPIVSDFFPVLAAADLQGWRRRLA 5116
5115 RLFARLHRVFDAEVDARLREHDAGEASKGDFLDVLLGIAARRDDAAELDRDTLRSLF 4945
4944 TVIQL 4930
4816 DLLGGALSLLPLLEWFRLVVGPRGFVVVCDHAFFRHVLCEKG 4691
991 DVTEKLEVEKN*TQQLSQVIGLGPNIKESEIGQLPYLQAVVKETFRLHPPAPLLLPRQ 818
817 AEMTMKIAGYTIPKGTRIFINVWAMGRDKDIWPEPEKFIPERFLGSKIDFKGVHFELIPF 638
637 GAGRRICPGMPLANRMVHLILGSLLNQFKWNLPVEVERNGIDMSEKFGLTLAKATPL 467
    CALVTPISVKPADHQE*

>AP003261.1 $P CYP76H12P chromosome 1 clone P0471B04, 
132381 MELAALCTDPVVLSAAFLCLLLNLSLCSYRPPSPGGGRRLPLGPPGVPVLGALPLVGPAPHADLASLARK 132172
132171 YGPIMYLKMGTCGVV 132127

>AP003214.3 $P CYP76H13P almost identical to AP003227 related to CYP75
165814 MELAVLCTDPVVLSGPFLCLLLHLSLCSYR 165725 (2?)
157244 RPPSPGGGRRLPPD 157203 
157203 PPGVPVLDALPLVGPAPHTDLASLARKYGPIMYLKMGTCGVV 157078 frameshift
AASSPCAARAFL 157053

>AP003622 $P CYP76H14P chromosome 6 clone P0633E08 related to AC025783.5 exon 1
105535 DLLGGALSLLPLLEWFRLVVGPRGFVVVCDHAFSRHVLCE 105654 
105656 KGLVAEVSKFLFG 105694

>AC025783.5b $P CYP76H15P chromosome 10 clone OSJNBa0001O14 1 ordered pieces Length = 
       DLLGGAFSLLPLLEWGRAVSSSSATTPFPG 124558
124557 TCYARKGLVAEVSEFLFGSGFSTA*DALW 124471

>AC078944.1 CYP76H16P (partial) clone OSJNBa0089D15,9 unordered pieces
140438 PFQGLCS KGTFRLPAPVPRLLPGRACPSSDVAGYTLPSGARVLVYVWA WADSCVRGLVRE 140259
140258 NLCQCVFRVRSAFRGVRLELFHWGQVPVWPGIAPAA*LVH*GLGS 140124

>AP005308.1b $F CYP76K1 (japonica cultivar-group) chr 9 = AP005575.1 74864-72921
145251 MELTTISPVFLISLLGVPLLYLLWSKASKSPSGAPAAPPPPPGPTPFPVIGNIPDLLRGG 145430
145431 ELHRALTGLAASYGPVMSLRLGMASTVVLSSPDVAHEALHKKDGAISSRWVPDNANVLGH 145610
145611 QDVSMAWLPSSSPLWKHMRTLASTLLFTSRRLGASRGIRERKARELVDYLGAR 145769
145770 SGRPVRVGLAVFGSVLNFMSNVFFSEDVVELGSETGQEFQQLIADSVAETAKPNISDFFP 145949
145950 FLSALDLSRRRRAAAKNLKKFYDFFDDVIDRRLSSGEKPGDLLDSLLELHAKSQLER 146120
146121 PLIRALM 146141
146574 DLFIAGSHTTTTTVEWAMAELLRNPSKMAKARAELGEAFGRGAVEEGELARLPYLN 146741
146742 AVIKETLRLHPPAPLLLPHRVSSDSEPAGGVTLGGYSVPSGARVLINAWAIGRDPAAWSP 146921
146922 EPDAFSPERFLGREADYWGRTLEFIPFGSGRRACPGIPLAVAVVPMVVAAMVHSLEWRL 147098
147099 PEGMAPGDVDVGDRFGAVLELATPLWAVPVKV 147194

>AP005308.1a $P CYP76K2P (japonica cultivar-group) chr 9 = AP005575.1 97551-97718
121122 EDVIEPGSETRQEFQELIADSVAETGVSDFFRFVSALDLSSRRCAATRNLSRFYDF 120955

>AP005308.1c $F CYP76L1 (japonica cultivar-group) chr 9 = AP005575.1 67708-65225
152407 MEASTILWLLYVSLASCLLYKVFVSTKNGHPKIAARRPPGPTPVLLLGNVFDLRGELHLA 152586
152587 LARLAEEHGPVMSLKLGTATAVVASSAAAARDALQRYDHVLAARAVCDAARALGTHERSI 152766
152767 VWLPGSSALWKRLRAVCTNHLFSARGLDATRAVREAKVRELVEHLRGHAAGAGEEEAAAV 152946
152947 DVGRVVFSAVINLVSNVLFSEDVADLSSDRAQELEMLVRDTVEEATKPNLSDLFPVLAAL 153126
153127 DLQGRRRRTAVHIRKFHDFFDEIISRRQNAGGEGERKEDFLDVLLQLHSADQLSLDTIKT 153306
153307 FLG 153315
154270 DLFTAGTDTNSITVEWAMAELLRHPAAMSRARAELRDALGAKPHPDESDIGRLPYLSA 154443
154444 VVMETMRLHPPSPLLMPHEAVADGAAVGGYAVPRGTKVIVNVWSIMRDPASWPRPEEFEP 154623
154624 ERFVAAGGSFRGGEMLEFMPFGAGRRACPGTPMATRVVTLVLASLLHAFEWRLPGGMRPC 154803
154804 DVDVRGRFGTSLNMVTPLKAVPVPVPARP 154890

>aaaa01003137.1 $FI CYP76M1 (indica cultivar-group) ortholog to AU173996.1
2741 MDVNQLWLLWATLAVSLLYYISNRRRRVGGRRRCPPGPMPLPLVGNLLNLRGHLPPALAR 2920
2921 LARTYGPVMMLKMGLTTTVVISSGDAAREAFTKHDRHLAARTVLDVTRSLDFADRSMIWL 3100
3101 PSSDTVWKTLRGVTAASIFSPRGLAALRGVRESKVRDLVGYFRGRAGEVVDVRHAVYGCM 3280
3281 LSLVSSAFFSVDVVDLSAESENEFRQSMTFLMEVVSKTNVSDFFPFLRPLDLQGWRRLTE 3460
3461 RYLGRVTCFLDDVIDRRFAADASANRHGDFLDSLLDLVSTGKIVRENVTTILLDVFIAGS 3640
3641 DTITATVEWAMAELLRNPSEMAKVRAEMDGALGGKKTVDEPDIARLPYLQAVVKEAMRLH 3820
3821 PAAPLLLPHRAVEDGVEVGGYCVPKGSMVIFNVWAIMRDPAAWERPEEFMPERFIRRGDD 4000
4001 DEVDFWGKTFEFIPFGSGRRVCAGLPMAERVVPFMLASLLRAFEWRLPDGVSAEELDMRH 4180
4181 RFTIANFRAIPLKAVPVVVS* 4243

>AP005254.1a $F CYP76M2 (japonica cultivar-group) chromosome 8 = AF488522.1 PM-II
59535 MERDAWLLCAALAAATVVYYLACTTSRRAQRRRLPPGPTPLPVIGNVLSLRGNMHHALARLARER 59341
59340 YGPVMALKLGLVTAVVVSSPDAAREAFTKHDRRLAARAVPDTSRVRGFADRSMIWLPSSD 59161
59160 TRWKTLRGVVATHVFSPRSIAAARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLV 58981
58980 SNAFFSGDVVDVGEESAHGLREAVEDIILAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYD 58801
58800 TVFDILDNITNSRLADASAGNHAGDFLDSLLGLMSYGKIARDDVTTIMFDVFGAGTDTIA 58621
58620 ITVQWAMAELLRNPSIMAKARTEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAP 58441
58440 ILLPHQAAEDGVEIGGYAVPKGSTVIFNVWAIMRDPTAWERPDEFMPERFLQRAEVDFRG 58261
58260 KDFEFMPFGAGRRLCPGLPMAERVVPFILASLLHAFEWRLPDGMSAEELDVSEKFTTANV 58081
58080 LTVPLKAVPILASSASELQAS* 58015

>aaaa01018916.1 $PI CYP76M3P (indica cultivar-group) missing Nterm, inverted seq at 
4748 RRLPPGPTPLPVIGDVLGLRGNMHHALARLARERYGPVMTLKLGLVTAVVVSSPGA 4581
4580 AREAFTRHDRRLAARTVPDISRARGLAGRSMIWLPSSDPRWKTLRGVVAAHVFSPRSLAA 4401
4400 ARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLVSNAFFSGDVVDVGEESAHGLRE 4221
4220 AVEDMISAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYDTVFDILDNITNSRLADASAGNH 4041
4040 AGDFLTPSLGLMSYGKIARDDVTTIMFDVFGAGTDTIAITVQWAMAELLRNPSIMAKART 3861
3860 EMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHQAAEDGVEIGGYAVPKG 3681
3680 STVIFNVWAIMRDPTAWERPDEFMPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAE 3501
3500 RVVPFIL
ASLLHAFEWRLPDGMSAEELD
VSEKFTTANVLTVPLKAVPILASSASELQAS* 3321

>AP005254.1b $P CYP76M4P (japonica cultivar-group) chromosome 8 
82126 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALARL 81947
81946 AGEHGPVMALKLGLVTTVVVSSAGAAREAFTKHDRRLAARAVPDTTRARGFASRSMIWL  81770
81769 PSSDPRWKTLRGVAATHVFSPRSLAAARGVRERKVRDIVGHLAGHAGEVVDVG    81611
      QVVYGGVLN 
81582 LRRLDLQGWRRWA  81544 
81542 EKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGTIARDDVTSIMYDL 81363
81362 FGAGTDTIAITVEWAMAELLRNPSVMAKARAEMNHVLAGKVKATEMEENDVEKLPYLQAV 81183
81182 VKEVMRLHPAAPILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPEEFMPE 81003
81002 RFLDMAEEVDFRGKDHKFMPFGTGRRLCPGLSMAKRVVPFILASLLHAFEWRLPAGVTAE 80823
80822 ALDLSEKFTTVNVLVTPIKAIPILASDEI* 80733

>aaaa01011645.1 $FI CYP76M5 (indica cultivar-group) one frameshift no introns 
1329 MEARELWVLAAALAVSLLYYLTVLMRYAGGGSSRSSRPRLPPGPTPLPLIGNLLSLR 1159
1158 GVLHHRLASLARVHGPVMALRLGLTTAVVVSSRDAAAEAFTKHDRRLAARVVPDSNRA 985
984  HGFSDRSVIWLPSSDPRWKTLRGIQATHLFSPRGLAAVRAVRESKVRDIVAYFRSRAGEE 805
804  VVFGEAIYSGVLNLVSSSFFSVNMAGVGSEEAHGLRELVEDLVEAVAKPNVSDLFPFLR 628
627  QLDLQGLRRRTEERMARAFGILDGIIDRRLANRTHGDRHGDFLDALLDLVSEG 469
468  KMARDHVTIMLFEVFGAGSDTMSISLEWAMAELLRNPRAMRKARAELEDAAAV 310
309  VEESDAARLPYLQAVVKEAMRLHPVGPILLPHRAVEDGVEIGGYAVPRGAMVI 151 (fs)
149  FNAWAIMRDPAAWERPDEFVPERFMETTTAIDFRGKEYEYLPFGSGR 3
RLCPGLPLAERVVPFVLASLLRAFEWRLPDGVSAEDLDVSERFNTANVLAVPLKVVPVIVN*

>AP005114.1a $F CYP76M6 (japonica cultivar-group) chromosome 2 clone P0689H05
BI813130.1 cDNA clone J002D01.Length = 497 75% to BI808700.1 68% to AP003623
BI813468.1 K008G06 Oryza sativa mature leaf library induced by M.grisea Oryza
sativa cDNA clone K008G06.Length = 474
best rice match AP003623.1 chromosome 6 63% clone P0642B07 41% to 76C4 = AU095771
26813 MEKLKSELWMTAVATCMSLLLYLTILRRRHASGGRSLALPPGPTPLPLIGNLLCLGGIFHQTLA 27004
27005 KLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARPVPDAFRANGFSERSIVF 27184
27185 SPSSDPQWKNLRGIHATHIFSPRALAALRGIRERKVRDIVGYIRTVAGEEMCVREVVHNG 27364
27365 VLNLISTSFFSMDMADVRSESARGLRGLIEDIIATVAGPNVSDFFPFLRQLDLQGLRRQT 27544
27545 GSHLGIVFGLLDDIIDRRMAETRDHPDKQRHGDFLDALISLASAGKIPRYHITYLLFDVF 27724
27725 AAGADTMTTTVEWAMAELLRNPRVMAKVRAEVTDALGGRESFDEGDAASLTYLQCVFKEA 27904
27905 MRLHPVGSILVPHLAVQDGVEIGGYAVPKGTTVIFNAWAIMRDPAAWESPDQFLPERFLH 28084
28085 KEESSSPPLELRGKDYEYIPFGSGRRLCPGLPLAERAVPFILASLLHAFEWRLPDGMSPD 28264
28265 DMDMTEKFATANVLATPLKAVPVASHTS* 28351

>AP003623.1 $F CYP76M7 chromosome 6 clone P0642B07 41% to 76C4 = AU095771
84245 MENSQVWLLWGALSVAVLFYLSTLRRRHAGGKPLPPGPTPLPLIGNLHLAGGTSFHHKLRDLAR 84436
84437 VHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSS 84616
84617 DPRWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLMAYLRAHAGEEVLLGQAMHTGLL 84790
84791 NLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWTTKRFNRVFSIMGDI 85006
85007 IDRRLAHIRDNKPSHNDFLDSLLELMAAGKIDRVNVLDMLFEAFVAGADTMALTLEWVMA 85186
85187 ELLKNPGVMAKARAELRDVLGDKEVVEEADAARLPYLQAVLKEAMRLHPVGALLLPH 85357
85358 FAVEDGVEVGGYAVPKGSTVLFNAWAIMRDPAAWERPDEFVPERFVERAPLLDF 85519
85520 RGKDAEFMPFGSGRRLCPGLPLAERVMPFILASMLHTFEWKLPGGMTAEDV 85672
85673 DVSEKFKSANVLAVPLKAVPVLIK* 85747

>AK069701   CYP76M8     1737 bp    mRNA    linear   PLN 24-JUL-2003
MENSQMWLLWGALSVALFFYFSTLRR
RYAGGKPLPPGPTPLPLIGNLHLVGGGTFHHKLRDLARVHGPVMTLKLGLATNVVISSRE
AAIEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSSDPQWKALRGIHASHVFTPRVLA
AVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTGILNMVSFSYFSVDIVDMGSQMARELR
EVVDDIILVVGKPNVSDFYPFLRPLDLQGLRRWTTKRFNRVFSIMGDIIDRRLAHIRDNK
PRHDDFLDSILELMAAGKIDRVNVLNMLFEAFVAGADTMALTLEWVMAELLKNPSVMAKA
RAELRDVLGDKEIVEEADAARLPYLQAVLKEAMRLHPVGALLLPHFAMEDGVEVGGYAVP
KGSTVLFNAWAIMRDAAAWERPDEFVPERFVERTPQLDFRGKDVEFMPFGSGRRLCPGLP
LAERVVPFILASMLHTFEWELPGGMTAEELDVSEKFKTANVLAVPLKAVPVLIK*

>AP004684.1a $F CYP76M9 chromosome 6 clone P0012H03, Length = 163117 41% to 
10968 MQQQVTEFANAGSDTHAERKQSELTAAEMGHELWVLW
11079 ATLAVSLLCYLYLTSHRLGSRRRRWPPGPRPLPLLGNLLDLRGG 11210
11211 NLHHTLARLARAHGAPVMRLQLGLSPAVVISSPGAAREAFTAHDRRLAARAVPDAN 11378
11379 HALGFCDRSMIWLPSADPMWRTLRGVVAAHAFSPRALAAARAVHERKVRDLVA 11537
11538 YLRGRAGREVDVKDAVYGGVLNLVSSALFSADVVDVGGESAQGFRELVEELIESIAKPN 11714
11715 VSDLFPFLRRFDLQGWRRWTSGHLAKIYKVLDDIIDRRSAEDDAAMDKRGDFLDVL 11882
11883 LELMSTGKIAREYLTNILFDVFTAGSDTMSLTVVWAMAELLRNPGVMAKAR 12035
12036 AEIDAALGGREAVEEADVARMPYVQAVLKEAMRLHPVAPVMLPRKAAEDGVEIGG 12200
12201 FEVPRGCAVIFNTWAIMRDPAAWERPDEFVPERFVGRSRATEEMDFRGKDFGFLPFGSG 12377
12378 RRLCPGVPMAERVLPLIMASLLHAF 12452
12453 EWRLPDGMSAEQLDVSEKFTTANVLAVPLKAVPVVIAC* 12569

>AP005254.1c $F CYP76M10 (japonica cultivar-group) chromosome 8 = AF488521.1 PM-I
103909 MEREAWLLCAALAAAMVYYYYYYLACTTRRAQRRLPPGPTPLPVIGNVLSLSGDMHHEL 
104086 ARLAREQYGPVMTLKLGLFTAVVVSSPDAAREAFTKHDRRLAARTVPDISRARGLTGRSM 
104266 IWLPSSDPRWKTLRSAVATHFFSPRSLAAARGVRERKVRDIVNYFAGHAAEVIDVGEAVY 
104446 GGVINIVSNAFFSADVVDVGKESAHGLRETLEDIILAIAKPNVSDLFPFLRRLDLQGWRR 
104626 WAEKRYDKVFGILDDKINSRLADADADASTKKHGDFLDSLLELMSAGKIACDDVTTVMFD 
104806 AFGAGTDTISNTVVWAMAELLRNPSIMAKVRAEMEDVLAGKKTIEENDTEKLPYLRAVIK 
104986 EAMRLHPVAPILLPHRAAEDGVEIGGYAVPKGSTVIFNVWTIMRDPAAWERPEEFMPERF 
105166 LQRAEVDFRGKDFEFIPFGAGRRLCPGLPMTERVVPFILASLLHAFEWRLPVGVAAETLD 
105346 LSEKFTTVNVLVTPLKAIPILASHQI* 105426

>AP005254.1d CYP76M11P (japonica cultivargroup) chromosome 8 aa 227-504
GGVLN
110436 LRRLDLQGWRRWAEKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGK 110257
110256 IARDDVTSIMFDLFGAGTDTIAITVEWAMAELLRNPSVMTKARAEMNHALAGKKTIEEND 110077
110076 VEKLPYLQAVLREAMRLHPAAPILVPHRAEEDGAEIGGYAVPKGSTVIFNVWAIMRDPAA 109897
109896 WERPEEFMPERFMDMAEEVDFRGKDYKFIPFWAGRRLCPGLLMAERVVPFILASLLHSFE 109717
109716 WRLPGGMTAESLDLSEKFTTVNVLVTPLKAIPILASKNENIRE* 109585

>aaaa01004667.1a $PI CYP76M12P (indica cultivar-group) 
1103 LHGGTTAEDVDVSEKFKSANVLAVPLQAVPVL IKFVGRT*

>AL713947.1 $F CYP76M13 chromosome 12 clone Monsanto-OJ1003_A04, 
MASGLWFLGISLAVLLLCYVGTNRRGDGQRPPGPRTLPIVGNLLDLRGGNLHHKL 
ASLAHAHGPVMTLKLGLVTTVFISSRDAAWEAFAKHDRRLAARTVPDTRRALAHAERSM 
VWLPSYDPLWKTLRSIAA  45837
45835 THVFSPRSLGVARSARERKVHDMVDSFRRRAGQEVDIGQVLYHGMFDLLANVLLSVD
AHPNLRDLMEDIVAILAKPNASDFFPLLRPLDLQGIRHWTAIHMSRVLHILDSIIDC 
RLAQGTDDQCKDVLDSLLVLMSTGKLSRRDVKILLFDILAAGTETTKITVEWAMAELL 
RNPNVMATTRAEMKAALGGNGTITEADVVNLPYLQAAVKESMRLHPVAPLLLPHLVVEDG 
VRIGGYAVSKGTTVIFNSWAIMRDSTAWERPDDFLPDRFLGKTELDLWGKQAKFIP 
LGSGRRLCPALPMVELVVPFTVASLLHAFEWHLPKGMSAEEVDVTERYTSNDILVMATPLKAVPLIVT* 

>AP003267.1 $F CYP76M14 chromosome 1 clone P0496H05 38% to 76C4
55979 MEKSSELWLLWAVFSASLVFLYLTIRRRSGAGAGGKPPLPPGPTPLPLIGNLLDLRGGVIHDKLAALARVYG 55764
55763 PVMMIKLGLNDAVIISSRDAAREAFTRYDRHLAARAIPDTFRANGFHERSAVFLPSSDER 55584
55583 WKALRGIQGTHIFTPRGLAAVRPVRERKVRDIIAYFRDHAGEELVIRQAIHTGVLNLVSS 55404
55403 SFFSMDIAGMGSETARELREHVDEIMTVFAQPNVSDYFPFLRRLDLQGLRRSTKRRFDR 55227
55226 IFSILDDIVERRLVDRGERGGEGGASSNSSKSKHQYDGGDFLDALLELMVTGKM 55065
55064 ERDDVTAMLFEAFVAGGDTVAFTLEWVMADLLRNPPVMAKLRAELDDVLGGKDQSAIEEH 54885
54884 DAGRLPYLQAVLKESMRLHSVGPLLHHFAAEDGVVVGGYAVPRGATVLFNTRAIMRDPAA 54705
54704 WERPEEFAPERFLAREGKAPVDFRGKEADFIPFGSGRRLCPGIPLAERVMPYILALMLRE 54525
54524 FEWRLPDGVSPEELDVSEKFMSVNVLAVPLKAVPVKVIN* 54405

>AP005069.1a CYP76N1 (japonica cultivar-group) chr 2 no indica ortholog found 9/11/02
17537 MAASLAWLLVAIVLASLYLAMHHRVAAARRRRLPPGPTPLPLVGNLLSVSRSGPHRSLA 17361
17360 RLAERYCPLMRVRLGVVDYVVASSPAVAGDIHHHSHNAHLASRPLFDVWRGAEHHRNSVI 17181
17180 VLPLHGVWRAQRRLATEEVMSPRRLDALAPTRREKVRELMRCVARRAARGEPVEVGLEA 17004
17003 FEAFLGILSCTAFSADLVDP 16944 frameshift
16944 DLRDAVQEATKLAATPNASDFFPAMAAAD 16858
16686 LQGLRRRMGKLVARAYGIIDELLARRKGGREAGEPRKDDMLDVALDNEDEWKNNNPVID 16510
16509 RNNIKGLIA 16483
16286 DLFVAGTDSGSTAIEWAIVELLQNPQSMQKVKDEFRRVLGTRTEIEESDISQLPYLQAVL 16107
16106 KETLRLHPSVPMTYYKAEATVEVQGYIIPKGTNIILNIWAIHRKPDVWADPDRFMPERFM 15927
15926 ETDTNFFGKHPEFIPFGGGRRICLGLPLAYRMVHMVLASLLFHFDWKLPEGAEKDGVDMR 15747
15746 EKYGMVLHKETPLKALAIETYNR 15678

>aaaa01007897.1 $FI CYP76N2 (indica cultivar-group) 
9748 MPAMAASLAWLLLALLLASLYTATHRIAAARRRLPPGPTPLPLVGNLLSVSRTSP 9584
9583 HRSLARLAARYGPLMRVRLGVVDYVVVSSPAVADDIYHSRHNAHLSSRPPYDAWWGEKHR 9404
9403 LNSVIALPPHAVWRAQRRLAMEEVMSPGRLDALAPLRREKVRELLVRVRRVAAA 9242
9241 RGDGDGELVPVEVGQAAFEGFLSILSSTMVSVDLADSDLRDVVREAAILAATPNVSDIF 9065
9064 PAIAAADLQGYRRRMGELVARGYGIFEELLARRKGGREAGERRKDDLLDVVL 8909
8908 DREDELKKESNPVLDRNAIKGLIT (0)
7478 DLMVAGTDTSSSTIEWAMAELLQNSESMQKVKDELRRVIGTRTQIEESDISHLPYLQAII 7299
7298 KETLRLHSNVPMSYYMAEATVEVQGYTIPKGTNIIVNIWAIHHQPNVWVDPDKFMPERF 7122
7121 IGKDTNFFGKHPELIPFGGGRRICLGLPLAYRMVHVVLASLLFHFDWKLPEGAKKDGIDM 6942
6941 SEKFGLVLSMATPLKALATRSCNDM* 6864

>AC074054.1a $F CYP76N3 chromosome 10 clone OSJNBa0090A14 gene 1
21949 MAFFHLCISSLLLVFIISYIFQPLLDARRRFPPGPHRLPVISNLHNIGKNPHHAFARLADRYGPLM 21752
21751 SIRLGGVRAVVAMSADAAREILQRNNADITGRGGMDSWHACGHHANSSIALWPRWKWCA 21575
21574 MRMLCTEELL 21545
5536 GVTHAMREEVARELAHRVSDGSAGGMPVSVAREAFAAVAGVLWWSMFSEDMDAATTRQLRDVIE 5345
5344 EAVVVAGAPNLSDYFPVIAAADVMGVRRRMDNLVGWVYGIIDVQIDRRRRRRIVCEPRKN 5165
5164 DLLDVAFDMEGEVESEGWVMNQDTMRGM 5081
4770 AIYQDLLVAGSGSTSSTIEWAMAELLQNPKSMIQLPEELKGLMGTKTHVAESDISQLPYL 4591
4590 QAVIKETLRLHPTVPIAFNKAEATVEIQGYKIPQGTTVYVNIWAICRRAKIWDDLDKFM 4414
4413 PYRFLGRDINFLGTNFEFIPFGAGRRICLGMPLAEGML 4300
4291 HLMLASLLHRFEWTIPDEVKGDDLDMAEEFGLVLSMAKPLRAVAKET* 4148

>aaaa01082499.1 CYP76N4P (indica cultivar-group) 52% to aaaa01007897.1 76N2 $FI
637 DLFVGATDRSSNTIEWALAELLQNSQTMRRPREELRAVISSKSRFDVSIQNINDQK 470
469 F*AVLKETLRLHSVVPMLSSKAEAXX 398 FRAMESHIFT
390 TVHGYTVPEGNNVNVLVNVWAIHDNA

>AC074105.1 $F CYP76P1 chr 10 clone OSJNBa0030B02 19 unordered pieces 39% to 76F2 
40% to 76C2
60125 MAIFIGCICS
60095 LALLLLCSHVFQLLSDARRRLPPGPRPLPVIGNLLDVAGELPHRSLACVAERYGPL 59928
59927 VTLRLGTMLAVVASSPATARDVLHRHGASITDRGTPDAWSTDGHDGNSIFAFPTRHHRWR 59748
59747 ALRRLGAEQLFSPRRVEEQRPLRRDAVRGLLRHVAELAAASGGGGAAVVDVGRAAFAAMA 59568
59567 SLLFGALFSAGIDAATSCRFRDAAREFALLTMTPNVSEFFPVVAMADLQGL 59415
59414 RRRTARHITWMYQLIDGHVERRMRGRETAGGCGAAHGEKEKDLLDVMLDMSEKEEQNDD 59238
59237 SSLTMN 59220
57988 DLLMAGSETSSAVIEWAMAELLQNPQTMTKLQEELKKVIGSKTCIDEEDIDQLPY LQAVI 57809
57808 KETHRLHPAIP LLMYKAAVPVEIQGYKIPKETTVIVNTWAIHQNSEVWIEPDKFIPERF 57632
57631 LQKEISLSSGSTNMELIPFSAGRRFCLGYPVANRMLHVMLASLVHQFQWTLPEVVKKN 57458
57457 GGVDMAEKFGITLSMATPLHAIAKNIV* 57374

>AL831811.1 $F CYP76P2 chr 12 
      MAIFIGCICSLALLLLCSHVFQLLS
31323 DARRPLPPGPRPLPVIGNLLDVAGELPHRSLSRVAQRYGPLVTLRLGTTLAVVASSPATA 31144
31143 REVLHRHGASITDRGTPDAWRTDGHETNSIFALPTRHHRWRALRRLGAEQLFSPRRVEKQ 30964
30963 RPLRRDAVRGLLRHVSELAAASGGGTGTAVVDVGRAAFAAMANLLFGSLFSVGIDAATSC 30784
30783 RFRDAAREFALLTLTPNVSEFFPVVAMADLQGLRRRTARHITWMYQLIDGHVERRMRGRE 30604
30603 TAGALGEKEKDLLDVMLDISEKQEQSDDSLTINRGVIR 30490
28669 DLLTAGSETSSAVIEWAMAELQQNPQTMRKLQEELKKVIGSKTYIDEEDINQLPYLQAV 28493
28492 IKETHRLHPAIPLLMYKAAVPVEIQGYKIPKETTVVVNTWAIHQNSEVWIEPDKFIPERF 28313
28312 LQKEISLSSGSTNMELVPFSAGRRFCLGYPVANRMLHLMLGSLVHQFQWTLPEVVKKNGG 28133
28132 VDMAEKFGLTLSMATPLHAIAKNIV* 28055

>AC092749.1b $F CYP76P3 clone OSJNBb0023M11, from chromosome 10, complete sequence
35% to 76C3 53% to AC074105.1
71148 MVFLLVCMCSLLLMFLISYALQLFGDARRRLPPGPTPLPLIGNLLDIASDLPHRSLA 70978
70977 RLAGRHGPLMAVRLGTVVAVVASSSSTAREVLQTHNGSLTGRVPPDAWHGVGHAANSVFV 70798
70797 LPPRRKWRALRRIGAEHLLSARQLDGRRLLPLLRDAVLDLLRRVSEMSAASGGGAGAPVQ 70618
70617 VGHAAFAAMMDMQWRAMFSAGLEDDDARVLQDAAREAVALSLKPNLSDFYPALAAV 70450
70449 DLQGLRRRFAGRVGTVYHLVDEQIERRMRRRREAAGDDGEARSEDDLLDVLL 70294
70293 DMSEHGKDDGKVAIDRDLIRTFLT (0)
67984 DIFLATVDTIASTLEWAMAELLQDRETMRKLQEELKKVLGSKTHAEYADMDRLPYLRAVIKETLRLH 67784
67783 PVVPIVPNVAEEMVEIHGHVVPRGSTILVNLWAVHRDAEAWPEPNRFLPERFMLRQHGQ 67607
67606 EAAGRALGTATTEFGLIPFSAGRRVCLGLPLATRMLHAMLGSLLHRFEWTLPLEVEENGV 67427
67426 DMSENLGLTMTMATPLQAIAKSI* 67355

>AC092749.1a $P CYP76P4P clone OSJNBb0023M11, from chromosome 10, complete sequence
64120 LMAVRLGTVVSIVASSPSTARQILQTHNGSLTGRV 64006 
64019 AWHGVGVGHAANSVFVLPPRRKWRALRRIGAEHLLSTRQLDGACMPLLR 63874
63872 SEMSAASGGAPVQVGHAAHAVFAAMVDMQWRAMFSAG 63762

>AC074054.1b $P CYP76P5 chromosome 10 clone OSJNBa0090A14 gene 2 41% to 76F2 
56068 MAFFLPLAFSLFLAVISAYVLQLLADARRRL 
      PPGPWPLPLIGNLHQLDHLPHRSLARLAARHGPLMSLRLGTVRAVVASSPEMAREVLQRH 55796
55795 NADIAARSFGDSMRAGGHCENSVVCLPPRRRWRALRRLSTVGLFSPRRLDAMRALLEEKV 55616
55615 AELVRRVSGHAARGEAVDVGHAAHVAALGVLSRTMFSVDLDPEAAREVSDIVDEASVL 55442
55441 GTGPNVSDFFPAIAPADLQGVRRRMARLVKRMYAIIDEQIERRMHGRTAGEPRKNDLL 55268
55267 DVMLEEGESKEDSNEINRDAIRGL 55196
54837 DLFTGGETTSHTMECAMAELLQCPNSMRRVHELKSVIGSKQQMDEHDITKLPY 54679
54682 LPPYEAEATIEIQGYTIPKGAKVLINLWAINRCANTWTEPDKFMPERFYDSDITFMGRDF 54503
54502 QLIPFGAGKRICLGLPLAHRMVHLMLGSLLHRFTWTLPAEAGKNGVDMRERFGLTLSFVAPLYVIAQEIQ* 
54290

>AC105746.1 $F CYP76P6 chromosome 10 clone OSJNBb0086I08, Length = 123484
MSAFCWSATRSPSRQRLIENGFLFACKHHALTPARPLLPPLQ
31481 RIAAARRRLPPGPCPLPLIGNLLDIGXLPH
      RSFARLAERYGPLMTVRLGAATCVVASSPATARAV 31288
31287 LQTHNASLAGRGRQDAWHAGG
116-306
102155 HAENSVFVLPPGRKWRLLRKLGAAHLFSRRKLAELAPLRDEIVGGLLRRVAERADHRGG 101979
101978 APVNVGRLALAANVELLWRSVFSTRLDAATLDVLCDVAREAAVLLGTPNVSDFFPA 101811
101810 VAALDLQGLRRRLAELMKNTYRLVDAQIDHRMRCRELRGGRGGEAMDLLDVLLDMSE 101640
101639 QEREDGDDEVINR
307-504
101097 DLFVGGSDSTATTVEWAMAELLQNPEIMKTLQQEIKMVLGTRSQVEESDIGQL 100939
100938 PYLQAIVKETLRLHPIVPLRLYEAERTVEIEGHTIPKGSKVIVNAWAIHQSVKVWIQP 100765
100764 EKFLPKRFITKDIDFAGRHFEFIPFGSGRHICIGLPLANRMLHMILGSLMHQF 100606
100605 KWTMPQMVNRNGLDMAEKFGLAVSMATRPNIIA 100507

>aaaa01002827.1 $FI CYP76Q1 (indica cultivar-group) one frameshift
12880 MAFFLVACLPWVCFILLSLYVFQLFADARRRLPPGPWPPKPLIGDLLALGKGDQQ 12716
12715 HRSLARLADRYGPVMSLRLGTVLTVVVSTPDAMREIFHKNKDNLAGRPTADAFNAMGHSA 12536
12535 NSLLGLEHPGVRWRAIRRFSTAELLAPRRLAALQPLCRDKVRGLVRGVSELAARGEPVHV 12356
12355 RRVALDMALSLI  12320
12322 LSAIYSVDLDPESTAVFRSVVEEAMLLIGTANLSDLFPAIAALDLQGVRRRVA
      ELFTITYRQYDEQVARRRPERDAGEAGKNDLLNVVLDMEREWQQKGSVLSHDAMRVLFT (0) 
8887  DLYGAGASTTSVLIEWAIADLLQNPESMRKIKEEITNVIGTNAQIQESDIARLPYLQAVV 8708
8707  KETLRLRAVAPLVPRRAEATIEVQGFTIPKGTNVILNLWAINRDARAWNDPDKFMPERF 8531
8530  IGNDINYLGQNFQFVPFGVGRRICLGLPLAQKVMYLVLGTLVHQFEWTLPEELKDTGIDM 8351
8350  TEKCGMVLCLANPLKVMAKKM* 8285

>AP003522.1 $F CYP76Q2 chromosome 6 clone P0036B02, 37% to 76C2
AP004726.1 chromosome 6 clone P0486G02
AU096446.1 Rice green shoot cDNA clone S13713.Length = 477 49% to 76C2
129851 MAASSFLVECLSWLVVVLFSLYIFQLLRDARRRLPPGPWPPKPLVGDLLDLGEDGKQHRTFLRLAGR 130051
130052 YGGLMCLRFGMVPHVIVSTPDALRAVFAAAGAGGGGGGEGKKVDGIAGLPSLDVLSAMGH 130231
130232 RAHTIFALPSQDGKWRALRKFAAAEMLAPRRISSAAAGAQLQTKIVEALRREVSGHAARG 130411
130412 AAVVFRHAVLDSILSLLLGVLYSTDLEREERAMFRDLIEEIVGMLGTANVSDVFP 130576
130577 PVAALDLQGLRRRMTDLLTIMYRHFDDQVALRRRSRDAGEARKNDVLDTVLDKEES 130744
130745 EWKQEGSLLSHDVMRVLLS 130801 (0)
131025 DLYGAGASTTAALIEWGMVDLIQNPEVMTKVREELTNVLGDKLVMDESDIARLPYLQ 131195
131196 AVVKETLRLRTVVPLVPRKAEVDIEVNGYRIPKGTNVILNAWAINRSADAWSEPDKFIP 131372
131373 ERFLGGETRGYLGQDFEMIPFGLGRRICPGMPLAQKLIPLIIGTLLHRFEWELPADAK 131546
131547 EGGIDMTEKCGVVLSLVNPLKAIPKEI* 131630

>AL731641.1 $F CYP77A9 chromosome 4 clone OSJNBa0042I15 = AU070007 
42403 MQPTWLATMPAASSLVVGVAFTAAVAVAVAAAVARRAWRHRGLRLPPGPPGWPVVGNLLQ 42582
42583 VVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESP 42762
42763 IRSIFSSGKFTVNSAVYGPEWRSLRRNMVSGMLSAARLREFRPARLRAMERFVARVRAEA 42942
42943 AASRDGASVWVLRNVRFAMFCVLLDMTFGLLDLDEELVVRVDAVMKRVVLAVAARIDDYL 43122
43123 PFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYSYLDSLL 43302
43303 DLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHGEIMQRV 43482
43483 GDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVDANLDIF 43662
43663 LPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPFSAGRRICPGVGMGTAHIA 43842
43843 LMVARMVQAFEWRAHPSQPPLDFEDKVEFTVVMKRPLLAMVTPRKLSF* 43989

>AP003723.1 $F CYP77B2 chromosome 6 clone P0003H08 60% to CYP77B1
127597 MVDMNDVLLVVSAAVLAAMWWRRCSRTGGADG
127693 LPPGPPGWPVVGNLFQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTDADLIHD 127869
127870 ALVKQGAAFASRPEDSPTRLLFSVGKCTVNSAPYGPLWRALRRNFVAEIVSPPRVKGFSW 128049
128050 IREWAVGSHLRRLRAEFAATGAVRMMANCRLSICSILICICFGAKIPDELIREIEEVLKD 128229
128230 VMMMTMPKLPDFLPLLTPLFTKQLAAARELRRRQLGCLAPLVRARREFIRGGGERNA 128400
128401 DGNTVVGGVEMVSAPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATAL 128577
128578 EWAMMHLVLDAGVQDKLYGEVVSKVGTTARITEADVEAMPYLQ 128706 (0)
129997 AVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENPATWPDP 130161
130162 EAWRPERFLEGGEGFDTDITATRALRMMPFGAGRRICPAATLGVLHIQLMLANMVREFRW 130341
130342 VPPAGEGPPDPTETFAFTVVMKNPLRAALVERRVGGELATGGGGGAAASA* 130494

>AC083943.6 $F CYP78A11 clone OSJNBa0044A10, 61% to 78A7
40753 MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLAFATAAVLAWAASPGGPAWAHGRGRLGA 40965
40966 TPIEGPRGLPVFGSIFALSRGLPHRALDAMSRDAAAPRARELMAFSVGETPAVVSSCPAT 41145
41146 AREVLAHPSFADRPLKRSARELLFARAIGFAPSGEYWRLLRRIASTHLFSPRRVAAHEPG 41325
41326 RQADATAMLSAMAAEQSATGAVVLRPHLQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQ 41505
41506 LKSMVREGFELLGAFNWSDHLPWLAHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRD 41685
41686 SSSTAADNADFVDVLLSLEAHENLAEDDMVAVLW 41787 (0)
41874 EMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMP 42035
42036 YLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 42215
42216 EAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWF 42395
42396 LPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA* 42506

>aaaa01004390.1 $PI CYP78B4 (indica cultivar-group) Nterm missing and one frameshift
12657 SDRPVKDAARGLLFHRAMG 12713
12714 FAPSGDYWRALRRVSANHLFTPRRVAASAPRRLAIGERMLDRLSALAGGEIGM 12872
12873 RRVLHAASLDHVMDTVFGTRYDGDSQEGAELEAMVKEGYDLLGMFNWGDHLPLLKWL 13043
13044 DLQGVRRRCRTLVQRVDVFVRSIIDEHRQRKRRTGGNGGGEELPGDFVDVLLGLQGEEKM 13223
13224 TESDMVAVLW (0?)
      EMIFRGTDTVAILLEWI 13403
13404 MARMVLHPDIQAKAQAELDAVVGRERAVSDGDVAGLRYLQCVVKEALRVHPPGPLL 13571
      SWARLAVRDAHVGGHA 
13622 VPAGTTAMVNMWAIAHDPELWPEPDEFRPERFAEEDVSVLGGDLRLAPFGAGRRACPGKT 13801
13802 LALATVHLWLAQLLHRFEWAPVGGGVHLLERLNMSLEMEKPLVCKAKPRW* 13954

>AP005175.1 $F CYP78B5 (japonica cultivar-group) chr 7 
116502 MALSSMAAAQESSLLLFLLPTSAASVFPPLISVVVLAALLLWLSPGGPAWALSRCRGTPP 116323
116322 PPGVAGGAASALSGPAAHRVLAGISRAVEGGAAVMSLSVGLTRLVVASRPETAREILVSP 116143
116142 AFGDRPVKDAARQLLFHRAMGFAPSGDAHWRGLRRASAAHLFGPRRVAGSAPEREAIGAR 115963
115962 IVGDVASLMSRRGEVPLRRVLHAASLGHVMATVFGKRHGDISIQDGELLEEMVTEGYDLL 115783
115782 GKFNWADHLPLLRWLDLQGIRRRCNRLVQKVEVFVGKIIQEHKAKRAAGGVAVADGVLGD 115603
115602 FVDVLLDLQGEEKMSDSDMIAVLW (0?)
115439 EMIFRGTDTVAILMEWVMARMVMHPEIQAKAQAEVDAAVGGRRGRVADGDVASLPYIQ 115266
115265 SIVKETLRMHPPGPLLSWARLAVHDARVGGHAVPAGTTAMVNMWAIAHDAAVWPEPDAFR 115086
115085 PERFSEGEDVGVLGGDLRLAPFGAGRRVCPGRMLALATAHLWLAQLLHAFDWSPTAAGVD 114906
114905 LSERLGMSLEMAAPLVCKAVAR 114840

>aaaa01023161.1 CYP78B6 (indica cultivar-group) ortholog of AC097276.6
2560 MVSFSYLDSTFLPLLATTMASPLHACLLLALLFLALAFFHPGGVAWALSSSGGHGAAAIP 2381
2380 GPRGVLLAFAGPNPHRALASLAASTRGATRLMAFSVGLTQFVVASHPDTAREILAGAAFA 2201
2200 DRPVKEAAAELMFHRAMGFAPHGGYWRRLRRLASAHALAPGRLAARRRAIGEETV 2036
2035 RRVAAAMARDGAVGVSRLLHLASLDNVMASVFGVGLGELGAGAVSELEEMVGQGYELLGT 1856
1855 FNWGDHLPLLRLLDVHGVRRKSRALASRVKVFVSKIIEEHQTRRDAKYGGCDGDGDFVDA 1676
1675 LLGLEGEERLEEEDMVAVLW (0) 1616
3584 XXXXXGTDTVAILLEWVLARMALHPDVQAKAQAEIDAAAVSGDAAALPYLHCVVKECLRMHPPGP 3405
3404 LLSWARLATRDAHLDLGADAGGRAALVPAGTTAVVNMWAIARDGGLWRDPGVFRPERFLG 3225
3224 DGEAAGVGVAGGAGGYDLRLAPFGAGRRACPGRALAMATVHLWLAQLLRSFRWVPSGDRG 3045
3044 VDMSERLGMSLEMEKPLICLALPRTSST* 2958

>AP004704.1a $F CYP78C5 chromosome 8 clone P0544G09, Length = 137478
42285 MDMDSSPSTQDCGGWLLYVSLAAKCGGDPCRVVGFVAVAVVAFAVTSLLHWLSPGGPAWGRYWWNRRGGLGIAAAI
42057 PGPRGLPVLGSMSLMAGLAHRKLAAAAGGSPARRRLMALSLGETRVVVTADPGVARELLA 41878
41877 SAAFADRPVKESAYGMLFHRAIGFAPYGTYWRALRRVASTHLFSPRQVSASAAQRA 41710
41709 VIARQMVEAMRSAAAAAAGGGVAARPFLKRASLHNVMWSVFGRKYELAAPESEETAEL 41536
41535 RSMVDEGYDLLGQLNWSDHLPWLAPFDLKKTRSRCSSLVPRVNRFVTRIIDEHRARLSLA 41356
41355 VDAAVDFTDVLLSLHGGDKLSDADMVAVLWVCT 41257 (0) 
41183 EMIFRGTDTVAVLIEWVAARLVLHQDVQARVHDELDRVVGSDRAVTESDAS 41010
41009 KLVYLQAVIKEVLRLHPPGPLLSWARLATSDVHVGGFLIPSGTTAMVNMWAITHDPAVWP 40830
40829 DPNEFKPERFVAGPSSDQATEFPIMGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLH 40650
40649 EFDWLPLSDKSRGVDLSEVLKLSCEMATPLEARLRPRRKV* 40527 

>aaaa01017257.1 CYP78C6 (indica cultivar-group) small seq gap of about 3 aa
MATPEDTGSWLLYLSLAAKCSGDGDGQPHRLLGFVVVCAVAGLVTCLLHWSFPGGPAWGRW
3808 WWTRRRRRGSPCGVAAVPGLRGLPVIGSMWLMTGLAHRKLAAAAEAAGAGRLMALSLGE 3984
3985 TRVVVAAHPDVAREILHGAAFADRPVKESAYGLLFHRAIGFAPHGAYWRALRRVA 4149
4150 STHLFSPWQVAASAPQRAVIARQMVRAIKLQQRSRSGDSAAGA 4278 
     RRASLHNVMWSVFGRRYELQLDPGKESDEVRELRALVDEGYDLLGQLN
     WSDHLPWLARFDLQSTRARCSRLVPRVNRFVTRIIDEHRSSAPVAAAI
     DFTDVLLSLQGSDKLADSDMVAVLWVRH (0)
4829 EMVFRGTDTVAVLIEWVLARLVLQQDVQARVHDELGRVVGLDRDVTESDTASLVYLH 4999
5000 AVIKETLRLHPPGPLLSWARLATSDVHVDGYLIPAGTTAMVNMWAIAHDPDVWAEPMEFR 5179
5180 PERFIGKAAEFSVMGSDLRLAPFGSGRRSCPGKSLAMATVAFWLATLLHEFALLPSPDP 5356
5357 AHGVDLSEVLRLSCEMATPLAVTAWPRRVV* 5449

>AC099399.1 $F CYP78C7 chromosome 3 clone OJ1006_F06, Length = 122577
49121 MATSFVYLAIFACLAWAGTALLYWAHPGGPAWGKYRRARGQSPRCSI
48980 PGPKGLPVVGSLGLMSGLAHCSLAAEAARRPGAKRLMALSLGPVRAVVTSHPDVAKEIL 48804
48803 DNPAFADRPLNHAAYGLMFHRSIGFAEHGPYWRALRRVAAGHLFGPRQVDAFAPYRA 48633
48632 RVAGGVVAALRGAGGEAAVQVRGVLRRASLYYIMRFVFGKEYDVSRGAPESGEEVEELL 48456
48455 EMVHEGYDLLGKENWCDYFPGLAAVDPQGVGARCAELMPRVNRFVRGIIQEHRGKAIA 48282
48281 GGEARDFVDILLSLQESEGLADADIAAVLW 48192 (0)
47885 EMIFRGTDAMAVLMEWTLARVVLHPDVQANVHRELDAVVGRSNTVAESAVPSLPYLQALL 47706
47705 KEALRMHPPGPLLSWRHRAISDTYVDGHLVPAGTTAMVNQWAMSRDADVWDAPLEFQPER 47526
47525 FLPGGKAHGVSVLGADGRLVPFGSGRRSCPGKSLAMTTVTAWMATLLHEFEWTPASGA 47352
47351 VDLSEVLRLSCEMAVPLEVRVSARRNV* 472968

>aaaa01012488.1 $FI CYP78D1 (indica cultivar-group) 47% to CYP78A5 orth AA751892
5682 MRNEVLSTIFLLLIFFTTTINPSSSQLPWLFSLLYLSLAMAVVALPPLLAKRHGHARRVN 5503
5502 GGGAAIPGPRGWPLLGSLPAVSGPLMHRRLAALAYAHGGGARR LMSLTLGATPVVVSSHP 5323
5322 DTAREILAGAAFRDRPARAAARE LMFLRAVGFAPAAGDDGGAYWRRLRRAAGAGMLS PRR 5143
5142 AAALAALRARVARRTSEAVSRGMAVPPGRVAMRALLHAASLDNMVGSVLGLEHHDHHGGV 4963
4962 ISDMGDMVREGYELVGKFNLGDYYSTTQYQCLWGLLDFHGVGPRCQRLAARVREQFGRVM 4783
4782 EERRKVSDLHKRDDLLSYMLSMPQEERIEDSDVIAVLW (0) 4669
3107 EMIFRGTDVVAILLEWAMARMVLHPDIQSKVQEELDRAVGHRPMTDSDIPSLRFLHCVIK 2928
2927 ETLRMHPPGPLLSWARLAVHDTYVGKHLVPAGTTAMVNMWAISHDETIWGDPWVFRPERF 2748
2747 MEEDINVLGSDLRLAPFGSGRRVCPGRMMGLSTSYLWFGRMLQEYKWSPAQPVKLTECLR 2568
2567 LSMEMKKPLVCHAVPRSKTG* 2505

>AC091302.4 CYP79A7 chr 3 = AC084319.5b 50% to 79B3
18071 MSEAMAVTMPPMRAPALVAMLVVVLVALVRRRRHRSKGAGGRLESLPPGPVGLPVIGNMH 17892
17891 QMLVNKPVFRWVHRLLADAGGEIVCVRLGPVHVVAVTSPEMAREVLRKNDAVFADRPTTF 17712
17711 AAESFSVGYRSASISPHGDQWRKMRRVLTAEILSPATEHRLRGARGEEADHLVRYVLVRC 17532
17531 GRDGAAVDVRHVARHFCGNVIRRLTLGRRHFREPRADDEDAAAPGRDEAEHVDALFATLN 17352
17351 YLDAFCVSDYFPALVGLDLDGQEKVIKKVMRTLNRLHDPVVEERVEEWRLLRKAGERRDV 17172
17171 ADFLDVLASLDDAAGRPLLTVEEIKAQTI 17085
14173 DIMIATVDNPSNAVEWALAEMMNKPEVMRKAMDELDTVVGRDRLVQESDVRDLNYLKACI 13994
13993 REAFRLHPYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERH 13814
13813 LSPYPAGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKP 13634
13633 AGVERVELREEAASLVLAQPLVLQATPRLAAHLYGAGK 13520


>aaaa01007189.1 $FI CYP79A9 (indica cultivar-group) ortholog of AL662990.1
     MPSQLIAQNDHAYVLTFL
4128 MSIAMAILLLVALFYRIKKQAAAMAAKRKQQPKLPPGLATMPVVRNMHQMLMNKPVFRWIHR 3943
3942 LLDEMDTEILCLRFGRVHVIAVASPEMARELLRKKDAMLASRH 3814
3814 SSFASRTFSFGYKNTIMSPGGDQWRKMRRVLTSEILSPAMERRMLGRRVEEADHLVNYVY 3635
3634 GHCNDGTVDVRHVTRHFCGNIIRKLVFGRRHFNSGDGNIGPGRDEEAHIDALFTALDYHG 3455
3454 AFSVSDYFPTLVGLDLDGHEEVVNGLMNTFNRLHDPIIMERIEEWKSLRTKGDKRREVAD 3275
3274 FLDVLISLEDAQGKPFLSVDEIKAETL (0) 3194
2567 EIILATVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGRERLVEESDIHNLTYLKACI 2388
2387 REAFRLHPYHPFNPPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERH 2208
2207 LKNTGTVVLAEPELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIEL 2028
2027 QESATSLQLSKPLFMQAKPRLLLHLYEADVLN* 1929

>aaaa01014830.1 $FI CYP79A10 similar to AL662990.1 a CYP79
4669 MFPSSVNMREQNNII
4624 IISIAMTILLLVVFFCRMLGNMAGKNKRKKQPKLPPGPATMPVLGNIHQILMNKPVFRW 4448
4447 IHRLLDEMDTEILCLRLGSVHVIAIASPEMAREALRRNDAVLTSRPVSFAWRAFSFGYKN 4268
4267 TVGSTGDQWKKMRRMLASEILSSAMERRMLGQRVEEADHLVNYIYRNCNSGTVDIRHVT 4091
4090 RHFCGNIIRKLVFGRRHFAFGAGNIGPGRDEEAHIDALFTALDYLGAFSISDYFPSL 3920
3919 VLNGLMSTFRRLHDPIIMERMEEWRAPRRNGDERREVADFLDVLISLDDAQGK 3761
3760 PLLSLDEVKAETL 3722 (0?)
3092 EIILNSVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGKERLVEESDIHSLTYLKACI 2913
2912 REAFRIHPYHPFNPSHVAIANITIAGFMIPKGSHIILSRIGLGRNPRAWDNPLEFRPERH 2733
2732 LKNTDNVVLAEPELRFLSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSISPGANRIEL 2553
2552 QESVTSLQLSKPLLMQAKPRLLLHLYEMDIAKQG* 2448

>aaaa01008340.1 CYP79A11 (indica cultivar-group) 81-84% to aaaa01007189 (partialI)
11247 MFFPSTANMREQNN
11205 TIIVSIAMTILLLVAFFCRIKKQAAMAAKNKRKKQPKLPPGPATMPVLGNMHQMLMNKPVFRWI 11014
11013 HRLLDEMDIEILCLRLGRVHVITVASPEMAREVLRKNDALMTSRPASFAWRAFSFGYKN 10837
10836 TIGSTGDQWKKMRRALASEILSPAME 10759
10649 IIMERMHEGRALRRNGDERREVADFLDVLVSLEEAQGNPLLSLDEVKAETL (0?) 10497
7815 EIFIATVDNPSNAVEWALAEMVNNPNVMKKAVDELDVVVGKERLVEESDIQNLTYLKAC 7639
7638 IREAFRIHPYHPFNPPHVAISDTIIAGYLIPKDSHVMLSRIGLGRNPRVWVNPLEFRPER 7459
7458 HLNNATSTMVLAEPELRFVSFGASRRGCPAVSLGTSITMMLFARLLQGFTWSIPPGADKI 7279
7278 ELQESASSLQLSKPLLMQAKPRLLLHLYELDRL* 7177

>AC084282a $F CYP81A5 46% to 81D5 CDS join(53081..54004,55290..55904)
MDKAYIAVFSIVILFLLVDYLRRLRGGGTSNGKNKGMRLPPGLP 
AVPIIGHLHLVKKPMHATLSRLAARHGPVFSLRLGSRRAVVVSSPGCARECFTEHDVA
FANRPRFESQLLMSFDGTALAMASYGPHWRNLRRVAAVQLLSARRVGLMSGLIAGEVR
AMVRSLCRRPAAAAPVQLKRRLFELSLSVLMETIAQSKATRPETTDTDTDMSMEAQEY
KQVVEEILERIGTGNLCDYLPALRWFDVFGVRNRILAAVSRRDAFLRRLIYAARWRMD
DGEKKSMIAVLLTLQKTQPEVYTDNMITALCSNLLGAGTETTSTTIEWAMSLLLNHPE
TLKKAQAEIDASVGNSRLITADDVPRITYLQCIVRETLRLYPAAPMLIPHESSADCEV
GGYSVPRGTMLLVNAYAIHRDPAAWEEPERFVPERFEGGGCDGNLSMPFGMGRRRCPG
ETLALHTVGLVLGTLIQCFDWERVDGVEVDMAEGGGLTMPKVVPLEAVCRPRDAMGGV
LREL

>AC084282b $F CYP81A6 46% to 81D5 N-term extension or too long
MDNAYIIAILSVAILFLLHYYLLGRGNGGAARLPPGPPAVPILGHLHLVKKPMHATM
SRLAERYGPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPRFESQLLVSFNGAA
LATASYGAHWRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRMYRAAAASPAGAAR
IQLKRRLFEVSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQVVDEIIPHIGAANL
WDYLPALRWFDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGDEGEKKSMIAVLLT
LQKTEPEVYTDNMITALTANLFGAGTETTSTTSEWAMSLLLNHPDTLKKAQAEIDASV
GNSRLITADDVTRLGYLQCIVRETLRLYPAAPMLLPHESSADCKVGGYNIPRGSMLLI
NAYAIHRDPAVWEEPEKFMPERFEDGGCDGNLLMPFGMGRRRCPGETLALRTVGLVLG
TLIQCFDWERVDGVEVDMTEGGGLTIPKVVPLEAMCRPRDAMGGVLRELV

>AC084282c $F CYP81A7 41% to 81H1 CDS join(65367..66332,67175..67792)
MDKAYIAVFSIAILFLLVDYFRCRRRRGSGSNNGENKGMLQLPP
SPPAIPFFGHLHLIDKPLHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARECFTDN
DVCFANRPQFPSQMPATFYGAGFGFANYGAHWRNLRRIATVHLLSAHRVRGMAGVVSG
EIRPMVQRMYRAAAAAGVGVARVQLKRRLFELSLSVLMEAIAQTKTTRPEADDADTDM
SVEAQEFKNVLDELNPLLGAANLWDYLPALRVFDVLGVKRKIATLANRRDAFVRRLID
AERQRMDNGVDGGDDGEKKSVISVLLSLQKTEPEVYKDIVIVNLCAALFAAGTETTAM
TIEWAMSLLLNHPKILKKAKAEIDASVGNSRLINGDDMPHLSYLQCIINETLRLYPVA
PLLIPHESSADCKVNGYHIPSGTMLLVNVIAIQRDPMVWKEPNEFKPERFENGESEGL
FMIPFGMGRRKCPGETMALQTIGLVLGALIQCFDWDRVDGAEVDMTQGSGLTNPRAVP
LEAMCKPREAMSDVFRELL

>AC084282d $F CYP81A8 40% to 81H1 join(70282..71220,71398..72015)
MVKAYIAIFSIAVLLLIHFLFRRRGRSNGMPLPPSPPAIPFFGH
LHLIDKPFHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARECFTDNDVCFANRPRF
PSQMLATFNGTSLGSANYGPHWRNLRRIATVHLLSSHRVSGMSGIISGQARHMVRRMY
RAATASAAGVARVQLNRRLFELSLSVLMEAIAQSKTTRREAPDADTDMSMEAQELRHV
LDELNPLIGAANLWDYLPALRWFDVFGVKRKIVAAVNRRNAFMRRLIDAERQRMDNND
VDGGDDGEKKSMISVLLTLQKTQPEVYTDTLIMTLCAPLFGAGTETTSTTIEWAMSLL
LNHPEILKKAQAEIDMSVGNSRLISVVDVHRLGYLQCIINETLRMYPAAPLLLPHESS
ADCKVGGYHIPSGAMLLVNVAAIQRDPVIWKEPSEFKPERFENGRFEGLFMIPFGMGR
RRCPGEMLALQTIGLVLGTMIQCFDWGRVDDAMVDMTQSNGLTSLKVIPLEAMCKPRE
AMCDVLRKFM

>AP005285.1a gene 1 $F CYP81L2 43% to 81D2 (one frameshift)
MVDAMSGGVLVALMVLLLVAAPALLSQLERRRRSPSGPVALPVV (1?)
GPRGSPQNREPHPAPLP
98846 AQRPGAPVICRRFGSPPLAVVSSAPAAEECLGPHDLAFADKPRLPSGEILSYEWSTMGTA 98667
98666 RYGPYWRHIRRITVTELLSAHRVQHFAGVNAREVRAMARRLYRRAAAAAAS 98514
98512 RVELKSRLFELFMNIMMAMICDRTFYGDGDDEVSEEARWFRSVVKETMELSGASTAWDF 
      LPAAARWLFARRLTRRMRELSDSRTRFYQRLITDHRTKEKTDDDNAAAGDHSPAPRRRTM 
      IGVLLSLQSKDPDACPDQLIRALCI (0) 98081 
97990 GSLQAGTETSAAVVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCVVMETL 97793
97792 RLYPPVPLLAHESSADCDVAGFHVRKGTMLLVNTFAIHRDPQVWDEPESFFPDR (2) 97631
94075 FADGQNEAKMVIPFGMGRRGCPGENLAMQMVGLTLGTLIQCFDWERVGEELEDMGESSG 93899
93898 ITMPKKLPLEAFYQPRACMVHLLSS* 93821

>aaaa01004834.1a CYP81L3 (indica cultivar-group) ortholog of AP005285.1b gene 2
8825 MAVDAMFGSVAVALLAVVVAAAALR 8751
rwrrrrrrgggrplpgpvalpvvghlhlfrrplhrtlarlaarhgaav
7227 MGLRFGSRRVAVVSSAPAAEECLGPHDLAFANRPRLPSGEILAYEWSTMGTASYGPYWRH 7048
7047 IRRIAVTELLSAHRVQHFADVNVREVRALARRLYRRAAAAAAAGARTRVELKSRLF 6880
6879 ELLMNTMMSMICERTFYGA (2)
     DDDEVSEEARWFRSVV 6700
6699 KETMELSGASTVWDFLPAPARWLDAGRMTRRMRELSDSRTRFLQRLIDDQRKDMDADSDE 6520
6519 HAPAKRRTMIGVLLSLQSKDPDSCPDQLIRSLCI (0) 6418
6331 GSLQAGTDTSAATVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRC 6152
6151 VVMETLRLYPPVPLLAPHESSADCVVAGFHVPQGTMLLVNTFAIHRDPQVWDEPEAFIPDR (2) 5969
5398 FADGKNEGKMVIPFGMGRRRCPGENLGMQMVGLALGTLIQCFDWERVGEELVDMRECS 5225
5224 GLTMPKELPLEALYQPRASMVDLLTKI* 5141

>aaaa01004834.1b $FI CYP81L4 (indica cultivar-group) ortholog of AP005285.1c gene 3
14689 MDALLIALFLLLLIALMETARVRRSGTQRRAGNVPPPPPEPAGLPLVGHLHLFRKPLHRT 14510
14509 LARLAARHGGAVFGLRLGSRRVAVVSSAPAAEECLGAHDVAFADRPRLPSGRILSYDWST 14330
14329 MGTASYGPYWRHVRRVAVTEILSARRVQHFADVHVREARAMARHLHRAAVRHGVGGAARV 14150
14149 RVELKSRLFELLMNTMMAMICDKTYYGD (2) 14066
13973 DDDGEVSKEARWFREMVEETMALSGASTVWNFLPAALRWVDVGGVGRRLWRLRESRTRFL 13794
13793 QGLINDERKEMEQEQGGDRAQPAARRRTMIGVLLSVQRQDPDACPDQLIRSLCI (0) 13632
12083 SSLEAGTDTSADTIEWAMSLLLNNPNVMRKARDEIDAFIGQPVRLLEASDLTKLQYLQCII 11901
11900 METLRLYPPAPLLVPHEASTDCSIAGFHITRGTMLLVNTFAIHRDPQVWNEPTSFIPER (2) 11721
      FENGRSEGKMAIPFGMGRRKCPAENLGMQMVGLAL 11541
11540 GTMIQCFEWERVGEELVDMTEGSGLTMPKEVPLQAFYQPRASLMHLLY 11397

>AP005285.1e gene 4 CYP81L5/6 combined   one frameshift, runs off end of clone missing 
142199 MDTSTLLIALTLVLLLLLLTARRRRSGRLRLRLPPEPPGLPLVGHLHLFRKPLHRTLAR 142375
142376 LAARHGAVFRLRLGSRRVAVVVSSAPAAEECLGAHDVAFAGRPRLPSAGILSYGWSTMG 142552
142553 TAAYGPYWRHVRRVAVAEILSAHRVRQFAGAHAREARATARRLCRAASRQRHGAGAAAGR 142732
142733 VRVELKSRLFELLMNTMMAMICDKTYYGA (2) 142816
142893 DDDGEVSEEARWFREMVEETMALSGASTVWDFLPAALRWVDVGGVGRRLWRLRESR 143060
143061 TRFLQGLIDDQRKEMEHDGDGRELPAAAARPRSMIGVLLSVQR 143189 
143191 QDPEECPDQLISSLCI (0) 143238 
27539 AGTGTSTDTIEWAMSLLLNNPDVMRKARDEIDAFIGQPVRLLEADDLPKLQYLRCIIM 27712
27713 ETLRLYPPAPLLVPHESSSDCTVAGFHIPRGTMLLVNTFDIHRDPHIWDEPTSFIPER (2) 27886
27979 FEDGRSEGKMAIPFGMGRRKCPAENLGMQMVGLGLGTMIQCFEWERVGEELVDMTEGSG 28155
28156 LTMPKKVPLEAFYQPRASVMHLLS* 28230

>AL606630.1 $F CYP81M1 chromosome 4 clone OSJNBb0046P18 45% to 81D3
70830 MANTTLSSLLFLSMASALFLLTLLRILRSKKQQR 70931 frameshift 
70931 PPPPPAEPAVPPRHRGHLHLFKKPLHRALSGLAATHGPVLLLHFGSRAVLHVTDPAVAE 71107
71108 ECLTDHDVTFANRPRLPSSCHLSNGYTTLGSSSYGPNWRNLRRIATVEVFSAHRLLRSAD 71287
71288 VRGGEVPHMARWLYLAAPAAGPSEPARADVKARAFELVLNVVARMVAGKQYYGGEGDAEA 71467
71468 ETEEAARFREMVREYFAMHGASNLQDFVLLLGLVDIGGAKRRAVKLSRERNTWAQRLID 71644
71645 EHRATATAAAATEARTMVGDLLKMQASEPEAYSDKVITALCL 71770 (0)
73597 SILQTGTDTSSSTIEWGMALLLNHPAAMAKARAEIDRFVGTGRVVEEADLPNLPYL 73764
73765 QCIIRENLRLYPVGPLLAPHESSADCSVSVAGGGRYAVPAGTMLLVNVHAMHRDARFWGP 73944
73945 DPESFSPERFEGGRSEGKWMLPFGMGRRRCPGEGLAVKVVGLALATLVQCFEWRRV 74112
74113 GDEEVDMTEGSGLTMPKAVPLEALYWPRPEMVPALSGIFFIYNFFY* 74253

>AL772426.1a = CYP81N1 ortholog of AAAA01017554.1 $FI 99%
69722 MTGGLEVAMVAGGGNGGAAVLVGITVLLFVVVVVVVVLVRWWSG
69590 GEGGAAPSPPALPVLGHLHLLKKPLHRSLAAVAAGVGAPVVSLRLGARRALVVSTHA 69420
69419 AAEECFTACDAALAGRPRTLAGEILGYDHTIVLWTPHGDHWRALRRFLAVELLSAPRLAA 69240
69239 LAADRHAEAASLVDAILRDAAGGAKVTLRPRLFELVLNVMLRAATTRRRHASVDA 69075
69074 RKLQEIIEETFSVNGTPSVGDFFPALRWVDRLRGKVGSLKKLQARRDAMVTGLIDD 68907
68906 HRQWRSGSAGDGDQDKEKKGVIDALLALQETDPDHYTDNVVKGIIL 68769 (0?)
68310 SLLFAGTDTSALTIEWAMAQLVTHPETMKKARAEIDANVGTARLVEEADMANLPYIQCVI 68131
68130 KETLRLRTAGPVIPAHEAMEDTTVGGFRVARGTKVLVNAWAIHRDGDVWDAPEEFRPERF 67951
67950 VDSDAGGAVTAPMMPFGLGRRRCPGEGLAVRVVGVSVAALVQCFDWEVGDDDVVDMTE 67777
67776 GGGLTMPMATPLAAVCRPREFVKTILSTS* 67687

>AL772426.1b $F CYP81N2 = ortholog of aaaa01010047.1dca hybrid 99% 
95445 MAGLEVATTAVTGGDASLVVVVGVLFLMVAVVVMTRLGDGGAAPSPPAMPVLGHLHLIKKPL 95260
95259 HRSLAEVAARVGAAPVVSLRLGARRALLVSTHAAAEECFTACDAAVAGRPRLLAGDVLG 95083
95082 YGHTTVVWASHGDHWRALRRLLGVELFSNARLAALAADRRAEVASLVDAVLRDAAAGGGG 94903
94902 GGTVTLRPRLFELVLNVMLRAVTARRHAGDETRRFQEIVEETFAASGSPTVGDFFPALR 94726
94725 WVDRLRGVVATLQSLQKRRDAFVAGLVDDHRRTRRAAAAAADKDQKKNGIIDALLT 94558
94557 LQETDPDHYTDNVVKGIVLVLLTAGTDTSALTTEWAMAQLVAHPEAMTKVRAEIDANVG 94381
94380 AARLVEEADMASLPYLQCVVKETLRLRPVGPVIPAHEAMEDCKVGGYHVRRGTMILVNAW 94201
94200 AIHRDGDVWGSPEEFRPERFMDDGAGAGAVTAVTAPMLPFGLGRRRCPGEGLAVRLVGLT 94021
94020 VAALVQCFDWEIGEGGAVDMAEGGGLTMPMATPLAAVCRPREFVKTVVSDCF* 93862

>AL772426.1 CYP81N3P P450 fragment
63156 PSQPVLGHLHLLKRPPLHRSX 63097
63092 AAAARAPLVSLRLGRAAGAARVDARRGAGERFTACDAAMAGRPPAARR 62949

>AL772426.1c = CYP81P1 ortholog of AAAA01002713.1 and aaaa01010047.1b 99% to these two
AF140486 mRNA 57% to C97610 57% to CYP81G1 56% to 81D2 = AU173235 clone R1815
99775 MEISQAFVFASLLLLLLLTWLLFHLLSYQAPPPNGDGGRRIPSPPALPVVGHLHLLKKPL 99596
99595 HRSLAALAARYGGGAGLLLLRFGARPVVLVSSQAAADECFTAHDAALAGRPGLASRRLLT 99416
99415 DGCPTIATAGHSARWRHLRRLATVHALCARRLAATS 99308 (fs)
99308 PARDAEARAMAARLYSSSSSSSAASAVVVGVKPAAYGFVASVIMSMVAGERMAEEDVLRF 99129
99128 KAITEAGLAAAGAANRQDFLPFLRLLDFGRARRRLAGIAKERHDFGQRIVDEYRRRHRRR 98949
98948 LAVAADDFSSSPPRRTVIGDLLRQQESSPESYADEVIRTVCL 98823 (0?)
98238 SLLQAGTDTSASTIEWAMALLLNNPDVLRKATDEINSVVGMSRLLQEPDLANLPYLRCII 98059
98058 TETLRLYPLAPHLVPHEASRDCMVAGHVIARGTMVLVDVYSMQRDPRVWEDPDKFIPERF 97879
97878 KGFKVDGSGWMMPFGMGRRKCPGEGLALRTVGMALGVMIQCFQWERVGKKKVDMSEGSGL 97699
97698 TMPMAVPLMAMCLPRVEMESVLKSL* 97621

>AC073867.4b $F CYP84A5 chromosome 10 clone OSJNBa0055O03, 1 ordered pieces 63% to 
68246 MADMVKFTMEWLQDP 
68196 LSLAIVVTVAVLIMRMQRRRAAPFPPGPKPLPIVGNMAMMDQLTHRGLAALAKEYGGLM 68020
68019 HLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATTAIAYLTYDRADMAFAHYGPFWRQM 67840
67839 RKLCVVKLFSRRRAETWLAVRDESAALVRAVAASRGEAAVNLGELIFNLTKNVIFRAA 67666
67665 FGTRDGEGHDEFIAILQEFSKLFGAFNIGDFIPWLSWADTNGINARLVAARTALD 67501
67500 RFIDKIIDEHMERGKNPDDADADMVDDMLAFLAEAKPHAGKAAAAAAGAGDGADDLQNTL 67321
67320 RLTRDNIKAIIM 67285
62628 DVMFGGTETVASAIEWAMAEMMHSPDDLRRVQEELAAVVGLGRDVAESDLDKLPFLRC 62455
62454 VIKETLRLHPPIPILLHETAADCLVAGYSVPRGSRVMVNVWAIARDRAAWGPDADAFRP 62278
62277 SRFAAGAAAEGLDFRGGCFEFLPFGSGRRSCPGMALGLYALELAVARLAHGFNWSLPDGM 62098
62097 KPSELDMSDIFGLTAPRATRLSAVATPRLTCPLY* 61993

>AC121490.1 $F CYP84A6 (japonica cultivar-group) chromosome 3 clone
AQ577123 nbxb0090O10r 57% to CYP84 C-term
92194 MDPWLVLWLVLASMAFALLHLRRRARRGAPPLPPGPRPLPIIGNMLMMDQLTHRGLAAMA 92015
92014 ARYGGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRPASIAIAYLTYGRADMAFSHY 91835
91834 GHFWRQVRKLSAVRLFSRRRAQSWRAVRDESAKLVGAIARRAGEAVDLGELIFGLTKDVI 91655
91654 FRAAFGTRDGGGHGELEVLLQEFSKLFGAFNVGDFIPWLAWLDPHGINRRLRAARAALDS 91475
91474 VIDRIIDEHVSNPAGDEDADMVDDMLAFLDEAGRDQTGGGGELQGTLRLTRDNIKAIIM (0)
      DFVFGGTE
      TVASAIEWAMAELLHSPGDLRRLQAELADVVGLGRGVEEGDLEKLPFLRCVAMETLRLHP
      PIPLLLHEAAADCVVGGYSVPRGARVVVNVWSVGRDAGAWKGDAGAFRPARFMAGGEAAG
      MDLRGGCFELLPFGSGRRACPAIVLGMYELELVVARLV 90725
90724 HAFGWAPPGGVAPEELDMADGFGLTAPRAARLRAVPTPRLTCPM* 90590

>aaaa01015479.1 $FI CYP84A7 (indica cultivar-group) ortholog of AQ160861
4482 MEYYSQDAYFVTASLISIAFFLWYASRLRRTAILLPPGPPGLPVLGNLLSVHQFTHRGLA 4661
4662 KLSKIHGGFFHLRVGQVNVFVVSSPETVREIIHENDSVFSHRPVTAAMVYVSYDLADMAF 4841
4842 AHYGPFWRQMRKLCVLKLFSPRRDVSWRVVRGEVDALVRSVAELRRVAGSVGDLVFKFAT 5021
5022 NVTFRAAFGAQSREDEKVFVDIILELSEIFMAFNMGDYIPCLGWLDLNGIGKRMAAARHA 5201
5202 LDVFIDRIIDEHLAKLRNGDVSASDMVDDMIAYLVDAPGGRHKRADGVELGDLHLTRDNI 5381
5382 KGLIMARN (0)
     DIMFGGTKTVASTVEWALSELLRNPDEL 5561
5562 RRAQDELAGVVGLRRRVNQDDLDNLPHLRCVTKEVLRLHPPLPLLLRESLHDCAIG (1?) 5738
5731 GYTVPRGSRIWINNWAMCRDEVLWGTDAAAFRPSRFADESARVEFKGGDFQYLPFGSGRR 5910
5911 SCPGMQLGMFAVELGLAELLHCFDWSLPAGTEPLELDMDDVFGLTAPKAERLCAVPSPRL 6090
6091 SCPLL* 6108

>AL606587.1 $P CYP84A8P chromosome 4 clone OSJNBa0011L07, 
29446 MESWWLPTWQPLLVLLPTMLLLYHTVSSWHCGE
29347 RCLPLPPGPRGLPFVGNILHTSDMTHRGLAQLASRYGGLLHLRLGRLRTVVVSTPEMARL 29168
29167 VLHVNDRAFADRPTTAAIDYLTYDRADMVFAPYGP 29063 
28858 YGPLWRQLRKLCINRLFNRRRAASWAAVHDGVDSLLREVTKNSG-AVVNVGELVFGMSMK 28682
28681 ITLR 28670 
28642 PGMQLGMLAVELALARLLHGFDWSLPGGTGSAGELDMEETYGLTAPRAVRLSAVPVPRLSHL* 28454

>AC092778.2 $F CYP85A1 chromosome 3 clone OSJNBa0015G17, 59% to 85A2
105850 MVLVAIGVVVAAAVVVSSLLLRWNEVRYSRKRGLPPGTMGWPLFGETTEFLKQGPSFMKARRL (?) 106038
       RYGSVFRTHILGCPTVVCMEAELNRRALASEGRGFVPGYPQS 106945
106946 MLDILGRNNIAAVQGPLHRAMRGAMLSLVRPAMIRSSLLPKIDAFMRSHLAAWSSSSSSA 107125
107126 VVDIQAKTKE (0)
       MALLSALRQIAGVSAGPLSDALKAELYTLVLGTISLPI 108109
108110 NLPGTNYYQGFK (0) 108145 
       ARKKLVAMLEQMIAERRSSGQVHDDMLDALLTGVEGTREKLTDEQIIDLIITLIYSGYETMSTTSMM
       AVKYLSDHPKALEQLR (0)
       KEHFDIRKGKAPEDAIDWNDFKSMTFTRA (0)
       VIFETLRLATVVNGLLRKTTQDVEMN (1?)
       GYVIPKGWRIYGYTREINYDPFLYPDPMTFNPWRWL (?)
       EKNMESHPHFMLFGGGSRMCPGKEVGTVEIATFLHYFVTQY (?)
       RWEEEGNNTILKFPRVEAPNGLHIRVQDY* 

>AP003442.1 $F CYP86A9 chromosome 1 clone B1096A10 72% to 86A1
49790 MAAAAVALASAYMVWFWALSRRLSGPRMWPLVGSLPSVVLNRARVHDWIADNLRATGDAATYQTCILPLPFLARRQGLV 
50026
50027 TVTCNPRNLEHILRARFDNYPKGPMWQASFHDLLGQGIFNSDGETWLIQRKTAALEFTTR 50206
50207 TLRQAMARWANRSIKYRLWRILDDHCNAAASVDLQDLLLRLTFDNICGLTFGKDPETLSP 50386
50387 GLPENPFANAFDEATEATMQRFLFPSLLWRIKKAFGVGSERSLRDSLAVVDRHMTETIAA 50566
50567 RKATPSDDLLSRFMKKRDSKGKAFPEDVLQWIALNFVLAGRDTSSVALSWFF 50722
50723 WTLMQRRDVERKVVLEIASVLRETRGDDTARWTEEPLNFDELERLVYLKAALTETLR 50893
50894 LYPSVPQDSKYVVADDVLPDGTVVPAGSAITYSIYSVGRMESIWGKDCAEFRPERWLSAD 51073
51074 GSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRNSVELVPGHKVEQKM 51247
51248 SLTLFMKNGLRVHVKPRDIASYVEPSEPAPPQGSLVIPTTTAAAA* 51385

>AP004139.1 $F CYP86A10 chromosome 2 clone OJ1486_E07 70% to 86A2
55281 MEVGTWAVVVAVAAAYMTWFWRMSRGLS
55335 GPRVWPVVGSLPGLVQHAENMHEWIAANLRRAGGTYQTCIFAVPGVARRGGLVTVTCDP 55511
55512 RNLEHVLKSRFDNYPKGPFWHAVFRDLLGDGIFNSDGETWVAQRKTAALEFTTRTLRTAM 55691
55692 SRWVSRSIHHRLLPILDDAAAGKAHVDLQDLLLRLTFDNICGLAFGKDPETLAKGLPENA 55871
55872 FASAFDRATEATLNRFIFPEYLWRCKKWLGLGMETTLASSVAHVDQYLAAVIKARKLELA 56051
56052 GNGKCDTVAMHDDLLSRFMRKGSYSDESLQHVALNFILAGRDTSSVALSWFFWLV 56216
56217 STHPAVERKVVHELCAVLAASRGAHDPALWLAAPFTFEELDSLVYLKAALSETLRLYP 56390
56391 SVPEDSKHVVADDYLPDGTFVPAGSSVTYSIYSAGRMKTVWGEDCLEFRPERWLSADGSK 56570
56571 FEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSLTL 56744
56745 FMKNGLRMEVRPRDLAPVADELRGADVRATAPCA* 56849 

>AL606687.1 $F CYP86A11 chromosome 4 clone OSJNBa0084K11 similar to AP004139
94178 MEAGTWAVVVAAVAAYMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMH
      EWIAANLRRTRGTYQTCIFAVPGLARRGGLVTVTCDPR 94441
94442 NLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNSDGETWVAQRKTAALEFTTRTLRTA 94615
94616 MSRWVSRSIHSRLLPILSDAAAAGGGGGGATVDLQDLLLRLTFDNICGLAFGKDPETLAR 94795
94796 GLPENDFASAFDRATEATLNRFIFPECVWRFKKWMGLGMETTLARSVQHVDRYLSAVIKA 94975
94976 RKLELAAGNGKGDASSATPHDDLLSRFMRKGTYSDESLQHVALNFILAGRDTSSVA 95143
95144 LSWFFWLVSTHPAVERKIVRELCTVLAASRGADDPALWLAAPLNFEELDQLVYLKAALSE 95323
95324 TLRLYPSVPEDSKHVVADDVLPDGTFVPAGSSVTYSIYSAGRMKTVWGDDCLEFRPERWL 95503
95504 SADGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVL 
      LRHRLAVAPGHRVEQKMSLTLFMKHGLRMEVRPRDLAPIVDELRGAGEYAAAARATAACA* 95815

>AL606448.1 $P CYP86A12P two short pseudogene fragments = D15209 6 diffs with 
135204 AFGDLLGNGIFNSDGETWVAQRKTLA 135278
135631 STSIKARKLELAAESGKGDASS 135696

>AP003230.1 $P CYP86A13P pseudogene fragment at C-helix 2 diffs with AP004139.1
65348 PFWHTVFRDLLGDGIFNSDGETWVA*RNTAALEFTT 65241

>aaaa01018882.1 CYP86A14P (indica cultivar-group) 91% to AP004139.1 $F
4729 PFWHAVFRDLLGDGIFNSEGETWVTQRKTTALEFTTMAAAAAVA 4598

>AP005389.1 CYP86A15P (japonica cultivar-group) chr 8 C-helix region
79974 PFWHAVFRDLLGDNIFNSDGETWVAQWKMAALEFTTTATAAAAAGVDRTL 80123

>aaaa01098941.1 CYP86A16P (indica cultivar-group) 
3   VRLYPSLPYNVKNAVEDDHLPDGTFVPAGTDVVYSPWFMGRSESFWGKNALEFRPERWL 179
RVCACGMNMAILEAKIFTAVMLRHFHVKIIDGEPQDRGYVL
KSGLFMAGGLPLAMTPRARISS*

>aaaa01024304.1 CYP86A17P (indica cultivar-group) ortholog of AP003242.1 1 diff
2219 ISYSIFSTGVLQITM*QGEILLHFWPSWL*LVDGKRPFGPMDGHLLLAYN 2070

>AC087182.8 $F CYP86B3 chromosome 10 clone OSJNBa0029C15, 66% to 86B1 
53685 MDAVMPGAAGAHNATAAAAAGRRGGGIVAGMMALPEVQTVELLVAVSIFVAIHSLRQRRSQGLPSW 53882
53883 PLVGMLPSLLLGLRGDMYEWLTGVLASRGGTFTFHGPWLTNLHCVVTSDPRNLEHMLKTK 54062
54063 FGSFPKGPYFRDTVRDLLGDGIFGADDEVWRRQRKAASLEFHSAEFRALTASSLVELVHR 54242
54243 RLLRVLGDAEEAGDAVDLQDVLLRLTFDNVCMIAFGVDPGCLRPGLPEIPFAKAFEDATE 54422
54423 ATIVRFVTPTAVWRAMRALGVGHERVLQRSLAGVDRFAYDVIRQRKEEVAAGGGGGGGGR 54602
54603 SDLLTIFTKMRDADTGAAAYSDKFLRDICVNFILAGRDTSSVALAWFFWLLNKNPAVEAK 54782
54783 ILEEIDDIVAARRSSPPAPAVAANGADEDDLVFHPEEVKKMEYLHAALSEALRLYPSVPVDHKE 54974 (0)
56977 VVEDEVFPDGTVLKKGTKVIYAMYTMGRMESIWGEDCREYKPERWLRDGRFMGESAYKF 57153
57154 TAFNGGPRLCLGKDFAYYQMKFAAASILRRYHVRVVDGHPVAPKMALTMYMKHGLKVK 57327
57328 LTKRDKSKL* 57357

>AP004092.1 $F CYP86E1 chromosome 2 clone OJ1568_B05, similar to 86C3
84356 MAIASMAAAAAAAIVGAVREHVRASDLAVAGAVL
84458 FAFSAAVSAVRARRRGAPVLWPLVGIVPTLFVHRDDIYEWGSAALLRAGGVFPYRGTWG 84634
84635 GGSSGVITSAPANVEHVLRANFGNYPKGPYYRERFVELLGGGIFNADGEAWRAQRRAATA 84814
84815 EMHSSRFVEFSVRSIEQLVYGRLVPLAERLSGGGAAVDLQEVLLRFTFDNICAVAFGVDA 84994
84995 GCLADGLPDVPFARAFELATELSLLRFVTPPFIWKAKRLLRAGSERRLVEATRAVREFAE 85174
85175 RAVADRRNEMRKVGSLRGRCDLLSRLMSSAPGADYSNEFLRDFCISFILAGRDTSSVG 85348
85349 LAWFFWLLAGHPDVESRVVGDVLAAGGDIKRMDYLHAAL 85465
85466 TEAMRLYPPVPVDFKEALADDVLPDGTPVRARQRVIYYTYAIGRDPASWGDDAAAFRPER 85645
85646 WMRGGAFAGGESPFKYAVFNAGPRLCIGKRFAYTQMKTAAAAVLSRFAVEVVPGQEVK 85819
85820 PKLTTTLYMKNGLMVRFRRRSPPPPSPPPRHVVADDDDDDDVAAGRHVAVGSCNSNHL* 85996

>AL607001.1a $F CYP87A4 chromosome 4 clone OSJNBA0088I22, gene 1 92976-97891
92976 MYAYVGLVGGAAALVLLLLLRHQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLAR  93188 
(2)
93267 YGPIFKTSLVGHPVVVSADEELNHMVFQQEGQLFQSW 93377
93378 YPDSFVEILGKDNVGEQQGAMFRYLKNMVLRYFGPESLKEGIIRDVERAVSSSLCTWSTL 93557
93558 PAVELKEAVST 93590 (0)
93686 MVFDLAASKLLGLEPSRSKILRKSFFDFVRGLISFPLYLPGTAYYSCMQ 93832 (0)
93922 GRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF 94098
94099 VLLFASFHTTSLALTLAVKLLADHPLVLEELT 94194 (0)
      VEHETILKDREAGSELDRITWKEYKSMAFTSQ
94575 VINETVRLANIAPVIFRKALKDIRFN 94652 (1)
97033 GYTIPAGWGVMVCPPAVHLNPYIYPDPLTFIPSRFK 97140 (0)
97486 DKPEINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYR 97617 (2)
97802 WIPLGASRVVRTPGLEFPDGYRIKVIQRH* 97891

>CYP87A5 Combined parts from #291, #292, #293, #363 81% to AL607001.1c
6830 METLVCVAVWAVAMAMVVASVMWAYRWSHPRANGRLPPGSLGLPLLGETLQFFAPNTTCDISPFVKERLN 7018
7111 RYGSIFKTSVVGRPVVVTADPELNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFMY 7290
7291 KYLKSLVLRLYGQENLRAVLLDETDRACRASLASWAAQPSVELKDSISA 7437
8400 MIFDLTAKKLISYEPSKSSENLRKNFVAFIRGLISFPVDIPGTAYHECMK 8251
8    GRRNAMKVLKKMMRER 73
78  EEPGRQCEDFFDVLIEELGREKPV
    LTEGIALDLMFVLLFASFETTSLALTLGVRLLAENPTVLDALT 278
374 EEHEAIVRGRKEGCDAAGLTWAEYKSMTFTSQ 469
1092 VTLEMVRLANIVPGIFRKALQDIEFKG1187
1285 YTIPAGWGVMVCPPAVHLNPEIYEDPLAFNPWRWQ 1389
2411 DKVEITGGSKHFMAFGGGLRFCVGTDLSKVLIATFIHHLVTKY
     RWKTVKGGNIVRTPGLSFPDGFHVQFFPKN* 2746

>AL607001.1c $F CYP87A6 chromosome 4 clone OSJNBA0088I22, gene 3 136970-140694 61% to 87A2
136970 MAYIALLCAALAAVVALLRWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKR 137173 
(2?)
137287 YGSIFKTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFM 137460
137461 YKYLKTLVLRLYGQENLKSVLLAETDAACRGSLASWASQPSVELKEGIST (0) 
       MIFDLTAKKLIGYDPSKPSQVNLRKNFGAFICG 137820
137821 LISFPLNIPGTAYHECME 137874 (0)
138176 GRKNAMKVLRGMMKERMAEPERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFASF 138352
138353 ETTALALTIGVKLLTENPKVVDALX 138424 (0)
138574 EEHEAIIRNRKDPNSGVTWAEYKSMTFTSQ (0)
139123 IMEIVRLANIVPGIFRKALQDVEIK 139197 (1?)
139305 XYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQ 139421 (0)
140396 XXEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYR 140518 (2)
140605 WRTVKGGNIVRTPGLSFPDGFHIQLFPKN* 140694

>aaaa01004251.1 $FI CYP87B1 (indica cultivar-group) ortholog of AQ157412 contig
2320 MEKSEIFVGAHSYAALCAFTLIIGWLAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFR 2499
2500 TSPSIDMPIYYKRRLER (2) 2550
2709 YGPIFKTNIGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAH 2885
2886 KLIRSFVCKLYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSN (0) 3032
3130 MIFGLAAKHLIGLDITNSGELKKNFQEIFQVMVSIPFPIYFPGTSFYRCMQ (0) 3282
3407 GRRNVWTTLTNVMKKRLSAPGNKFGDLVDLIVEELRSENPTI
     DESFAIDTLSGLLFASFAPLSCTLTTTFKFLNDNPEVFDKLK (0) 3658
3778 EEHEMILKKREGANSGFTWEEYKSLKFSTQ (0) 3867
3965 VVNEINRITTVIPGGFRKALTDVEVN (1)
4133 GYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWT (0)
4343 EEKRISMQRNFMPFGGGIRMCPAVEFNKLFITLFLHIVVTEYR 4471 (2)
4752 WKDIDGGNVKRISEVLVAQEYHIQLVPQT* 4841

>AK067592 cDNA = CYP87B2 (japonica cultivar-group) 75% to 87B4 
19 MEFLSSVSYLFKALCTCGVAFVTGWFAHWVYRWMNPQCDGKLPPGSMGLPLVGETFRF 192
 193 FRASASIDMPSYYKERLK
 247 RYGPIFKTSLVGQPLVISLDPEVNRFVFQQEGKLFRSWYPETTNTIFGKKSLTTYSGAVN 426
 427 KFVRSFASKLFGPTNLKESLLPELESAVRESFATWVMNPSIEVKDGISNMIFDLVAKKLI 606
 607 GFNPTKSRELRKNFQEFFQGMVSFPIYFPGTSFYRCMQ (0) 
     GRRNVHKTLTDLLKERLSAPGEKYNDLIDQ 966
 967 IIEELQSENPVIDVNFAVDVLSALLFASFATLSSTLSVGFKFLTDNPKVVKELK (0) 1128
     EEHTTILNKRGSLNSGFTWEEYKSLMFTSQVVHEITRISNVAPGIFRKTLADVK 1813
1814 VKGYTIPAGWLVMISPMAVDLNPTLFEDPLEFNPWRWTDKTKQSELLRNYMPFGGGIRLC 1993
1994 LGAEFSKLFIALFIHVLVTEYRWKEIKGGDVLRISEVIFPQGYHIQLIPHT* 2149

>aaaa01007725.1 CYP87B3 (indica cultivar-group) 74% to AL607001.1b chr 4, 
5527 MEIMETLLGSYSYLLVIYGVTLVIGWFLLHGVYRWMNPQCNGRLPPGSMGFPLVGET
     FQFFKQSPSIDMPGYYKQRMKR (2) 5291
2969 RYGPVFKTSLVGQPIVVSLDPEVNRFIFEQEGKLFRSWYPNTTNTIFGKKSVTVYTDT 2789
2788 VHKFIRSFASKLFGPNNMKELLLPELESSMRESFMTWAKEPSIDVKESISN (0) 2636
2247 MIFDLIAKKMISLDRTKSRQLRKNFDEFFQGMVSFPIYFPGTQFYRCMQ (0) 2101
1923 GRRNVQKTLTDILKERLSAPENRHNDLVDQIVQELQNDNPVIDVNFAVDAIAALLFASFA 1744
1743 TLSSTLAVGFKFLTDNPKVIEELK (0) 1672
1336 EEHKKILKKRDDMNSGFTWEEYKSLVFTPQ (0) 1247
1147 VMNEITRISNVAPGIFRKTLVDVQVN (1) 1076
 733 GYTIPAGWLVMISPMAVHLNPKLFEDPLEFNPWRWM (0) 626
 500 DETKRAELLRNHMPFGGX 450 
 447 IRLCLGADFSKIFIALFLHILVTEYR (2) 370
 279 WKEIEGGEVLRIAEAIFPKGYHIQLIPQT* 190

>AL607001.1b $F CYP87B4 chromosome 4 clone OSJNBA0088I22, gene 2 105584-109445 
105584 MEKSELLLGSYSYAALCGVTLIIGWLAHWVYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYKQRLER 
(2?) 105814
105556 YGPLFKTSLVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKFIRGVAAK 106159
106160 LFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSD 106279 (0)
106493 MIFDLVAKKLIGLDVTNSRELRKNFQDFFQGMVSFPIYFPGTSFYRSMQ (0)
       GRRNVRNTLTDIMKERLSAPGKKYGDLVDLIVEELQSEKPM 108258
108259 IDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELK (0)
       EEHGTILKKREGVNSGFTWEEYRSLKFSTQ (0)
       VMNEITRISNVTPGVFRKTLTDVQVK 108747 (1?)
108863 GYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRWR (0)
       EEKRSSMLKNYMPFGGGVRLCLGAEFSKLFIALFLHILVTEYR 109231 (2)
109356 WTEIEGGEVLRISEIMFPQGYHIQLVPQT* 109445

>AP005479.2 $F CYP87B5 (japonica cultivar-group) chr 7 now AP005479.3
7862 MEKDILLGH 
7894 HSYAALCVVTLIIGWLTHWVYKWMNPPCNGKLPPGSMGFPVVGETFQFFRASPSVDMPSYYKQRLER (2) 8088
8276 YGPLFKTSLVGQPLVVSLDPEVNRFIFQQEGKLFRSWYPETANNIFGKKSLTTYNGTVH 8452
8453 KFIRSFASKLFGL 8491 
8491 ENLKESLLPELENSMRESFASWASKPRIEVQDGVSD (0) 8598
8775 MIFDLVAKKLIGLNVTQSRELRKNFQEFFQGMVSFPIYFPGTSFYRCMQ (0)
     GRKNVRNTLTDVMKERLS 9134
9135 APEKKYGDLVDLIVEELQSEKPVIDENFAIDALAALLFTSFATLSSTLTVALKFLNDNPK 9314
9315 IVEELK (0)
9730 EEHDVILKKREVMNSGFTWEEYKSLKFTTQ (0) 9816
     VTNEITRISNVAPGVFRKTLTDVQVN (1)
10102 GYTIPSGWLVMISPMAVHLNPELFEDPLKFDPWRWT (0)
10346 EEKRSSVVRNYMPFGGGIRLCLGADFSKLFIALFLHILVTEYR (2) 10474
10596 WKEIEGGEVLRISEIMFPQGYHIQLIPRT* 10685

>aaaa01012486.1 CYP87C1P (indica cultivar-group) 75% to D48181
2586 MQDLPSNKTWVVSSSSSIQLPSMEDSPVAVAIPWFALAA
     ATAVLAGAAWLIIRACKADESCC
2772 RLPPGSRGLPLLGESLEFFARSPSLELLPFLKQRLE 2882
5045 RYGPIFRTNIIAQDMIVSLDPELNNLVFQQEERLFQCWYPNSFMRVFGADSIITTFGSSH 5224
5225 RHVRNLVLRLFGPENLRRAMLQEMQKTAQASLLSWLDRPSIEVKEEVSS
     MIIFSIIAKKLISYDSSASNG 5584
5585 KLWKQFDAFLQGLLA 5629 
5743 GRKNVMRMLRELLDERKKKTAHQLESIDFFDALIDELKQEKPAVSENVALDLLFLLLF 5916
5917 ASFETTSSGITAILRFLTDNPMALEELT 6000
6226 EEHDRILKRKADPNSQITWEEYKSMKFT 6315
7158 YTIPKGSKIMLSPSNIHLNPTVYKDPNEFNPWRWK (0) 7262

>aaaa01003340.1 $FI CYP87C2 (indica cultivar-group) ortholog of D48181 (less the 
 4887 MAVLASWLIRLVSLKWNSSHPCKADEGSRLPPGSRGLPLLGESLEFFTSSTSLELPVFFKRRLNR 5081 (2)
11460 YGPVFRTNMVGQDLIVCLDPEVNSFVFQQEERLFQCWYPDSFMRIIGADNIITTLGSSHK
11640 YIRNLILRLFGPENLRRAMLQDVHRTAQASLLSWLDRPSIELKDAVSS (0) 11783
11923 MIFSVTAKKLISYDSLASDGKMWKQFDAFIRGLLAFPIGIPGTAFYKCMQ (0) 12072
12416 GRKNIMKMLKELIDERKEASGRRG 12487
12488 SIDFIDVLLEELNEEKPLISENVALDLIFLLLFASFETTASAITAVVRFLTDNPEALQELA (0) 12670
12847 EEHDNIQKRRVDLNSEITWEEYKSMKFTSH (0) 12936
13023 VIHEALRLANIAPVMFRKATEDVHIK (1) 13100
13238 GFFIPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWK 13345 (0)
13765 DTAEPTGGASKDFMAFGGGLRLCVGADFAKLQTAIFLHCLVTKYR 13899 (2)
14151 WKAIKGGTMVLGPGLRFPEGFHIQLFPKP* 14240

>AC090482.3 $F CYP87C3 45% to 87A2 in the CYP85 clan 2 diffs with AQ868994
       MAVLATACWLVFVKRNTSRPSG 
135052 RLPPGSRGFPIIGETLEFLTESPANQLPAFFKRRLDR 134942 
116833 RYGPIFKTNMIMEDLIVSLDPEVSNFVLQQEEKLFQIWCPGSFMRITGAESIITTHALLHR 116651
116650 HIRNLVLRIFGPGNLRQEIIQEMHKTAEASLSSWLNHPSIELKEAISS 116519 (0?)
113034 MIFSVTAKKLISYDSSTSDGKMWKHYDAFAQGLITLPLCIPGTAFYKCMQ 112876 (0?)
98384  GRKNVMKMLKEILNERKKIEGRHESIDFLDVLIEEVKEDNPSMTENTALNLLFSL 98211
98210  LFGSFDTTSSGITGMLKFLTDNPEALRELT (0?)
97814  EHNNIRRRRADLNSEITWEEYKSMKFTSH 97704 
97599  VIHEALRLASITPMMFREAIEDVHIK 97519 (1)
96537  GFAIPKESKIMICPSTVHLNPVVYEDPI 96457 
       TFNPLRWK (0)
95926  DIAEPAGGASKDFMPFGGGLRLCVGAHFAKLQMAVFVHCL 95831
95446  LSTLVSWKAIKGGRMVLSPGLRFLEGFHIQLFPKD* 95339

>AC083944.6 $F CYP87C4 clone OSJNBa0047G15 three bad AG boundaries 47% to 87A2
40470 MAVLATACWLVIRLVFVKGNTDRRPCEADGMRMVPGSRGLPIIGETLEFLALSPS 40634
40635 LQIPAFFQRRFD 40670 (2) 
43217 YGPLFKTNMIMEDLIVSLDPEVTNFVFQQEERLFQMWYPDSFIRIIGTDSLIRTHGLLHR 43396
43397 HIKNLALRLFGPENLRREIIHDVQKTVEASLSSWLNQPSIELKEAVSS 43540 (0)
44000 MIFKVTAKKLISYDSSTSDGKMWKQYDAFTQGLFAFPLCIPGTAFYKCMQ 44149 (0)
46292 GRKNVIKMLKEILDERKNTEEHHESVDFFDVIEEVKAKNPDQMTENAVLDLLFLLLF 46462
46463 ASFETTSSGITAMLIFLTDNPEALQELI 46546 (0)
47088 EHNNIRKRKADKNSEITWEEYKSMKFTSH 47174 (0)
47314 VIHEALRLASIAPVMFREAIEDVHIK 47391 (1)
47742 GFAIPKGSKIMICPYTVHLNPVVYKDPNTFNPWRWK 47849 (0
48552 RNIPEPASGASKDFMAFGGGLRLCVGAHFAKLQMAVFLHCLVTS 48683 (0) 
48972 LSTIVSWKAIKGGRMALSPGLRFPEGFHIQLFPKA* 49079

>aaaa01005183.1 $FI CYP87C5P (indica cultivar-group) 71% to AC083944.6 $F
1171 MYISQENGIPYGWFWSHCYCVSCLVDPFVGHQTEHQYSSKLV
     QGKLPPGSRGLPILGETLDFFSQSPSLELLGFFKRRLDKR (2) 1416
287  YGPVFRTNIVGEDLIVSLDPEVNNFVFQQEGR 382 
382  AFRMWYPDSIMRIIGADSIITTLGSSHKYIKNMVFRLFGPENLRRDMIKDLQKTAEAS 555
556  LLSWLHHPSIELKEAASS 612
1717 MICSITA*KLISYDSVTSDGKM 1782 
1781 WKQYDDFIQGLLSFPLCIPGTLFYE 1855 
1857 CMQ 1865 
2790 GRKNVMKMLKEMMDERKKATGRQESIDFFDVLLEELKEEKHAMSENVALDLIFLLL 2957
2958 FVSFETTASGITAILCFLSDNPKALQELT 3044
4574 EHDYIQKKRPDLNSEITWEEYKTMKFKSH (0) 4660
4780 VIHEALRLTNIAPVMFRKATEDVHIK (1) 4857
5273 GFAIPKG*KIMISPSIVHLNPVVYKDPNIFNPWRWK 5380
5887 DTAEPAGGASKDFMALGGGRRLCVGADFAKLQMAIFLHCLVTKYR 6021
     WKVIKGGKMVLCPGLQFPEGFHIRLLPKG*

>AP000616.1 $F CYP88A5 chr 6, clone:P0514G12 Length = 138739 = AP002805
125060 MEGMGMAAAWAAGDLWVLAAAVVAGVVLVDAVVRRAHDWVR 125182
125183 VAALGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIR 125320
127992 RFGRTGVYRTFMFSSPTILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDD 128171
128172 HRRIRKLTAAPINGFDALTTYLSFIDQTVVASLRRWSSPESGQVEFLTELRRMTFKIIVQ 128351
128352 IFMSGADDATMEALERSYTDLNYGMRAMAINLPGFAYYRALRARRKLVSVLQGVLDGRRA 128531
128532 AAAKGFKRSGAMDMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFL 128711
128712 QENPDIFARAKAEQEEIMRSIPAT 128891
128892 QNGLTLRDFKKMHFLSQ 128942
129448 VVDETLRCVNISFVSFRQATRDIFVN 129525
129704 GYLIPKGWKVQLWYRSVHMDDQVYPDPKMFNPSRWE 129811
129937 GPPPKAGTFLPFGLGARLCPGNDLAKLEISVFLHHFLLGYK 130059
130322 LKRANPKCRVRYLPHPRPVDNCLATITKVS 130411

>AC068924.9a $F CYP89B1 chromosome 10 clone OSJNBa0026L12 1 ordered pieces
15237 MDNLYLILGAILAAAVVPFILFRGNGGKRGRRLPPGPPAVPLLGSVVLLTKALTDVEPEL 15058
15057 LLQRLIARYGPIVSLRMGTRVSVFVADRRLAHAALVEGGAALADRPGVPASRLLGEND 14884
14883 NIITRAGYGPVWRLLRRNLVSETLHPSRARLFAPARYWVHRVIVDKLAASGQAPHDVVD 14707
14706 TLQYAMFCLLVNMCFGERLDEATVRAVEDAQRDLLIYITSQMAVFAYFPAITKHLFRGRL 14527
14526 EKIYALRRRQRELFMPLINARREYKKHGGETTKTTNKETTLEHSYVDTLLDIKLPEDGNR 14347
14346 ALTDDEIIKLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLHDEIKSKTGDDQPEVTE 14167
14166 EDVHGMPYLRAVVLEGLRKHPPGHFVLPHRAAEDVEVGGYLIPKGATVNFMVAEIGRDER 13987
13986 EWAKPMEFIPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLSFAMHHLEYFVANMV 13807
13806 REFEWKEVAGDEVEFAEKREFTTVMAKPLRARLVPRRTT* 13687

>AC068924.9b $F CYP89B2 49% to 89A2 gene 2
30867 MDAWQLFVPAIAILIPLLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPV 31046
31047 VKRLMSRHGPVVSLRFGSQLLVFVADRRLAHAALVESGASLADRPSQAASARLVGEGDTM 31226
31227 ISRASYGPVWRLLRRNLVADTLHPSRAHLFAPVRARVRRLLVDRLREEHGEAEAAPRAVV 31406
31407 ETFQYAMFCLLVLMCFGEQLDEDAVRAIGAAERDTMLYMSSEMGVFNFFPAITRHLFRGR 31586
31587 LQKAHALRRRKEELFVPLINSRREYKKNGGEPKKETTTFTHSYVDNLLDINLPEDG 31754
31755 NRALTDDELVMLCSEFLVAGTDSTSAALQWIMAELVRNPSIQSKLYEEIKSKTGGGGQHE 31934
31935 VSEEDVHDMPYLKAVVLEGLRKHPPAHMLLPHKAAEDMDVGGYLIPKGTIVNFMVAEMGR 32114
32115 DEKEWEKPMEFMPERFLPGGDGEGVDVTSSKGIRMMPFGVGRRICPGLGIAMLHLEYFVA 32294
32295 NMVREFEWKEVAGDEVDFAEKREFNTVMAKPLRVRLVPRSTLE* 32426

>AC068924.9c $F CYP89B3 51% to 89A2 no introns gene 3
37901 MDTWHVAVAAILVLIPFLRLILSRRGGRGGGKRGRLPPGPPAVPLLGSTVWLTNSLADAE 37722
37721 PLLRRLIARHGPVVSLRVASRLLVFVADRRLAHAALVEKGASLADRPAMASTRLLGESDN 37542
37541 LISRASYGPVWRLLRRNLVAETLHPSRVRLFAPARAWVRRVLVEKLRDENGDAAAPHAVV 37362
37361 ETFQYAMFCLLVLMCFGERLDEDAVRAIAVAQRDALLYLSSKMPVFAFFPAVTKHLFRGR 37182
37181 LQKAHALRRRQTELFVPLINARREYKKRQGGANGEPKKETTFEHSYVDTLLDIKLPDDGN 37002
37001 RPLTDDEMVNLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLHDEIMAKTGGGGGGGQ 36822
36821 REVSEEDIHDMPYLKAVVLEGLRKHPPGHMVLPHRAAEDMEIGGYLIPKGTTVNFMVAEM 36642
36641 GRDEKEWEKPMEFMPERFLAGGDGEGVDVTGSREIRMMPFGVGRRICAGLGVAMLHVEYF 36462
36461 VANMVSEFEWKEVAGDEVDFAEKIEFTTVMAKPLRARLVPRRA* 36330

>AC068924.9d $F CYP89B4 50% to 89A2 gene 4
38532 MDNLVILAGVLLLPLLFLLRNAASSRRRRLPPGPPAVPLFGNLLWLRHSAADVEPLLLTLFKK 38720
38721 YGPVVTLRIGSRLSIFVADRHLAHAALIAAGAKLADRPQAATSTLLGVSDNIITRANYGA 38900
38901 MWRLLRRNLVSQTLQQSRVDQFAPARVWVRRVLMEKLRGSGEEAPNVMEAFQYTMFCLL 39077
39078 VLMCFGERLDEPAVRDVEEAERAWLLYISRRMSVFFFFPWITKHLFRGRLEAAHALRRRQ 39257
39258 KELFVPLIEARREYKRLASQGLPPARETTFQHSYVDTLLDVKIPEEGNRALTDDEI 39425
39426 VTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEINATCGGDDELLERNVRDKD 39602
39603 NKMPYLNAVVKEGLRKHPPGHFVLPHKAAEDMDVGGYLIPKGATVNFMVAEIGRDEREWE 39782
39783 NPMQFMPERFLDGGHGAGVDMHGTKGIKMMPFGVGRRICAGLNIAMLHLEYFVGSMVMEF 39962
39963 EWKEVEGHEVEFAEKREFTTVMAKPLRPRLVPRRS* 40070

>AC068924.9e $F CYP89B5 49% to 89A2 gene 5
49550 MDNLAILTGVLLLPLLVFLRDVTSRRRRRLPPGPPAVPLFGNLLWLRHSAAELEPLLLKLFDK 49362
49361 YGPVVTLRIGWRLSIFVADRHLAHAALVGAGATLADRPRTA 49239 frameshift
48% to 89A2 starts at 103
49240 PPACSSASARIITRSNYGAMWRLLRRNLVSQTLQQSRVDQFTPARVWARRVLMEKLRE 49067
49066 TTSGVSGGGGDAPPNVTEAFQHAVFCLLLLMCFGERLHEHAVRDIEDAERAWLLYISKKT 48887
48886 SVFFFLPWITKHLFRGRLEAGHALLRRQKELFVPLIEARREYKKLASQGLPPARETT 48716
48715 FQHSYVDTLLDVKIPEEGNRSLTDGEIVTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQ 48536
48535 EKLHAEINATCGDDGELLERSVRDKDNKMPYLNPVVMEGLRKHPPSHTLLPHKAAEDIDV 48356
48355 GGYLIPKGATVNFMVAEIGRDEREWEKPMEFIPERFLAGGDGDGVDVTGSREIRMMPFGA 48176
48175 GRRICAGLNVGVMHLEYFVGSMVMEFEWKEVAGDEVEFAEKLEFTTAMAKPLRPRLVPRRVRH* 47984

>AC068924.9f $F CYP89B6 50% to 89A2 gene 6
58837 MANVDASQWLMLLLAFLVALFILLSLRKCGGRSRVPPGPLAVPVLGNLLWLSHSSADLEPLLRRLIA 58637
58636 VYGPVVSLRVGSHLSIFVADRRVAHAALVERGAALADRPEVTRALLGENGNTISRGNYGP 58457
58456 TWRLLRRNLVAETLHPSRARAAFAPARSWARRALVDGLVGGGAVLADAFRHAMFCL 58289
58288 LVLMCFGEWLDEAAVRAIGDAQHGWLLHYATKMKVFAFCPAVTKHIFRGRIQTSLALRRR 58109
58108 QKELFMPLISARRERKNQLAERAVPEKETTTFEHSYVDTLLDIKLPEDGGDRALTDDEMV 57929
57928 RLCSEFLDAGTDTMSTTLQWIMAELVKNPSIQSKLHDEIKSKTSDDHDEITEEDTQKMPY 57749
57748 LKAVILEGLRKHPPGHFALPHKAAEDMEVGGYLIPKGATVNFMVAEMGRDEKEWENPMEF 57569
57568 MPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLNTAMLHLEYFVANMVREFEWREI 57389
57388 AGEEVDFAEKLEFTTVMAKPLRAQLVRRRMN* 57293

>AC068924.9g $P CYP89B7P Starts at 259 gene 7 pseudogene fragments
64765 KRPATVPENDTTFEHSYVDTLLDLRLPEDGDRALTDKAMVCLCSE 64631
64626 LDSGADTMSTTLPWIMAELVKNPSIQAKLYEEIKATVSDDHDEITEEDTQKMPYLKAVIL 64447
64446 EGLRKHPLGHFALPHKAAEDMDVGGYLIPKGATVNFMVAEMGRDEREWENPMQFMPERFL 64267
64266 PGGDGEGVDMTGSKRIRMMPFGVGRRMCAGINTAMLHLEYFVANMVREFEWKAVVGDKVD 64087
64086 FAEKL 64072 EFTTVMAKPLRAQLVLRSVD 64013

>AC068924.9h $P CYP89B8P 47% to 89A2 two stop codons and frame shift gene 8
69888 MTIDASPWLLLLVAFLFPFFVLRSLRSDGKGGGRGGGCRVPPGPLAVPVLGNLLWLWHSPADLE 69691
69690 PLLRRLIARHGPVVSLGVGSRLSIFVADRRVAHAALVERGAALADRPEVTRALLGENGNT 69511
69510 ITRASYGPTWRLLRRGLVSGTLHPSTTRARVFAPARSWARRVLVGKLAAASGQAPHGVMD 69331
69330 TLQYAMFCLLVVMCFGERLDEADVRAIATAQHDWIVYFATKMRVFAFCSTITKHLFRGRI 69151
69150 KMALALRRRQKELFVPLINARRERKTRTQPTLPENGTTFEHSYVDTLLDLRLPEDGNRAL 68971
68970 TDKEMVSLCSEFLDAGTDTMSTALQWIMAELVKNPSI*SKLYDEIKATVSDDHDEITEDD 68791
68790 TQKMPYLKAVILEGLRKHPPGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAEMGRDEREW 68611
68610 ENPMQFMPERFLPGGDGEGVDMTGSKRIRMMPFGVGRRMCAGLNTAMLHL*YFVANMVRE 68431
68430 FEWKAVVGDKVDFAEKLEFTTVMAKPLRAQLVLRSVD* 68318

>AC068924.9i $F CYP89B9 51% to 89A2 no introns gene 9
BI812666.1 mature leaf library cDNA clone F008D03.Length = 448
86433 MATDTSWLLLLVALVLPLVVLLARRRRSGGGSRRIPPGPLAVPVLGSLLWLRHSSANLEPLLQRLI 86236
86235 ARYGPVVSLRVGSRLSIFVADRRVAHAALVERGAALADRPDVTRSLLGETGNTITRSS 86062
86061 YGPVWRVLRRNLVAETLHPSRVRLFAPARSWVRRVLVDKLADGARPESEPPRPRVVVETF 85882
85881 RYAMFCLLVLMCFGERLDEAAVRAIGAAQRDWLLYVARKTSVFAFYPAVTKHIFRRRLQI 85702
85701 GLALRRQQKELFVPLIDARRARKNHIQQAGGPPVPEKETTFEHSYVDTLLDVSLPDTDGD 85522
85521 SALTEDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDDEIT 85348
85347 EEDTHDMPYLKAVILEGLRKHPPAHFVLPHKAAEDVEVGGYLIPKGATVNFMVAEMGRDE 85168
85167 REWEKPMEFIPERFLAGGDGEGVDVTGSREVRMMPFGVGRRICAGLGVAMLHLEYFVANL 84988
84987 VKEFEWKEVAGDEVDLTEKNEFTTVMAKPLRAQLVKRA* 84871

>AC068924.9j $F CYP89B10 48% to 89A2 gene 10
92213 MAIDATQWLLLLVVFLVAFLFTLLAKHGAVKRKHGVRVPPGPLAVPVLGSLVWLTHSSSANLEPLLR 92013
92012 RLIARHGPVVSLRVGSRLSIFVADRRVAHAALVGRGAALADRPPDVTHSLLGESRNTITR 91833
91832 SGYGPVWRLLRRNLVVETTHPSRVRLFAPARSWVRRVLVDKLADAGAHPASPPRVLEVFR 91653
91652 YAMFSLLVLMCFGERLDEAAVRAIGAAQHDFLLYLGRKTSVFMFYPAITKHLFRGRVHLG 91473
91472 LAVRRRQKELFMPLIDARRERKKQIQQSGDSAASEKKKDDNTTFNHSYVDTLLTIRLQDV 91293
91292 DGDGDRALTDDEMVSLCSEFLSAGTDTTATALQWIMAELVKNPSIQSKLYEEIKATMSGD 91113
91112 NDDEINEDDARNNLPYLKAVILEGLRKHPPMHLLLPHKAAEDVEVGGYLIPKGATVNFMV 90933
90932 AEIGRDEKEWEKPTEFIPERFMAGGGDGEGVDVTGSREIRMMPFGAGRRICAALSVAMLH 90753
90752 LEYFVANMVKEFEWKEVAGDEVDFAERLEFTTVMAKSLRVRLIKRA* 90612

>AC090873 $F CYP89B11 60128..61720 47% to 89A4 same as AQ327293 AU090603
MELTWLLLLATLLLSTTLLVFLFHGGSSATGGEKRRRLPPGPAT
VPVLGNLLWATNSGMDIMRAVRRLHARHGPMLGLRMGSRLEVIVADRRLAHAALVESG
AAMADRPEFASRALLGLDTATISNSSYGPLWRLFRRNFVAEVAHP ARLRQFAPARAAV
LEELTDKLRRRQEDAGAGTILETFQYAMFFLLVAMCFGELLDERAVRDIAAAQRDLLL
HSSKKLRVFAFLPAITTRLFAGRMKAMIAMRQRLKGMFMPLIDARRARKNLVDDHGDA
TAPPPPAASATTLPHSYVDTLLNLRINDNGGERALTDDEMVALCSEFLNGGTDTTSTA
LEWIMAELVKNPTIQDKLHGEIKGAITSNSGKVSEEDVQKMPYLKAVVMEGLRRHPPG
HFVLPHAPAEDMELGGYTIPKGTLVNFTVADMGMDGAAWDRPREFLPERFMAGGDGEG
VDITGTREIRMMPFGAGRRICPGLGVATLHLEYFVANMVAAFEWRAAEGEAVDVDGEK
LEFTVVMEKPLRARLLPRAVTV

>AP004792.1 CYP89B12P (japonica cultivar-group) chr 6 
102512 EIIKLCSEFLNADTDTTSTTLWWIMAKLVKNPSIQSNIHDKITAKTGDEKVEVSEENVHG 102333
102332 MPYLRAVVLEGLRKHPPGHFVLPQKAMEDMEVGGYLIPKGATVNFMVAEISRDEQEWAKP 102153
102152 MEFIPKRFLPDGDSEGVDVTGSKGIRMMPFGVKRRICVGLNFAMHHLEYFVANMVREFK* 101973
101972 KEVAGDEVEFVEKQE 101928

>aaaa01015583.1c CYP89B13P (indica cultivar-group) 93% to AC068924.9h runs off end
6384 GTDTMSTALQWIMAELVKNPSIQSKLYEEIKATVSDDHDEITEEDTKKMPYLKAVILEGL 6205
6204 RKHPLGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAEMGRDEREWENPMQFMPERFLPGG 6025
6024 DGEGVDMTGSKRIRMMPFGVGRRMCAGLNTAMLHLEYFVANMVRAFEWKEVAGDEVDFAE 5845
5844 KAELTTVMAKPLRAQLVLR 5788

>AC074105.3 $P CYP89B14P chr 10 clone OSJNBa0030B02 19 unordered pieces from 
109989 SSFMADCCVAHATLVERGAALANRLEVARSLLGENDYTITRCRCGPVWQILRRNLVAEMLHPSRVRL 110189

>AP002854.1 $P CYP89B15P chr 6, BAC clone:OSJNBa0014B15, 89% to AC074105
23716 SSFVADCCVAHATLVERGTTLADRLEVARSLLGENGYTITRCRCGPMWQILRRNLVAETL 23895
23896 HPSRVRL 23916

>AP004811.1 $F CYP89C1 (japonica cultivar-group) chromosome 6 
113179 MEDWIFYSLTLLLCLACSLLLRARASAAAVEVAPLPPGPRTVPVLGPLLFLARRD 113015
113014 FDVEPTLRRIAAEHGPVFTFAPLGPSRPTIFVAARGPAHRALVQRGAAFASRPRGVSPA 112838
112837 SVLLTSGGRNVSSAQHGPIWRALRRCISSGVLNPARLRAFSDARRWVLDALVSHIRGEGG 112658
112657 APLTVMEPFQYAMFCLLVYMCFGDRPGDARVREIEALQRELLSNFLSFEVFAFLPPITRL 112478
112477 VFRRRWNKLVSLRRRQEELFAPLIRARREAGAGGDCYVDSLVKLTIPEDGGRGLTDVEIV 112298
112297 SLCSEFMSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGEVREEDLQAMPYL 112121
112120 KAVVLEGLRRHPPDHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGLDSEVWTSPEVFR 111941
111940 PERFLAGGEGEDVDLTGSKEIKMMPFGAGRRICPGMALALLHLEYFVANLVREFEWREVA 111761
111760 GDEVDLTQKLQFTVVMKRPLKATAVPLRGDRSAAAAVTGSA* 111635

>aaaa01016355.1 $FI CYP89C2 (indica cultivar-group) ortholog of AA754418
90% to AAAA01004950.1
5728 MEDWLFYSLTSLLCLACSLLLRARASAASPKAAEAEAAPLPPGPRTVPVLGPLLFLARRDFDVEPTLRR 5522
5521 IAAEHGPVFTFAPLGPSRPTIFVAARGAAHRALVQRGAAFASRPRGGGGPASALLSSGGR 5342
5341 NVSSAPYGPTWRALRRCISSGVLNPARLRAFSDARRWVLDVLISHVRGEGGAPVTVMEPF 5162
5161 QYAMFCLLVYMCFGDRPGDARVREIEALQRDLLGNFLSFQVFAFLPPITKLVFRERWNKL 4982
4981 VSLRRRQEELFVPLIRARREAGAGGDCYVDSLVNLTIPEDGGRGLTDGEIVSLCSEFMSA 4802
4801 GTDTTATALQWILANLVKNPAMQDRLREEIAAAVGSDGEVREEDLQAMPYLKAVVLEGLR 4622
4621 RHPPGHYVLPHAVEDETTLDGYRVPANTPVNFAVGEIGLDSEVWASPEVFRPERFLPGGE 4442
4441 GEDVDLTGGKEIKMMPFGAGRRVCPGMALALLHLEYFVANLVREFDWREVAGDEVDLTEK 4262
4261 LEFTVVMKRPLKAIAVPLRGDRSAAVE* 4178

>AP003258.3 $F CYP89D1 (japonica cultivar-group) chr 1
36588 MEVILLPLVVIITSTMLLLLIISTAKKRHHGTANLPLPPAPPSVPVVGPLLWLVRARSNL 36767
36768 EPAIRELHRRHGPILSLTFLSPRAAIFVSSREVTHRALVQRGHTFASRPPAIAPFAVLTS 36947
36948 GQCTVSSAPYGPLWRSLRRNLTSGVLGHGSRAPLYAPARRWALHLLTSDLAAASGNTGGG 37127
37128 VAVAVVDCLQFAMFSLLTYMCFGKRLDRRGVREIEAVQRELFSSYISFQVFAFCPTVTKR 37307
37308 LFFRRWQKVLSIRRRQEDIFLPLIEERRKRIKISSMDNDGSMVCCYVDTIISHKLPKEAG 37487
37488 DRRLTDGELVSLCTEFLTASVDTIVTALQWIMARVVEQPEIQAKLLDEINRVVSSDKEHV 37667
37668 DEEDIKSMAYLKALVLEGLRRHPPAHFLLSHAAVEETSLDGHRIPAGRSVNFSVADVAHD 37847
37848 ENVWSRPEEFLPERFLDGGEGAGTDLTGSREIKMMPFGVGRRICPGLGLALLQLEYFVAN 38027
38028 MVREFEWGMVDGDCGGGINLAERPEFTVIMEQPLRALVVPRRRE 38159

>AP004769.1 $F CYP89E1 (japonica cultivargroup) chromosome 2 clone P0017C12, Length = 
135357 New 45% to 89A4 65% to Lolium rigidum clone Lol2 AF321865
50173 MEETWLFLLFSISLVAVLLATARRRRSSSIKARLPPGPSPLLFLAKFLRLRRSIFDLGPLLRDL 49982
49981 HARHGPVISIRLFGTTLVFVADRRLAHRALVQGGSTFADRPPLPELGRLFTSDTRDINSS 49802
49801 PYGPYWRLVRRNLASEALSPARVALFAPARRRARDVLVRGLRDRGGDGSRPVELRPLLRR 49622
49621 AMFELLLYMSLGARLAPEALEEVERLELWMLRAFTSFPVFSFFPAITKRLFRNQWAAHVA 49442
49441 VRRRVGEIYVPLINARRAGDGDGDDPPCYTDSLLQLRVAEEGDRPLTDDEIIALCSEFLN 49262
49261 AGTDTTVTLVEWIMAELVNRPDIQAKVHDEVRRRPELTEADLQAMPYLKAVVL 49103
49102 EGLRLHPPAQFLLPHGVQSDAEVGGYVVPRGAELNVWVAELGRDEVVWTAAREFMPERFM 48923
48922 DGGEVEVDVTGSREITMMPFGVGRRMCPGYTVGTLHAEYLVGSLVRELEWLP 48767
      ETEGEAADMAEELDFTTVMKHPLRARVLPRPSSLY* 48655

>AC087192 $F CYP89F1 similar to CYP89A4 missing about 97 aa internally not assembled 
     MHAELTSTTTMEMGSLLPHAASLFAVSMASLMIAAVLSIVRRP
4971 WPWKTAAISREAVLRLLGVRLGDVPTTVVRDGAVAVDALVRRADAFSDRPAG 5126
5127 GGATSIVSGGRAHNINTVPHGPLWVALRRNLTSEAFHP  VHGLARAAPGRSSRTSRPPRR 5303
5304 APPAEGQA 5327
     VRDCLYAALFALNVATCFGDGVDGE 5413
5414 LVGAMRAAQQEFLRFLPRARVFSTFQKAARLVYPDRWKQLLRHRRRQEEMYLPLIRAIN 5590
5591 EQRRTRGTPSPPPPTT
5639 YVDTLLYLEVPADDGRRRRKLSDGEMVGLVSEYLGAATGTVVAQLEWALANLVRRPDIQT 5818
5819 RLCGEVEAAAGGEPCAYLRAVVMECLRRHPPVSSVQRHMVRDVMLGGAHV 5968
5969 ARGNV VSFAIEEIGR 6013
6667 WTSSEEFSPERFMEGGEEGVRLAIGSKQEATTKVKMMPFSAGRRTCPGMGYAILHLEYFL 6846
6847 ANLVTAFEWRRVPWEEEVDLTADYGFITTMQHPLRALVVPLSNDRSTVV* 6996

>AP005252.1 CYP89G1 chr 7
105052 MALLLLLVSSSCLVVAASIAVLCYVNNDADERLPPGPRVRLPLIGNLFLHAPTMAFLPSA 105231
105232 LRRLRRSHGPVVTLWAGNRPAVFVIGRDFAHRTLVLAGAALAHRPPSPFASSRALSFNRH 105411
105412 GVNAAEYGDRWRRLRSNICSCLAATEALRRRSVDRLVATLELEARAGAG 105558
105559 ATGVVAPTDAFRHGVFSFFAVLCFGEWVRDGEHDAVLRDLRRAHADILALTVELGAFHLV 105738
105739 PAVLMVPYLHRWWKLSGLQRSHRDIVAALISVRRLRREKADGDVADSATFCYVDTLLELE 105918
105919 LGEDEMVSLCWEFMNAAAKTTSTALEWTMARLVHHSDIQRKLRHDIAKTTNSGGVGVSPS 106098
106099 PYLKAVVQESLRLHPPAHYLLAHTVDRDVPLGAGGYVIPKGAIVNYAVAEIGRDATAWTD 106278
106279 PDEFVPERFMEGGEGAMVDAVSCGGAEIRMMPFGAGRRACPGASFAVSVLHLFVGRLVEQ 106458
106459 FEWWPVAEDEKAAAVDFSEKTGLVTVMKTPLRALLVPITSS 106581

>AC123526.1 $F CYP90A3 chr 11 60% to 90A1 2 diffs with aaaa01015179.1
61015 MAAAALLLLAAAAAIVVVAMVLR
60946 WLLLLGGPAAGRLGKRALMPPGSTGLPLIGETLRLISAYKTPNPEPFIDERVARHGGVFT 60767
60766 THVFGERTVFSADPAFNRLLLAAEGRAVHSSYPSSIATLLGARSLLLTRGAAHKRLHSLT 60587
60586 LTRLGRPASPPLLAHIDRLVLATMRQWEPAATVRLMDEAKKITFNLTVKQLVSIEPGPWT 60407
60406 ESLRREYVKLIDGFFSIPFPLANLLPFTTYGQALK 60302
60159 ARKKVAGALREVIKKRMEEKAENGGSIGDDEGKKEKKDMVEELLEAEGGSFSEEEMVD 59986
59985 FCLSLLVAGYETTSMLMTLAVKFLTETPAALAELK 59881
59231 EEHANIRDMKGKKQPLEWSDYKSMPFTQC
58979 VINETLRVGNIISGVFRRANTDIHYK
58783 DYTIPKGCKIFASFRAVHLNNEHYENARTFNPWRWQ (0)
58561 INNKLQNAVGANIFTPFGGGPRLCPGYELARVVVSIFLHHLVTRF 58427
58285 SWEETEEDRLVFFPTTRTLKGYPINLRLLSESIC* 58181

>aaaa01034672.1 CYP90A4 (indica cultivar-group) 56% to 90A1 89% to AC123526.1 
1531 GRAPRLPPRSTGLPLIGETLRLISAYKTPNPEPFIDDRVARHGSGVFTTHVFGERTVFSADPAF 1340
1339 NRLLLAAEGRAVDCSYPSSITTLLGAHSLLLTKGPAHRRLHTLTLTRLGRPASPPLLAHI 1160
1159 DRLILATMRDWEPAATVRLLDEATKVTFNLTMKQLVSIEPGPWTESIRREYVKLIDGFFS 980
979  IPFPFAYLLPFTTYGQALK (0) 827
826  ARKKVAGALREVIRKRMDDKVGNGGAEGEDEEKREKKDMVQELLEAEDGSFSVEEMVDFC 647
646  LSLLVAGYETTSVLMTLAVKFLTETPTALAPLK (0) 548

>AC104473.1 $F CYP90B2 chromosome 3 clone OJ1626B05, Length = 127982
MAAMMASITSELLFFLPFILLALLTFYTTTVAKCHGGHWWRGGTTPA
34958 KRKRMNLPPGAAGWPLVGETFGYLRAHPATSVGRFMEQHIAR 34833 (2)
34664 YGKIYRSSLFGERTVVSADAGLNRYILQN 34578
34577 EGRLFECSYPRSIGGILGKWSMLVLVGDPHREMRAISLNFLSSVRLRAVLLPEVERHTLL 34398
34397 VLRAWPPSSTFSAQHQAKK 34341 (0)
34237 FTFNLMAKNIMSMDPGEEETERLRREYITFMKGVVSAPLNLPGTPYWKALK 34082 (0)
31271 SRAAILGVIERKMEERVEKLSKEDASVEQDDLLGWALKQSNLSKEQILDLLLSLLFAGHE 31092
31091 TSSMALALAIFFLEGCPKAVQELR (0)
30871 EEHLGIARRQRLRGECKLSWEDYKEMVFTQC 30776 (0)
29986 VINETLRLGNVVRFLHRKVIKDVHYK 29909 (1)
29811 GYDIPSGWKILPVLAAVHLDSSLYEDPQRFNPWRWK 29704 (0)
28816 SSGSSGGLAQSSSFMPYGGGTRLCAGSELAKLEMAVFLHHLVLNFRW 28676
28675 ELAEPDQAFVFPFVDFPKGLPIRVHRIAQDDEQE* 28571

>AP003244 $F CYP90D2 59% to 90D1
MVSAAAGWAAPAFAVAAVVIWVVLCSELLRRRRRGAGSGKGDAA
AAARLPPGSFGWPVVGETLEFVSCAYSPRPEAFVDKRRKLHGSAVFRSHLFGSATVVT
ADAEVSRFVLQSDARAFVPWYPRSLTELMGKSSILLINGALQRRVHGLVGAFFKSSHL
KSQLTADMRRRLSPALSSFPDSSLLHVQHLAKSVVFEILVRGLIGLEAGEEMQQLKQQ
FQEFIVGLMSLPIKLPGTRLYRSLQAKKKMARLIQRIIREKRARRAAASPPRDAIDVL
IGDGSDELTDELISDNMIDLMIPAEDSVPVLITLAVKFLSECPLALHQLEEENIQLKR
RKTDMGETLQWTDYMSLSFTQHVITETLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCV
FVYFRSVHLDDTLYDEPYKFNPWRWKEKDMSNGSFTPFGGGQRLCPGLDLARLEASIF
LHHLVTSFRWVAEEDHIVNFPTVRLKRGMPIRVTAKEDDD

>AC130732.1 CYP90D3 chromosome 5 
MHSIYIDAHLLFQKLEYSILTVTQLATPAA
MQPLAAGGGVSWPLYAATVAAALLVTAIVLRLAARSTAAA
16466 CKARPPAGSLGWPLVGETLQFISAAYSSRPESFVEKRC 16579
16686 RRYGKVFRSHLWGSPAVVSADAEASRAVLQSDASAFVPWYPRSLMELMGESSILVLGGAL 16865
16866 QRRVHGLAGAFFKSPELKARVTADMRSRL 
IVFEILVRALIGLEQGQEMNYLRQQFHIFIAGLISLPIKLPGTQLYRSLK
AKKRMTSLIQNIIQEKRRRIFEGKDLCAVSRDLIDVLMSNGSDELSLTDELISD 
NMIDFMIPAEDSVPVLITLAIKYLSECPLALQQLE
SLYLMQEENMELKRQKSDVGETLEWTDYMSLTFTQH (0)
VITETLRIGNIISGIMRKAVRDVEVKGQGDVVIPKGWCVLVYFRSVHLDAN 20309
20310 IYDDPYAFNPWRWKERDMAAATANSGSGFTPFGGGQRLCPGLDLARLQTSIFLHHLVTNF 20489
20490 TY 20495
RWVAQGDVVVNFPTVRLKRGMPIKVTPK

>AP004314.1 $P CYP90D4P chromosome 7 clone P0495H05, Length = 205470 90D like
137016 QAKKKMVRLIQRIIWDKRARRATTGPP
136946 RDAIDVLFRDTSDELTDELISDTMIDLMIPAGDSVPVLITLTVKFLSECLLALHQLEXXXXXX 136776
135719 KRRKTSMGETLQWTDMSLSFTXX 135657
135520 VITETLWLGNIIGGIMHKAVRGVEVNGYLIPKGWC 135416 
135413 SVHLDDMLYDEPYKFNP*RSK
134847 EKDMSNGSFTPFGGGQRLCPGLDLARLEASIFFHHLVTSFRY 134722

>AP005419.1 CYP92A7 (japonica cultivar-group) chromosome 9 clone
1053 MEVALCASFVAILLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHE 1232
1233 LSRRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWS 1412
1413 PCDAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLS 1592
1593 TASLNMITRMVMGKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLE 1772
1773 WLDLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEV 1952
1953 KLSRDSIKAFTQ 1988 (0?)
4609 DLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEAIV 4788
4789 KETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFMPERF 4968
4969 LGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDLSM 5148
5149 EEIFGLSMPRKFPLEVAVEPKLSSHLYKGD 5238

>AP005570.1b CYP92A8 4 genes and a pseudogene seq  of gene 2 shown below
16178 MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH 15999
15998 SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW 15819
15818 SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASGRVVALKDYL 15651
15650 SAASLNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWL 15477
15476 GWLDLQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLE 15297
15296 VKFSRDSVKAFTQ 15258 (0?)
13216 DLIAGGTESSSATVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTEK 13073
13072 DIPSLPYIDAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKL 12893
12892 WDAPEEFMPERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWR 12713
12712 LPDGMTKEQLSMEEIFGLSTPRKFPLEVVVEPKLPADLY 12596

>AP005570.1c $F CYP92A9 4 genes and a pseudogene seq  of gene 3 shown below
21127 MLPPWASFVGVVLATVLFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKKYG 20936
20935 PLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGAYW 20756
20755 RQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGVVVLKDYLSTVSLNV 20588
20587 ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQG 20423
20422 YIKRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREG 20243
20242 VKAFTQ 20225 (0?)
19497 DLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLT 19336
19335 YVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEE 19156
19155 FMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVT 18976
18975 REQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLY 18877

>AP005570.1d CYP92A10P 4 genes and a pseudogene seq  of pseudogene 4 shown below
32984 MELPPWPSLLVIVLTAVVFFLATILCHGRRVYRLPLGPKPWPIIGNLNLIGALPHRSIHE 33163
33164 LSKRYGPLIQLRFGS 33208

>AP005570.1e CYP92A11 4 genes and a pseudogene seq  of gene 5 shown below
ortholog of AAAA01006146.1c $PI 100% first 199 aa (not a pseudo in japonica)
47412 MELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHE 47591
47592 LSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILWS 47771
47772 PYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAAPVLLRDYLS 47936
47937 TATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGD 48116
48117 FIPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLAD 48296
48297 DPNLEVQLRRDNVKALTQ 48350
48452 DLIAGGTDTSAITVEWAISELLRKPEILAKATEELDRVVGRGRLVTETDMTSLPYVEAI 48628
48629 VKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEEFMPER 48808
48809 FIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKVIQLSLASLLHGFEWRLPDGVSAGELS 48988
48989 MEEVFGLSTPRKVPLEVVVKPKLPAHLYTG 49078

>AP003870.1 $F CYP92A12 chromosome 8 clone OJ1116_A04  70% to D24290 related to 92A
9007 MEPSALATLLSMALAAFLLLGLIKRKGSRRGYN
8908 LPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMARLVLKT 8729
8728 HDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEHIRA 8555
8554 DEVRALVRGLFAAASSGRSGAVHLNRDHLSTLSMNVITRMVLGKRFFGEGADAAEGPVST 8375
8374 LSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLDEHSER 8195
8194 RRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSSVTVEWALSE 8015
8014 LFKNPAIFATATDELDRVVGRCRWVTEKDIPNLPYLDAIMKETMRMHPIVPLLIPRVARD 7835
7834 DAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFELLPFGSG 7655
7654 RRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYPLQVVVEPRLPVQLYSL* 7445

>aaaa01012419.1 $FI CYP92A13 (indica cultivar-group) one frameshift
2885 MLATVVFVFLLQAVLLRRRGAYKLPPGPKPWPIIGNLNLIGALPHRSIHEISK 3043
3044 RHGPIVQLWFGSCPVVVGSSVEMAKLFLKTNDAVFADRPRTAAGKYTAYDCADIVWSPY 3220
3221 CAYWRQARKMCIAELFSARRLESLEHIRHEEVRALLRDLNSAGVAGNAVQLGDHLS 3388
3389 MVTLGVISRMVLGKKYVEKQPAGAETASSPPTTPEEFKWMMDELFLMSGVLNIGDFIP 3562
3563 WLDWLDLQGYVRRMKKVNRLMHRFLDRVLDEHDERRRLQGDGFVARDMVDVLL 3721
3722 QLADDPNLDVQLTRNGVKGITQ (0) 3775
     NLVTGGADTS (fs)
5132 VTVEWAMSEVLKNPAILAKATKELDNVVGSGRLVTESDIPHLPYVDAIMKETMRMHPVAPLL 5317
5318 IP 5323
5323 RMSREDATVAGYDVPAGTRVLVNTWTINRDPSLWDSPEEFRPERFVGSGIDVKGRDFELL 5502
5503 PFGTGRRMCPGYSLGLKVIQLTLANLLHAFSWNLPDGIAAGELSMEEIFGLTMPRKIPLL 5682
5683 AVVKPRLRDHLYAEP* 5730

>AK100987.1 CYP92A14 (japonica cultivar-group) cDNA clone:J023145F09
32  MELQSSWATFFAVVLATVVFLLRAVLLRRRRAYKLPPGPKPWPIIGNLNLISSLPHRSIH 211
212 EISKRHGPIVQLWFGSCPVVVGSSVEMAKLFLQTNDAVFADRPRTAAGKYTAYDCTDITW 391
392 SPYGAYWRQARKMCAAELFSARRLESLEHIRHEEVRALLRELHGSGAAGNAVQLRDHLSM 571
572 AALGVISRMVLGKKYVEKQPAGGGAAMTTPEEFKWMLEELFLMNGVLNIGDFIPWLDWLD 751
752 LQGYIRRMKNVNRLIHRFLDRVLDEHDERRRLQGDGFVARDMVDILLQLADDPNLDVQLT 931
932 RNGIKGITQDLVTGGADTSTVTVEWAMSEVLKNPAILAKATEELDTIVGVGRLVTEGD 1105
1106IPHLPYIHAIMKETMRMHPVVPLLVPRMSREDASVAGYDVPAGTRVLVNTWTIGRDPSVW 1285
1286DSPEQFRPERFVGSGIDVKGRDFELLPFSSGRRMCPGYNLGLKVIQLTLANLLHAFSWCL 1465
1466PDGVTAGELSMEEIFGLTMPRKIPLLAVVKPRLPDHLYAEP 1588

>AP004022.1b $F CYP92A15 chromosome 2 clone OJ1126_B06, = AP005069.1b
59881 MEVQELVPSPWSSSSSFLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDL 59669
59668 SRRYGPLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSH 59489
59488 YGEYWRQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVT 59309
59308 LNVISRMVFGKKYIVEEGEGSSPTTAEEFR 59219 (2)
59007 WMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMKRLGGMFDRFLEHILDEHVERRRR 58834
58833 EGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFIL 58729 (0)
57247 ELITGSTDTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYLDA 57074
57073 VVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVWGD 56894
56893 DAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHGFA 56714
56713 WRLPGGAAAEELSMEEKFGISVSRLVQLKAIPEPKLPAHLYDE* 56582

>aaaa01012551.1 CYP92A16P $PI (indica cultivar-group) 87% to AAAA01012419
5816 FMGSGIDVKGWDFELLPFGSGRQMCPGYSLGLKVIQLTLANLLHAFSWSLPDGVAAGELS 5995
5996 MEEIFGLTTPRKIPLLPIVKTRLPDNLYAEP 6088
     YDAPCVACMHGCAFVGV* 6142

>aaaa01010885.1 $FI CYP92C1 (indica cultivar-group) ortholog of AT003629.1
759 MAMSSWVATIVTLLIGVAVASLRGRQRRTKARLNLPPGPRGWPVFGSLGALAGALPP 929
 930 HRALAALAARHGPLMHLRLGSFDAVVASSAGAARLVLKTHDAAFADRARTAAGELVAYNY 1109
1110 KGIVHTPYGAYWRMARKLCATELFSPRRVDSYERIRAEEIGALARDLFGRAGRAVAVRER 1289
1290 LASATLRNILRMSVGDKWSGVYGSADGEAFRRTLDEAFEVSGAVSNVGEWVSLLGWL 1460
1461 DVQGFRRRMKRLSKMYDRFLEQILHEHEASMAAAGDGGQPAAAACDLVDVLLQLSGEEEE 1640
1641 GSAGAGADSEARLTRDGVKAFILDIIAGGTESSAVAMEWAMAELLRRPDAMAAATDELDR 1820
1821 VVGTARWVTERDIPDLPYVDAVVKEALRLHPVGPLLVPHHAMEDTVVAGGYVV 1979
1980 PAGARVLVNAWAIARDPASWPDRPDAFLPERFLPGGGAAAAGLDVRGQHYELLPFGSGRR 2159
2160 VCPATNLAMKMVALGVASLVQGFAWRLPDGVAAEDVSMEE 2279
     LVGLSTRRKVPLVAVAEPRLPAHLYAGTAA* 2372

>AP005652.1 CYP92C2P (indica cultivar-group) chr 6
104950 VDSYEHIRAEEIRALVRNLFGCASHAVAVRECLVNATLRNILHMSVGEKWSGVYGSADGE 105129
105130 VFRRTESSAVTMEWAMAELLRCPDAIATATDELDRVVGRARWVAESDLPDLPYVDAVVKG 105309
105310 ALRLHPVGPLLVPHHAMEDTVAACNDVPVGTHVLVNVCAIARNPTSWPDRLDVFLPERFL 105489
105490 PGGGA 105504

>AP003927.1 $P CYP92C3P chr 7 clone OJ1120_A01, pseudogene fragment related to CYP92A
58933 PLLVPHHARENTVVAGYDVPAGTRVLVNLWAIARDPASWLDRPDAFLPERFLPGAGSCDD 59112
59113 VVDVHGQHFELLPFESGRQIYPATNLAKKMVALGVASLLQGFAWR 59247 
59250 EDVSMEELVGLSTRRKVPLVAVAEPRLPAHERR* 59351

>aaaa01027238.1 $PI CYP92C4P (indica cultivar-group) similar to AP003927.1
1448 PLLVPHHARQDTVVTG 1401
1291 RVLVHVRAIAPDPASWPDRTDAFLPERFLPGAGGCDGGVDVHGQHFELLPFGSGRRISPA 1112 
1111 TNLAKKMVALGVASLLQGFAWRLPD  1037
1035 EDVSMEELVRLSTRRKVPLVTVAEPRLPPHLYAAAAA* 922

>AP003711.1 $F CYP93F1 chromosome 6 clone P0417G12 45% to 93D
85884 MDHQLVARGLFKPLLLFVAGLIVLYALRRRRRHRRSSGLR 
85764 LPPSPFGLPILGHLHLLAPLPHQALHRLAARHGPLLFLRLGSVPCVAACSPDAAREVLKT 85585
85584 HEAAFLDRPKPAAVHRLTYGGQDFSFSAYGPYWRFMKRACVHELLAGRTLDRLRHVRR 85411
85410 EEVARLVGSLRASADGGERVDVDAALMGLTGDIVSRMVMGRRWTGDDNDAEEMRSV 85243
85242 VAETAELTGTFNLQDYIGVFKYWDVQGLGKRIDAVHRKFDAMMERILTAREAKRKLRRQA 85063
85062 AADGEDDEKDLLDMLFDMHEDEAAEMRLTRDNIKAFML (0)
84873 DIFAAGTDTTTITLEWALSELINNPPVLRKLQAELDAVVGGARLADESDIPSLPYLQ 84703
84702 AVAKETLRLHPTGPLVVRRSLERATVAGYDVPAGATVFVNVWAIGRDAAWWPEPTAFRP 84526
84525 ERFVSGGGGGGTAADVRGQHFHLLPFGSGRRICPGASLAMLVVQAALAAMVQCFEWSPVG 84346
84345 GAPVDMEEGPGLTLPRKRPLVCTVSPRIHPLPAAASASLT* 84223

>AP004013.1 $P CYP93F2P chr 8 clone OJ1575_B01 pseudogene fragment like AP003711
74046 RRPAGPGLRLPPSPFGLPILGHLHLLTPLPHQALHRLAACHGPLLYLRLGSVPCVAACSP 74225

>AL606632.1 $P CYP93F3P chr 4 clone OSJNBa0042L16 pseudogene fragments like AP003711
79792 VHELLAGLTLDRLRHVRREEVARLVGSLSWSATDAEHVDVDAALMGVTSNIVPRMVMGRR 79613
79612 WTGDDNDMEEMRSVVAETAELTGDLVYQD 79526
79515 RGRQAELDAVVGDLQAVAKETLRLHPT 79435

>AP004070.1 $P CYP93F4P chr 2 clone OJ1705_E12 two pseudogene fragments like AP003711
107009   AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSA 107110
108243 RRAAVHELLAGRTLDRLRHVGREEVARLVGSLSRSAANGEHVDADAALMGLTSDIVSRMV 108064
108041 GDDNDTEEMWSVVAETAELTSTLNLQCEVIIILVVAVEQPGEVVVVVGAALVNEEVNAVHRR 107856 

>AP003759.1 $P CYP93F5P chromosome 7 clone OJ1567_G09, pseudogene fragments like 
100882 RRRRRHLPQQGRRLPRREAGGAPLPRAALAHDGARHG 100772
112892 AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSA 112993
114111 AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSAANGEHVDADAALMGLTSDIVSRMVN 113935
113934 W*WAGDDNDTEEMWSVVAETAELTSTLNLQGEVIVILVVAVEQPGEVVVVVGAALVNEEV 113755
113754 DAVHRR 113737

>AL606442.1 $F CYP93G1 chromosome 4 clone OSJNBa0068L06 43% to 93D1
122031 MASLMEVQVPLLGMGTTMGALALALVVVVVVHVAVNAFGRRR
122157 LPPSPASLPVIGHLHLLRPPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIR 122333
122334 SHEAKISERPLTAVARQFAYESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRA 122513
122514 GLVSLLRHVLSQPEAEAVDLTRELIRMSNTSIIRMAASTVPSSVTEEAQELVKVVAELV 122690
122691 GAFNADDYIALCRGWDLQGLGRRAADVHKRFDALLEEMIRHKEEARMRKKTDTDV 122855
122856 GSKDLLDILLDKAEDGAAEVKLTRDNIKAFII 122951 (0)
123050 DVVTAGSDTSAAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRLPYLQAAYKETLRL 123247
123248 RPAAPIAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLEFRPERFLAGGGGE 123427
123428 GVEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCMDNKLIDMEEADG 123604
123605 LVCARKHRLLLHAHPRLHPFPPLL* 123679

>AL607097.1 $F CYP93G2 chromosome X clone OSJNBa0082A03 = AY021309.1 39% to 93D1
118528 MEEGVVGGGGAAVLVALLVTVVLAVMRSAGSRSSKRGRLPPSPMALPIIGHLHLIRPPPHRAFDRILARH 118737
118738 GPLVYLRLGPSTHCVVIGSADVARDFLKFEASIPERPPTAVTRQLAYGKAGFAFAPYGA 118914
118915 YWRFVKRLCMSELLGPRTVELLRPVRAAELADVLRAAQSAAERGEGVDMSHELVRMA 119085
119086 NNSIMRMVASALPGEMAEAARDCAKQVAELVGAFNAEDFVAVCRGWDLQGIGRRT 119250
119251 NEVHARFDALLETIIEAKEEARRRSLRLGRRESSSKDLLDMLMDAAEDDTAEVKLTRD 119424
119425 NIKAFVL (0) 
       DIF 119604
119605 TAGSDTTATTVEWMLAELVNHPECMAKLRGELDAVVGRSRLVGEQDVARLPYLQAVLKET 119784
119785 LRLRPPAVFAQRVTVEPVQVRGYTIPTDTQVFFNIFSIGRDATYWDQPLHFRPDRFL 119955
119956 PDGAGATVDPKGQHPQLMPFGSGRRACPGMGLAMQAVPAFLAALVQCFDWAPPPSQP 120126
120127 LPLDMEEAAGLVSARKHPLLLLPTPRIQPLPSFYS* 120234

>AC131343.1 $F CYP94B4 (japonica cultivar-group) chr 11
35451 MAWFVAAWSCLLVVVMVSSMRLSRSASSSCGSSCGHGGWGPRSYPVIGCLVAFYRNRRRL 35272
35271 LDWYTEMLAASPSQTIVVDRLGARRTVVTANPANVEHILRARFANYPKGKPFTDVLGDLL 35092
35091 GMGIFNVDGELWHAQRKLVSHEFSARALRDLEVTVLEAEARDRLVPALAAASRGGGVVDM 34912
34911 QDVLRRFAFDVICRVSLGVDPGCLDPALPAPRLAAAFDTAAGIIARRGAAPVAAVWKVKR 34732
34731 ALDAGSERRLREEVGVIHEAVMGLIRSRRKERALLLVNGNGVGGGGGARSDLLSRMIECG 34552
34551 YPDEAIRDMVISFIMAGRDTTSSALTWFFWLLMRHRGVEAQVLDEIAATRRARGAGEEGG 34372
34371 DDGEGEGLDLDDYRRMRVLHAALCETMRLYPPVAWDSKHAAADDVLPDGTAVGRGDRVTY 34192
34191 FQYGMGRMEAIWGADAADFSLDRWLSLPRGGGDGAAAASPAAAAFAGVSPFKYPVFQG 34018
34017 GPRTCLGKEMAFVQMKFVASAVLRRFELRPVDEGRTPAFVPLMTAHMAGGLNVTVRRRTP 33838
33837 APATSTAANGTGGELTSS 33784

>AL731873.1 $F CYP94B5 chr 12 
173670 MDLESCSYVLPLLTCCLFLLYSITCYALAAAAGGGGSCGGSDDHAA
173808 PRSYPLVGCLLDFYRNRRRLLAWYTGLLAASPSQTIVVDRLGARRTVVTANPVNVEHVLR 173987
173988 ANFGNYPKGKAFTDVLGDLLGGGIFNADGERWFAQRKLVSHEFSARVMREAVGVALEREA 174167
174168 RARLLPALDAAAEGGGGVVVVDVQELLRQFAFNVICRVALGGGGGEVALALPLSRLAAAF 174347
174348 DAAAAISARRGAAPVAAAWKVKRALGVGSERRLREEVKVIRDAIMEFVRDSSSRRRREQL 174527
174528 LAAARGRDDLVSRMAAAGYPDEAICDMVVSFIMAGRDTTSSALTWFFWLMTRHRDVEREV 174707
174708 LDEVDACMGDGGDGGGLAGVDLEGSRRARVLHAALCETMRLYPPVAWDSKHAAEDDVLPD 174887
174888 GTRVGRGDRVTYFPYGMGRMEAIWGADAGEFRPGRWLAAAAAGGGVSPFKYPVFQGGPRT 175067
175068 CLGKDMAFVQMKFVASAVLRRFELRPVAPEGSPEFVPLLTAHMAGGLKVTVRRRQRQNGTCET* 175259

>AC116949.3 $F CYP94C2 chromosome 11 NO INTRONS
73586 MEMELPWGARCAGLAFFAFSVCLAALGVVLLVARRWPWCSCHVCRAYLTGSWAREFTNLG 73407
73406 DWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRTRFDNFPKGRPFAALLGDLLGDGI 73227
73226 FNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEVEARLMPVLADAADRGAVLD 73062
LQDVFRRFAFDXIC
KISFGLDPGCLDREMPVSELADAFDAASRLSAMRGAAASPLLWRAKRFLNVGSERELRKA
IKVVDE
LAAAMIRERQKLGVGSSHDLLSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDT
VSTALTTLFMLLSKNPEVAAAMRAEAEAGDGGETGAAITYEHLKGLHYTHAVLHENMRL
FPPVQFDSKFCAAADVLPDGTYVGGDARVMYHPYAMGRMPHIWGADYAAFRPARWLTGPG
ASFVPANPYKYPVFQAGQRVCLGKELAVTEMKAASVAVVRAFDVEVVGENGRSGGAAAAP
RFVPGLTASISGGLQVRVRRRVHT* 72048

>AP003289 $F CYP94C3 55% to 94C1 CDS complement(91864..93438)
MGVVEAEALHGAVEALAGSLQPHVATAFFVFSACTVALAALLAV
VRLRPPWWCDCTVCEAFLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANP
VTVDHVLRARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRA
FAARVVASELRCRLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLEL
SMPVSTLVEAFDTASTLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEV
IRQRRKLGGAATGSDLLSRFMGSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSD
HPEVATAIRDEVARVTGDGNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAA
GDDTLPDGTVVAKGTRVTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYP
VFQAGVRVCIGKELALMEMKAVIVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGLPV
RVRRRRARASGHNPPI

>aaaa01003818.1 $FI CYP94C4 (indica cultivar-group) 86% to AP003289 $F 94C3 
17250 MGADATTLHIAVHALASSLQAQVAAVFFVSAACTVALALLLALLRLRPPWWCACPVCEAYVTA 17438
17439 SWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLRCRFDNYPKGAPFSA 17618
17619 ILADFLGRGIFNVDGDGWLFQRKLAAAELASPAIRAFAANVVASELRCRLIPLLRSASSY 17798
17799 GSERLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFDTASMLSARRATVPM 17978
17979 HVVWKLKRLLNIGEERELRDAIRLVDALAAEVIRQRRKLGSAASGDDLLSRFM
18138 GSINDDKYLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRDEVFRVAGGRDPTA 18317
18318 ASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGTRVTYHAYAM 18497
18498 GRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCIGKDLAIMEMKAVIVAV 18677
18678 VLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRRAHCAPS* 18809

>AC123527.1 CYP94D4
7571 MEFYAYSMLLILPLILYMSYHLTRTLAEKKPTTHGLKAHPLLGHLPAFVRNSHRFLD 7401
7400 WSTELIAGSPEMRIGLWIPGMRSGIVTGNPADVEHILRTNFANYPKGQHAIGMLEDFLGH 7221
7220 GLFNSDGEQWLWQRKNASYEFSKRSLRKFVVDVVQAEVANRLLPLLRRAAGDGVGGDAV 7044
7043 VLDLQDVLQRFGFDTICMVAFGHDPRCLADGGVLEEAKSEFMHNFGEALDLVIGRFMDPI 6864
6863 EVSWKIKKWLNIGTERRLKKAIADVHAFAMDIVRARRQSASVKDRDDVLSRFVASDEYRD 6684
6683 EVLRDIVLSFLVAGRETTSSGLTWFFWLLSSRPDVVARIADEVRAVRKATGTRPGEPFGF 6504
6503 DTLREMHYLHAALTESMRLYPPVPTDPQSCAADDTLPDGTFVRAGWFVNYSAYAMGRLAA 6324
6323 IWGEDCMEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQMKSIVANVLEEL 6144
6143 VVDVVKEVAGGGAPEHVFSISLRMKGGLPVKIRRKGECV* 6024

>AC123528.1 $F CYP94D5 chr 11 orth of AAAA0100965.1d 99% except N-term
124027 MDTYYYSMLFVLPPILYMSYHLTRILADKKKPTTHGLKAHPLLGHLPAFVNNSHRFLD 124200
124201 WTTELIVGSPEMRMGFWIPGMRTGIITGNPADVEHILRTNFANYPKGEHAIGMLEDFLGH 124380
124381 GLFNSDGEQWLWQRKNASYEFSNRSLRRFVVDVVQAEIADRFLPLLRRAAGDGGGDGDVV 124560
124561 VLDLQEVLQRFGFDTICMVAFGHDPRCLADGGVMEDARSEFMHTFGEAQDLVVGRFFDPI 124740
124741 EVSWKIKKWLNVDTERRLRKAIADVHAFAMDIVRARRQSASVNDRDDVLSRFVASDEHSD 124920
124921 EVLRDIVLSFLIAGRETTASGLSWFFWFLSSRPDVVARIADEVRAVREATGTRPGEPFRF 125100
125101 DALREMHYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSVTYSAYAMGRLAA 125280
125281 IWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQMKSIVANVLEEF 125460
125461 EVDVVKDVAGGGVPEHVLSVTLRMKGGLPVKIRRKTEAY* 125580

>AP003232.1a $F CYP94D6 chromosome 1 clone P0034E02 
43934 MGTELSLTSSVPLLLLLLFPLLCFLCLRHGSTRKQPRADGLKAYPIVGILPHFVRNQHRL 43755
43754 LEWSAGVVARCPTHTMSFNFKGFGLIAGAITGNPANVEHIVKTNFQNYSKGEYVVSVMED 43575
43574 FLGHGIFNSDGDQWLWQRKAASYEFNKRSLRNFVVDTVRSEVVDRLLPLLTRAERDGRTL 43395
43394 DEQDVLERFAFDNVCCVAFDEDPACLTEEGMGTNARTEFLRAFNDAQNILMARFMSPVEW 43215
43214 AWRAKRLLDLEPERRMREALATIHGYADRIVRERRERGAAGLARKDDFLSRFAATGKHSD 43035
43034 ESLRDVX 43017 
43014 TNFVLAGRDTTSSALTWFFWLVSGQPDVEDRIAREIRAVRASSGSTDAAAFSFDELREMH 42835
42834 YLHAAITEAMRLYPPVAMDSHCCQNDDVLPDGTFVGKGWQVTYSAYAMARLEELWGADCE 42655
42654 EFRPERWLDEDGVFRPESPFKYPVFHGGPRMCLGKEMAYIQMKSIAACVFERFSFRFVG 42478
42477 GEGRPGLVFSVTLRMEGGLPMRVKKRRDSVC* 42382

>AP003232.1b $F CYP94D7 chromosome 1 clone P0034E02 
60720 MELSSTSASLLLILLLTLVYFLYLHQDPKKKPRTHGLKSYPVVGTLPHFINNKDRF 60553
60552 LEWSTGVMKRSPTHTMSFKELGLTGGVITANPANVEHILKANFGNYPKGELAVSLLEDFL 60373
60372 GHGIFNSDGEQWLWQRKAASYEFNKRSLRNFVVDTVRFEVVERLLPLLEYAGRHGRTLDV 60193
60192 QDVLERFAFDNICRVAFDEDPACLTEESMAAPQSAEFMRAFNDAQNAILDRFNSPAKSLW 60013
60012 RIKKLFNMEPERRMRDSLATIHGYAERIVRERRERREARLERRDDFLSRFAASGEHSDES 59833
59832 LRDVVTNFILAGRDTTSSALTWFFWLLSGRPDVEDKIVREIRAVRQSSAGSEGTRGATFS 59653
59652 LDELRDMQYLHAAITESMRLYPPVPFDTHSCKEEEFLPDGTFAGKGWLVTYCAYAMGRVE 59473
59472 DIWGADCEEFRPERWLDEAGAFRPESTFKYPVFHAGPRMCLGKEMAYIQMKSIVACVLEQ 59293
59292 FSLRYAGDAKGHPGLVVALTLRMEGGLPMKVTIRE* 59185

>AP003232.1c $P CYP94D8P chromosome 1 clone P0034E02 pseudogene fragments 
67707 FT*VFNDAQNTIVSRFLS*VKSL*RFKRLFNMEPKRQMWEALAR 67576
67575 HDPATPSGSFSKHNN*SLREVVTSFLLA 67492
67313 TFVGKGWLVIYYAYAMRYVEDIRGSDCEEFRLEQWMNKAGVF*PKSSFK 67167
67164 FEYPIFYIGQRMCLGKEMTYIHGFGFTALEKLMQRVA 67054

>AP003232.1d $F CYP94D9 chromosome 1 clone P0034E02 48% to 94D2
76378 MELSSISASLLLILPLLPLLYFLYLHQDPKKQPRAHGLKSYPVVGTLPHFIKHKNHI 76208
76207 LEWSAGVLKRSPMHTMSFKALGLTGGVFTANPANVEHMLKTNFGNYVKGEAIITMLEDFL 76028
76027 GRGIFNSDGEKWLWQRKATSYEFSKRTLRNFVVDTVQFEVIERLLPLLERAGRDGRTLDV 75848
75847 QSVLERFAFDNICRVVFDEDPACLAKDSVASPHIAEFMGACNDAQNAILARFNSPIKSLW 75668
75667 RVKRLFNIESERRLREALATIHAYTDRIIRERRERGEARGDDFLSRFAAGDKHSDES 75497
75496 LHDVITNLVLAGRETTASALTWFFWLVSGRPDVEDNIVREIRAVRRASSSNGVTSGAAFS 75317
75316 PHELRDMHYLHAAITESMRLYPPVSLDTYVCKEEDFLPDGTFVGKGWQVTYCAYAMARVE 75137
75136 DIWGTDCEEFRPERWLDEAGVFRPESSFKYPVFHGGPRMCLGKEIAYIQMKSIVSCVFDR 74957
74956 FTLRYTGGEGHPGLVTSLALRMEGGLPMQVLLTNRGQAVSC* 74831 

>AP003232.1e $F CYP94D10 chromosome 1 clone P0034E02 51% to 94D1 4 diffs with BE230752
3 diffs with AQ509587 78% to AZ135305
81213 MELSPISASLLLILILLAFLPLLYFLYMHQDPKKKPRIHGLKSYPVVGTLPHIIKNK 81043
81042 HRFLKWSTSIMKCSPTNTMSYKALGLTGGVITANPANVEHILKTNFDNYPKGKLTVSML 80866
80865 EDFLGHGIFNSDGEQWLWQRKAASYEFNKRSLRNFVVDTVRFEIVKRLLPLLEQAGLDGR 80686
80685 TLDLQDVLERFAFDNICLVAFGEDPACLTKERMAAPQSAEFMRAFNDAQNAILARFNSPA 80506
80505 KSLWRVKKLFNMEPERRMREALATIHGFAERIVRERRERGEAGLARGDDFLSRFAASGEH 80326
80325 SDESLRDVVTNFVLAGRDTTSSALTWFFWIVSGRPDVEDRVVREIRAVRASSGSTDATF 80149
80148 SFDELREKHYLHAAITESMRLYPPVAIDTHSCKEDDFLPDGTFVGKGWL 80002
80001 VMYSAYAMGRMEGIWGADCEEYRPERWLDEAGAFRPESTFKYPVFNAGPRICIGKE 79834
79833 MAYIQMKSIVACVLEKFSLRYAS 79765
      DANERPRSVLSLTLRMKWGLPMKVTIRK* 79678

>AP003232.1f $F CYP94D11 chromosome 1 clone P0034E02 
86279 MKFSSTSTPLFILLLPFLPLLYFLYLYQDTKKQPAGSNGLKSYPVVGTLPHFAKNRHRFLEWST 86088
86087 DVMKRSPTHTMTFKALGLTGGVITANVANVEHILKTNFSNYPKGELSVSLLEDLLGHGIF 85908
85907 NSDGEQWLWQRKAASYEFNQRSLRSFVVDTVRFEVVERLLPLLEWARRDGRTLDVQDVLE 85728
85727 RFAFDNICHVVFHEDPACLAEDSMVSSQSAEFIRACSDAQNAIIARFMSPVKSLWRVKRL 85548
85547 FNLDPERRMRDALTTIHGYADRIVRERRARGEAGLARSDDFLSRFAAGGEHSDESLRDVV 85368
85367 TNFLIAGRDSTSSALTWFFWLVSSRPDVEDKIVHEIRAVRSASSSGGTSSATFSFDELRD 85188
85187 MHYLHAAITESMRLYPPVHLDTHSCKEDDFLPDGTFVGKGWLVTYCAYAMGRVEDIWGAD 85008
85007 CEEFRPERWLDEAGAFRPDSPFKYPIFHAGPRMCLGKEMAYIQMKSIVACVLEQFSLRYA 84828
84827 GGDGHPGFVLWSTLRMEGGLPMQVTTRE* 84741

>AP003232.1g $F CYP94D12 chromosome 1 clone P0034E02 
AZ135305.1 OSJNBb0115G10r CUGI Rice BAC genomic 53% to 94D2
AZ131112.1 OSJNBb0104L22f CUGI Rice BAC genomic 
91065 MEFSSSSTSLFLLLSILPLLYFLCQRHDPKKQPHAHGLKSYPVVGTLPHFAKNKDRF 90895
90894 LEFITEIMKRSPTHTLSFKALGLTGGVITANPANVEYTLKTNFGNYPKGELAVSMLVDFL 90715
90714 GHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVERLLPLLERAERDGRTLDV 90535
90534 QDVLERFAFDNICHVAFDEDPACLAEDSMASPQSAKFMRAFSDAQNAVMDRFMSPVKSRW 90355
90354 RFKRLFNMEPERQMREALATIHGFAERIVRERRERGEAGLARSDDFLSRFAASGDHSDES 90175
90174 LRDVVTNFLIAGRDTTSTALTWFFWLLSGRPDVEDKIVREIHAVRRASGGTGDPTFNLDE 89995
89994 LRDMQYLHAAITESMRLYPPVAMDSHSCKEDDFLPDGTFVGKGWFVSYSAYAMARVEDIW 89815
89814 GADCEEFRPERWLDEAGAFRPESPFKYPVFHAGPRMCLGKEMAYIQMKSIVASVLERFSL 89635
89634 RYAGGEGHPGFVLWLTLRMKGGLPMQVTTRG* 89539

>AP003232.1h $F CYP94D13 chromosome 1 clone P0034E02 one in frame stop 53% to 94D2
100994 MEFSSSSTSLFLLLSILPLLYFLCQRNDPKKQPHAHGLKSYPVVGIVPHFTKNNDRF 100824
100823 LEFTTEIMKRSPTQTMSFKALGLTGGGVITANPANVEYTLKTNFGNYPKGELAVSMVVDF 100644
100643 LGHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVERLLPLLERAERDGRTLD 100464
100463 VQDVLERFAFDNICQVAFDEDPACLAEDSMASPQSAEFMRAFNDAQIAVRDRFMSPVKSL 100284
100283 WRFKRLFNMEPERRMREALATIHGFAERIVRERRERGKAGLARSDDFLSRFAASGEHSDE 100104
100103 SLRDVVTNFLLAGRDTTSSALTWFFWVLSGRPDVEDKIVREIHAVRRASGSTSDATFSFD 99924
99923  ELRDMQYLHAAITESMRLYPPVAMDTHSCKEDDFLPDGTFVGKGWLVTY*AYAMARVEDI 99744
99743  WGADCEEFRPERWLDEVGAFRPESPFKYPVFHAGPRMCLGKEMADIQMKSIVASVLERFS 99564
99563  LQYAGGEGHPGLVLSVTLRMKGGLPMQVATRG* 99465

>aaaa01017255.1 $PI CYP94D14P (indica cultivar-group) 81% to AP003232.1 
2147 MELSSTSTSLFFILIPFLPLLYFLYLH frameshift
     LDPRKQPHAHGLKSYPVVGTLPHFVKNRDRFLEWSTG 2342
2343 VMKRSPTHTISFKGLGLTAGAITANPANVEH 
     VLKTNFDNYPREGL 2479
2480 ISLAEDFLGRGIFSSDGEQWLWQRKAASYEFNKRSLRNF 2596 
     VVDSVRFEVVERLLPLLEQAAGRDGRTLDVQDVL 2699
2700 ERFAFDNICRVAFDEDPACLTEESMATPQSAEFMRAFND 
2817 AQNTILSRFLSPAKSLWRAKRLFNMEPERRMREAINTVHTYTERIVRERREREEAGLARR 2996
2997 DDFLSRFAAGGEHSDESLRDVVTNFLMAGRDSTSSALTWFFWLLSDRP 3140
3141 DVEGKIVHEIRAVRSASISGGMGSTTFSLDELRDMHYLHAAITESMRLYPPVPINARTC 3317
3318 KEEDSLPDGTFVGKGWHVTYCAYAMGRMEDIWGADCEEFRPERWLD 3455
     EAGVFRPESPFKYPI 
     FHAGPRMCIGKEMPYIQMKSIVAXXXXXXX 
     LRYAREEGHPGLVLSLTLRMEAGLPMKVTSRE*

>AC105364.1 $F CYP94D15 chromosome 3 clone OJ1743A09, Length = 145936
53% to 94D2
53146 MAAILLLLLVFLVSVALVVRTWSASRRSHEKARYATAELRPY
53273 PLVGHLPQFLANRHRILDWMTEVLSRQPTRTFVLRRPGGVRGVITANPANVERF 53434
53435 LRSGFDNYPKGERFASLLHDFLGRGIFNADGEAWRSQRKAASYEFNTRSLRAFVARCVHG 53614
53615 ELHGRLLPLLRRAAAEGRAIDLQDALERFAFDNICRVAFDHDPGQLPDASGGGALAEADD 53794
53795 GSTASGRFADAFRDAANLSAGRFRYAVPWFWRVKKALHIGSERRLRESIAIVHDFADRII 53974
53975 RSRREEIRAGLEKHDLLSRFMASHDESYTEVALRDVVISFLLAGRETTSSALTWFFW 54145
54146 LLSSRPDVERRIREEVATVRARRGDGDVDRVGFDLDELREMQYVHAAITESMRLYPP 54316
54317 VPVDSLHAQEDDVLPDGTAVEAGWFVAYNSYAMGRMESVWGKDAAEFRAERWLEDAAAAT 54496
54497 FRPESPFRYVSFHGGPRVCLGKEMAYIQMKSIIACVLQELELAVDGAYRPRQVTSLTLRM 54676
54677 ADGLPTRVKVRGN* 54718

>aaaa01000851.1 CYP94D16P (indica cultivar-group) 84% to AC074282.1 $P
29298 SFSEAQDLVVGCFFD
29253 LIEVKKWLNVGTEYCLRKAITDVHAFAMDIVRARHQSSSVQDRDDVLSRFAASDEHND 29080
29079 EVLRDIVLSFLIAGRETTSSGLSWFFWLLSSQPDVMACITNEVRVVRKATGT 28924
28923 CPDEPFGFDALREA 
28880 QACAADDTLPDGTLVHADWFVTYNAYAMGRLAAIWGEDCLEYRPERWLSEDGVFQPANP 28704

>aaaa01045877.1 $PI CYP94D17P (indica cultivar-group) 84% to AP003232.1f
1102 KIVHEIHAVRSASISXGMGSTTFSLDELRDMHYLHAAITESMRLYPPVPINARTCKE 932
931  EDSLPDGTFVGKGWHVTYCAYAMGRMEDIWGADCDEFRPERWLGEAGVFRPESPFKYPI
750 FHAGPRMCIGKEMAYIQMKSIVAS 679 
LRYAREEGHPGLVLSLTLLMEAGLPMKVTSRE* 584

>AP005092.1 CYP94D18P (japonica cultivar-group) chr 9 
46190 LDLQDVLQRFGFHTICMVAFGHDLPCLADGGVMEDARSDFMHSFGEAQNLVVGRFFDLIE 46011
46010 VSWKIKKWLNVGTIRRLRKAIADVHTFAMDIVRARRQSASVQDRDDVLSRFVASDEHSDE 45831
45830 VLRDIVLSFLIVGRDTTASGLSWFFCLLSSRPDVVARIADEVRAVRKPTDTRLGEPFRFD 45651
45650 ALWEMHYLHAALTESMRLYP
45568 DDTLPDGTLVRAGWSVTYSAYAIERG 45491
45495 EDCLEYRPERWLGEDGVFQPASQRK

>AC074282.1 $P CYP94D19P chromosome 10 clone OSJNBa0049K09 93 unordered pieces 48% TO 
183681 VRCFIFIKQAQRRHLVPPEEGHRQRHAFAMDIIRARRQSASVQDRDDVLSRFVASDKHNE 183860
183861 *VLRDIVLIFLIAGCETRSSGLSWFFWLLSSQPDVMARIADVVHVVRKATGACPSEL 184031
184032 FGFDALREMHYLHAVLMESMRLYPP 184106 
184111 QACAADDTLPDGTLVHAGWSVTYNAYAMGRLAAIWGEDCLEYKPER*LGEDGVFQPASPRK 184293

>AC090870.8 $P CYP94D20P chromosome 10 clone OSJNBb0015K05 
104876 KVMKRSPTHTMSFKALGLTGGVITANPANVEYTLKTNFGNYPKGELAVSMLVDFLGHGIF 105055
105056 NSDGEQWLWQQKAASYKFNKRSLRNFVVDTVRFEVVERLLPLLERAERDGRMLDVQDVLE 105235
105236 CFAFDNICHVAFDEDPACLA 105295 frameshift
105297 EESMASPQSAEFMRAFNDAQNAVMDRFMSPVKSRWCFKRLFNMEPERRLQEVLATIHGFA 105476
105477 ERIVGERRERVVAGLARSDDFLLRFAASGEHSNESLRDVVTNFLLVGHDTTSSALTWFLC 105656
105657 RPVVEKREEKE 105689

>AP004239.1 $P CYP94D21P chr 6 clone OJ1115_C07 90% identical to I-helix region of 
136094 (aa309) SSALTWFFWILSGRPDVEKR aa336 136153

>AP003735.2a $F CYP94E1 chromosome 1, BAC clone:B1147A04, complete 39% to 94A2 43% to 
4872 MYMQMDSSYLHLVLPAAAAAVVVAVVLLLSLWRRCQ
4981 TTSNHRPQANPILGNLVAFLANGHRFLDWSTGLLAAAPASTMQVHGPLGLGYCGVATASP 5160
5161 DAVEHMLRASFHNYVDKGDRVRDAFADLLGDGLFLANGRLWRLQRKLAASSFSPRLLRLF 5340
5341 AGRVVLDQLRRRLLLFFDAAADARRVFDLQDVLKRFAFDNICSVAFGVDRDDSSPSSSSP 5520
5521 SRLEAGGDGRDDAFFAAFDDAIDISFGRILHPTTLAWKAMKLLDVGSERRLRQAIGVVDE 5700
5701 YVTAIMESKQRCSDSEEESDLLSRFTAAMMEEDGGNELGAMFDSPEAKRRFLRD 5862
5863 TVKTFVLAGKDTTSSALTWLFWFLAANPECERRVYEEVTALRGDTAGDERDDGYEELKRM 6042
6043 HYLHAAITETMRLYPPVPLASRVAAADDVLPDGTVVRAGWFADYSSYAMGRMPQLWERDC 6222
6223 GEFRPERWLDGGGGGGGRFVAVDAARYPVFHAGPRSCLGKEMAYVQMKAVAAAVVRRFSV 6402
6403 EVVPAAAANAPPSPPPHETAVTLRMKGGLRVLLTRRRGVLSHA* 6534 

>AP003735.2b $F CYP94E2 genomic DNA, chromosome 1, BAC clone:B1147A04, complete 
8263 MDGTLAPLLLLLLLFLPALLLYLRRRPAAASRINNNHCPHPNPVLGNALPFLRNRHRFLDW 8445
8446 ATDLLAAAPTSTIEVRGALGLGSGVATANPAVVDHFLRASFPNYVKGARFAVPFEDLLGR 8625
8626 GLFAADGRLWALQRKLASYSFSSRSLRRFSARVLRAHLHRRLVPLLDAAAGSGEAVDLQD 8805
8806 VLGRFGFDNICNVAFGVESSTLLEGGDRRHEAFFAAFDAAVEISVARVFHPTTLVWRAMR 8985
8986 LANVGSERRMRDAIRVIDEYVMAIVASEERLRLRRGEDEREHEQHLLSRFAASMEEEGGE 9165
9166 LAAMFGSPGAKRRFLRDVVVSFVMAGKDSTSSALTWLFWLLAANPRCERRVHEEVSSSRH 9345
9346 ADPRRADAGEDGHGDGYDELRRMHYLHAAISEAMRLYPPVPIDSRVAVAADALPDGTAVR 9525
9526 AGWFADYSAYAMGRMPQLWGEDCREFRPERWLSDGGEFVAVDAARYPVFHAGPRAC 9693
9694 LGREMAYVQMKAVAAAVIRRFAVEPVQAPASMETPPACEVTTTLKMKGGLLVRIRKR 9864
     EDDAAQQKLT* 9897

>aaaa01014899.1 $FI CYP94E3 (indica cultivar-group) 
223 MVTTHLAYVLLFLVTAVLLFHLRRGG
    RSAPAKLTTAHRPHPNPVLGNTVEFIRNRRRFFDWYTDLLRASPS
    GAIEAWGPFGAGHAVTTACPAAVEHLLRGNFGNYVRGASFRAAMSELIGDG
589 LFAADGRLWSVQRKVASYAFSSRALRRFSDDVLAVHLRGGLLPFLDAAAASGEAVD 756
757 LQDALRRFAFDSICHVAFGVESSTLIETAREDSGRHEALFAAFDAAVEISFRRALAPFTL 936
937 VRKLTGLVNVGSSRRLREAIGVIDDYAMSVVESKEAACRDRDSEDVDPDLLSRFMAA 1107
1108 MDEEDGGELGAMFPTPEGKRRLLRDVVVSFVLAGKDTTSSALTWLFWLLAANPRCERRVR 1287
1288 DEVSRSPDGDGGGDAKGMHTHYLHAAITEAMRLYPPVPFNGRVAVGDDVLPG 1443
1444 GAAVRAGWFANYSAYAMGRMERLWGEGCLQFSPERWLRDGGEFVAVDAARYPVFHAGPRA 1623
1624 CLGKEMAYVQMKTVAAAVLRRFSVEVAAPAPAMESPPAYEMTATMKMKGGLWVRLRKRE* 1803

>aaaa01014014.1 $FI CYP96B2 (indica cultivar-group) 74% to AAAA01014333.1 
3501 MAFSSILQLTLCFLCFSVFYYYHIKSKRKNPAIPVCWPLVGMLPDLLVNRHQLHDWITSF 3322
3321 LTASQLNFRFIGPTMSSNMRFFFTCDPANVRHIFTSNFANYPKGPDFAEIFDDTLGDGIF 3142
3141 NVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSDKVENALLPLLSHFAGTGERCNLQDVFM 2962
2961 RLTFDMSTMLASGEDPGCLAISLPMPKVPFVRAVDYTTRV 2842
2841 LLVRHIIPLSLWKLARRLGVGFERKMAEALRTINQFIYETIVKRRAKKATE 2689
2688 GIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDTIGSALSWFFYLLTKNP 2527
2526 HVASKILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVA 2347
2346 ADVMPSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISDHGKLRYVPSYKFTPF 2167
2166 ITGPRTCLGKDMALVQLKVVAATVVKNFEAEAVPGHIVEPKLSMVLHMKNGLMVRVKRR* 1987

#339
>aaaa01014333.1 $FI CYP96B3 (indica cultivar-group) 74% to AAAA01014014.1 47% to 96A10
4957 MAVSSFSFLELLLSFLCFGFFYYYHVKSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSVLTVT 4760
4759 PLNFRFIGPPSSDMRLFITSDPANIRHVFNTNFSNYPKGREFQEIFDILGDGIFSADG 4586
4585 ESWRRQRTKAQMLMSSPRFRAFVARYSRDKVEK 
4358 ALLPLLAHVAGTGDACNLQDVFLRLTFDTTTTLVFGVDPGSVAIDLPEVPFARAMDDA 4185
4184 MTVLLLRHIVPLSWWRLARRLGIGYERKMPVAWRTMDRFVADTIAKRRAEKARTGIDDSA 4005
4004 DLLSSYINDDEEDAGTVDAFLRDTTINLMLAGRDTTGSALSWFFYLLTKNPRVLHKLLQE 3825
3824 LDSVKSTTTADGMVIFDPDETGRLVYLHAALCESLRLYPPVPMEHKGPAAADVLPSGHE 3648
3647 VRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISDDGKLRYVPSYKFMSFNSGPRTCLG 3468
3467 KDMAFVQLKTAAAAVMKNFEIEAVAGHVVEPKLSIILHMKNGFMVTVKRRLAVC* 3303

>aaaa01003917.1 $FI CYP96B4 (indica cultivar-group) ORTHOLOG OF D39760 43% to 96A1
8147 MNLFDLFFVLQLLLSGVCVLVICYRYQRLKSMKKCSLGVVQWPIVGVLPAIVANMHRLLDGVTFLLAT 8350
8351 SQLNFQCRFWLAGFRFFVTCDPDNVRHIFTSNFDNYPKGDVFADMFDVLGGGIFNTDGER 8530
8531 WRRQRNKAQMLMTTPRFRAFVARSSLDKVEKGLLPFLAHVADARKTCDLQDVFTRWSLDA 8710
8711 TCHLVFGVDPGCLDIGLPEVPFARAMDDVLRTIFLRHTMPVSFWKTMRWLGIGHEKRNAA 8890
8891 ARRTVESFVASAIAKHRADDESKSRQGGGGGGDKQSVADLLSSFLCDDEIAGSADADVYI 9070
9071 RDMAMNLLVAGRDTTSSALSWFFYLLSTNPRVEQKLLQELAPIASRKPQLQQGRLFPGNG 9250
9251 GMVTFDASEVRNLLYLHAALCEAMRLYPPVPLEHKAAVADDVLPSGHEVMAGDKVLVFYY 9430
9431 SMGRMKRVWGKDCREFRPERWITEDGKLRYVPSNKFVAFNSGPRTCLGKEMALVQMKVTA 9610
9611 AAMAWNFAVEVVPGHVVEPRLSVILHMKNGLLVRVKRREPVMNT* 9745

>AC137697.2 CYP96B5 Oryza sativa, Nipponbare strain, clone
132436 MDMLLCFVEIFSILCCCIIYYYHLQTKKASASEPTEWPVLGHLFGMFANIHRFHDWATDI 132257
132256 LAGGWHNFEARAGLTGIRFFITCDPSNVRHIFTSNFANYPKGDEYAEIFDVLGNGIFNAD 132077
132076 GESWRSQRAKAQMLMAGARFRAFAARSSRDKAEKSLLPLLAHAADTGARCDLHDLFLRLT 131897
131896 FDVTCTLVFGVDTGCLSAGLPVIPFARAMDDVLETLFLRHIIPMSCWKLMYRLEVGTERK 131717
131716 MAVARRTIDRFVAETIAKRRADMIRQGTSNSDDLLSSFISHDDDDTSNGNDVVDETDEFL 131537
131536 RDTTVNLLLAGRDTTGAALSWFFYILSKNPRVEQKLLEELAPIAAQKGGDGGGMVIFDAS 131357
131356 ELKNLVYLQAALSECLRLYPSVPFEHKAVAADDVLPSGHEMKAGDKVLVFSYSMGRMEGV 131177
131176 WGKDCTEFLPERWITSEGKLRYEPSYKFFSFNAGPRTCLGKELAFVQLKTVAAAVMWNFA 130997
130996 VEVVPGHAVEPKLSIILHMKNGLAVTVKRRATMASC*

>AC118132.1 $F CYP96B6 chromosome 10 39% to 96A10
137194 MDKAMAFIPPRDLVVVLPFLALLLPLYIYLRYSRSAKANPSLPTEWPLVGMLPSLVANIH 137373
137374 NLFDYATALLAASGNSFEARGPPMSSLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFD 137553
137554 VMGDSFFNADGESWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPF 137733
137734 DLQRLLTRFAFDVTAMAVFGVDTCRLSIDMPPLDVANAMDAVMEVGFFRHTVPVSCWKLM 137913
137914 RSLRIGPERKLTAAQRLLRRFVAEMIEKRRVAGGACKATDDEQGGVPPPADIVSSYINDP 138093
138094 EYVDEDGNPREFMYATFINYMVAGRDTVGTALSWLFFNLTEHPRVVARIREELEPIASSK 138273
138274 AGGGGMVVFDPEETKPLVYLQAALFESMRLYPPGPIERKATLAEDVLPSGHTVRAGDNIL 138453
138454 IPVYSMGRMASVWGKDSGEYRPERWVTEDGKLRHVPAHRFMPFNA 138588 (fs)
138590 GPRLCLGKDISVLQMKSVAAA 138652
138653 VAWNFDLEVVAGHAVEPKVSMVMQIKNALMVKVKKR* 138763

>AP006064.3 CYP96B7 Download subject sequence spanning the HSP Oryza sativa (japonica 
4558 MMLLALVLYLCIGWPILSTLELPSIAANLHNLHDHLAGVLAASGHTVMARGTAATSSIRF 4737
4738 FITCDPENVRHIFTSNHGNYPKGHEFAEIFDIMAGVSFTLDGEPYLRLRAKMLSILGDPR 4917
4918 LVASMAASCLDKVRDGVLPFLARVATAGAPFDMQDLT 5028
5029 GRLMFDVTSMAVFGVHPGYLSPGPDMPPAHAAAAMDTVMEVGLIRH
     AVPASWWKSMRRLNIGPERRLAAAHRVLHGFVGEMMGARTKATQSPH 5310
5313 RRRRRLLQTTAIAYMVAGRDTIGTTLPWFFYNLAVNPRVVSGIREELKPIAASRRAAS 5486
5487 PSPSPSNGDRTTTVMFSPEDTKPLVYLQAALFETLRLYPPGHMERKTAVADDVMPSGHEV 5666
5667 RAGDA 5681 
5681 VLISLYSMGRMESLWG KDCREYRPERWLTGGDGGGSGGAQLRHVP 5824
5825 SHKFLAFNSGARMCPGKSIAVMLMKTIAAAVVWNFDVEMVEGQAVEPKMSCLFQMKNGLM 6004
6005 LKVKKRQI* 6031

>aaaa01022933.1 $FI CYP96B8 (indica cultivar-group) 96A like ortholog of D46472
1337 MASLTPSLQDL
1370 LVSSLMILLVLLYIAYWRSKYQSLFPVDWPIVGLLPTLVANLHRLHDKITEYLAASGHS 1546
1547 FTGNGPAASNMRLFVTCDPDNVRHIFTTNHDNYPKGHEFAEIFDIMAGAFFTMDGELYRR 1726
1727 QRAKTHSILSDPRMVASMASSCADKVRDGLLPLLTSMASTRTPFELQDLATRLMFDVTAM 1906
1907 PVFGVDPGRLSPDMPSMHVSAAMDTIMEVGLFRHTVPPSCWKAMRRLKIGPERKLAAAHA 2086
2087 ALHVFVSEMMEKARKQEAAPSSMSMDVLSSYINDPDYVG LLHSIL 2221
2222 ITYMVAGRDTVGTTLPWFFYNLAMNPRVVSGIREELAHNIATSTCNGDGAPVMFSPEDTK 2401
2402 SLVYLHAALFETLRLYPPGWIERKTVVADDVMPSGHEVRAGDAVLISIYSMGRMESLWGE 2581
2582 DCRVYRPERWLYDSRGGRKMRHVPSHKFLSFNSGPRMCPGKNIAVMQMKIIAAAVVWNFD 2761
2762 LEVVEGQAVVPKLSCLLQMKNGVMVKVKKRAV* 2860

>aaaa01028498.1 CYP96B9 (indica cultivar-group) 71% to AAAA01014333.1
506 MAFASILQLALCFLCFSIFSYNHIKSKRKNTAI
605 PVCWPLIGMLPDLLANRHRIHDWITSLLTASQLNFRFTGPPSSNMRLFITCDPAN 769
770 VRHVFTSNFSNYPKGPDFTEIFDIFG 847
847 XXXFNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFAATGESCNLQDVF 668
667 MRLTFDTTTMVVSGADTGCLAISLPEVAFARAMDDATRVLLVRHIVPLSWWKLVRRLGIG 488
487 YERTMAEALRACDHFVNETIEKRRAEKAKGEADGSADLLSSYINDDDEEENASSSFLRD 311
310 TTMNLISAGRDASAMALSWFFYLLTKNPCVVSKILEELDSVNGITTPDGMVTFDP 146
145 DELRPLVYLHAALSETLRLYPPVPLEHKGVLAADALPSGHDVRPGDKI 2
    VVSLFAMARMEAVWGSDCREFRPERWISKDGKLRYVPSYKFMTFS 622
621 SGPRTCLGKDMAFVQLKAVAAAVVKNFEIEAMPGHVVEPALSIVLHMKNGLMVRVKRR

>AP005697.3 CYP96B10             166423 bp    DNA     linear   PLN 22-OCT-2003
MASLTPSLQDLLVSSLMILLVLLYIAYWRSKYQSLFPVDWPIVG
LLPTLVANLHRLHDYLTDVLAASGHSFTAHGPAATNMRLFVTCEPDNVRHIFTTNHDN
YPKGQHFAEIFDILAGIPFTMDGELCRRQRAKTHSILSDPRMVASMQSSCVDKVRDGL
IPFLTSVASTQTPIELQDLATRLMFDVTAMPVFGVDPGCLSPDMPSKHVSAAMDTIME
VALFRHTVPPFCWKAMRRLKIGPERKLAAAHAALHVFVSEMVEKARTKQEEAAPTSMS
MDVISSYINDPDYNDLLHSKLISYMVAGRDTVGTTLPWFFYNLAMNPRVVSGIRDELA
PIATSTCNGDGAPVMFSPDDTKPLVYLQAALFETLRLYPPGAIERKTVAADDVMPSGH
EVHAGDAVLILVYSMGRMESLWGX 
DCREYRPERWLYDSGKMRHVPSHKFLAFNSGPRMC
PGKSIAVMQMKTIAAAVVWNFDVEVVDGQTVEPKLSCLLQMKNGVMVKVNKRAV*

>AP002484a  $F CYP96D1 join(76365..77485,77598..78009) 42% T0 96A5 new 96 subfamily
MGPLWTFILLYPEIFLAIICFFWFSLFRPIRQRQKSNLPVNWPV
FGMLPFLVQNLHYIHDKVADVLREAGCTFMVSGPWFLNMNFLITCDPATVNHCFNANF
KNYPKGSEFAEMFDILGDGLLVADSESWEYQRRMAMYIFAARTFRSFAMSTITRKTGS
VLLPYLDHMAKFGSEVELEGVFMRFSLDVTYSTVFAADLDCLSVSSPIPVFGQATKEA
EEAVLFRHVIPPSVWKLLRLLNVGTEKKLTNAKVVIDQFIYEEIAKRKAQASDGLQGD
ILSMYMKWSIHESAHKQKDERFLRDTAVGFIFAGKDLIAVTLTWFFYMMCKHPHVEAR
ILQELKGLQSSTWPGDLHVFEWDTLRSAIYLQAALLETLRLFPATPFEEKEALVDDVL
PNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEPSYKFLSFNT
GPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSSVILHTQNGMMVRLKRRD
AA*

>aaaa01011192.1 $FI CYP96D2 (indica cultivar-group) 38% to 86B2 
6837 MGGALLSFLLSYPEFILAAACFLAFAAIRRARDARRRAAPVPVSWPVVGMLPFVVAHLGRLLAA 7028
7029 AAAALPELGCTFMFRGPWLVGADFLVTCDPAVFRHCLVANFAGYDKGRDFAEMFDVVGDG 7208
7209 LLVADAASWAAKRHLAASVFTSAAFRGFVLSTVERQTRRLLVPFLDHAGGVVELEDV 7379
7380 FMRYSLDVSYTVAFAADLDSLSVASAAEPFPPFGEATRVTGEAVLLRHIAPAGWWKLMRW 7559
7560 LNVGVERRLADAKAVLDEFVYREIANRRSRPAPAVAGGDDLLCMYMASPIDPAM 7721
7722 SDQTLRDAAVGFMFAAKDLIAAALTWLFYMICTHPHVEAKILDELRSLHTTTTAGAVVFD 7901
7902 ADELRAATYLHAAVLETLRLYPSAPFEEKEAVGDDVLPGGTAVRKGTRVVFCLYAMGRVE 8081
8082 GIWGSDCREFRPERWLSTGDGDGGAGKVLQEPSYKFAAFNAGPRSCLGKDLGLSNIKIAA 8261
8262 AAIVYNFTVELVAGHVVEPKDSVVLHTKNGLMVRVKRRETA* 8387

>AP002484b $F CYP96E1 CDS  80463..81980 43% to 96A1
MELLPWLLGFVVKYPEIMASAACFLLLFCRFRRRSKRIPTNWPV
VGALPAIVANAGRVHDWVTEFLRAAAMSHVVEGPWGSPGDVLITADPANVAHMFTANF
GNYPKGEEFAAMFDVLGGGIFNADGESWSFQRRKAHALLSDARFRAAVAASTSRKLGG
GLVPLLDGVAASGAAVDLQDVFMRLTFDLTAMFVFGVDPGCLAADFPTVPFAAAMDDA
EEVLFYRHVAPVPWLRLQSYLKIGHYKKMAKAREVLDASIAELIALRRERKAADANAT
GDADLLTAYLACQDEIGMDGAAFDAFLRDTTLNLMVAGRDTTSSALTWFFWLLSNHPG
VEARILAELRAHPPSPTGAELKRLVYLHAALSESLRLYPPVPFEHKAAARPDTLPSGA
AVGPTRRVIVSLYSMGRMEAVWGKGCEEFRPERWLTPAGRFRHERSCKFAAFNVGPRT
CLGRDLAFAQMKAVVAAVVPRFRVAAAAAPPRPKLSIILHMRDGLKVKVHRRQED*

>AP004028.1 $F CYP97A4 chromosome 2 clone OJ1136_C12, same as AP004048 131962-137032 
91296 MAATSSAAAAAPPPCRLLGSGQAHLRLPPSAAAAAASARRRLLLRCAA
      SGGNGKGGGGDGSGSDPVLEERRRRRQAELAARIASGEFTAQGPA (2) 91018 
90920 WIAPLAVGLAKLGPPGELAAALLTKVAGGGGPEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPK (0) 
SFLIVSDPAIAKHILRDNSKAYSK 90537 (0) 
      GILAEILEFVMGTGLIPADGEIWRVRRRAIVPAMHQK 90339 (0) 
      YVTAMISLFGYASDRLCQKLDKAATDGED 90171
90170 VEMESLFSRLTLDVIGKAVFNYDFDSLSYDNGIVE (0
      AVYVTLREAEMRSTSPIPTWEIPIWKDISPRQKKVNEALALINKTLDELIDICK 89802 (0) 
89715 RLVEEEDLQFHEEYMNEQDPSILHFLLASGDD 89620 (0) 
89554 VSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSK 89438 (0 
      YPNVMAKLQDE (0) 
89160 ADTVLGDRLPTIEDVKKLKYTTRVINE (0) 
88998 SLRLYPQPPVLIRRSIEEDMLGGYPIGR 88915 (2) 
88254 GEDIFISVWNLHHCPKHWDGADVFNPERWPLDGPNPNETNQNFS 88117 (2
86884 YLPFGGGPRKCVGDMFATFE 86819 (0) 
86584 TVVATAMLVRRFDFQMAPGAPP 86519 (0) 
86441 VEMTTGATIHTTEGLKMTVTRRTKPPVIPNLEMKVISDSPENMSTTTS 86298
86297 MPVSAASIASGEDQQGQVSATRI* 86226 

>AK100596 CYP97B4     2093 bp    mRNA    linear   PLN 24-JUL-2003
MAITAATAAAAATPHPWQADASPRRHAACPALRGRRRLPVV
63  RCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWFLEHGSVYKLA 242
243 FGPKAFVVVSDPIVARHILRENAFCYDKGVLAEILKPIMGKGLIPADLDTWKQRRKVITP 422
423 GFHALFIDAMVGVFTKCSERTIFKLEELIERGEHGEKYTIVDLEAEFSNLALDIIGLGVF 602
603 NFDFDSVTKESPVIKAVYGTLFEAEHRSTFYIPYWNLPLTRWIVPRQRKFHSDLKVINDC 782
783 LDSLIKNAKETRQEADVEKLQQRDYSSLK 
    DASLLRFLVDMRGADVDDRQLRD 962
963 DLMTMLIAGHETTAAVLTWSVFLLAQNPSKMRKAQAEVDSVLSNETINVDQLKKLEYIRL 1142
1143IIVEALRLYPQPPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDR 1322
1323PDEFEPERFSVPKKDESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFA 1502
1503LLESTVALALLLQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRRT* 1649

>CYP97 from rose petals BQ106584
MGMGAYSLLNPSSPTLLNLSFQRSDFGYLHSSTTTHLPNSKLKRSSI RCQSTSTED
PKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVTDLFDRPLFFSLYDWFIEHG
SVYKLAFGPKAFVVVSDPIVARHILRENAFGYDKGVLADILEPIMGKGL

>AC025783.5a $F CYP97C2 chromosome 10 clone OSJNBa0001O14 1 ordered pieces Length = 
111679 MAAAAAAAVPCVPFLCPPPPPLVSPRLRRGHVRLRLRPPRSSGGGGGGGAGGDEPPITT
111856 SWVSPDWLTALSRSVATRLGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVY 112035
112036 RLAAGPRDLVVVSDPAVARHVLRGYGSRYEKGLVAEVSEFLFGSGFAIAEGALWT 
113153 VRRRSVVPSLHKRFLSVMVDRVFCKCAERLVEKLETSALSGKPVNMEARFSQMTLDVIGL 113332
113333 SLFNYNFDSLTSDSPVIDAVYTALKEAELRSTDLLPYWK 
113582 IDLLCKIVPRQIKAEKAVNIIRNTVEDLITKCKKIVD 113692
113693 AENEQIEGEEYVNEADPSILRFLLASREE 
114115 VTSVQLRDDLLSMLVAGHETTGSVLTWTIYLLSK 114216 
114327 DPAALRRAQAEVDRVLQGRLPRYEDLKELKYLMRCINESMRLYPHPP 114467 
114538 VLIRRAIVDDVLPGNYKIKAGQDIMISVYNIHRSPE 114645 
114955 VWDRADDFIPERFDLEGPVPNETNTEYR 115038 
115197 FIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELVPDQKINMTTGATIHTTNVSVPLSMLMTASRWH* 
115406

>CYP98A4 AC108505.1 $F chromosome 5 clone OJ2086B07, Length = 79991
72630 MDVASLLPFALALVAIPISLALLDRLRLGRIPPGPRPWPMVGNLWQIKPVRCRGFLEWAERYGPIVSVW 72836
72837 FGSSLNVVVSTSELAKEVLKENDQLLADRPRNRSTQRFSRNGMDLIWADYGPHYIKVRKL 73016
73017 CNLELFTPKRLEALRPIREDEVTAMVESVHRAVTQP (1) 73124
74708 GSEHKPIVVRNHLAMVAFNNITRLAF GKR FMNANGDIDEQGREFKTIV 74851
74852 NNGIKIGASLSVAEYIWYLRWLCPLNEELYKTHNERRDRLTKKIIDEHAKALKESGAKQ 75028
75029 HFVDALFTLREQYDLSDDTVIGLLW 75103 (0)
75681 DMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMSETDFQSLPYLNAVV 75860
75861 KESLRLHPPTPLMLPHKASTNVKIGGYNIPKGANVMVNVWAIARDPKVWSNPLEYRPERF 76040
76041 IEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHQFEWSLPEGTRPEDVNM 76220
76221 MESNGVVTFMSTSLQVIAKPRLDNPDLYKRFPVEM* 76328

>AC093612.17b $P CYP98A15P chromosome 10 clone OSJNBa0003P07, Cterminal seq from aa 
83358 GEEGKPMVMRKHLSMVAFNNITRLTFGKRFIDAAGELDEQGSELKAIVNNGIKIGASLTI 83537
83538 AEHIRVLRWLNPVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFVDAL 83696
83697 FTLRDKYDLSDDTVIGLLCDMIAAGTDTTVITVEWAMAELVRNPRVQMK 83843
83844 AQEELDRVIGRGRVMLEADIPNLPYLQAVVKESFRLHPPTPLMLPHKASTSVKIAGYD 84017
84018 VPKDASVVVNVWAVARDPGVWDNPLE*RPERFLEESIDI 84134
84135 KGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQFTWALQDGTRPEDLDMMESPGLV 84314
84315 TFMATPLQVVAMPRLDKEELFKRVPVDMS* 84404

>AC105377.3 $P CYP98A16P like 98A3 chromosome 10 clone OSJNBa0034E15 probable 
3339 MDTPALLPLALALVAIPITILLDLQSDPPRQAVPRAPGVAGGNLFDITLVRCRCFMEWAG 3160
3159 KYGPIMTVWLGTSPTIVVSTSELAREVFKNV 3067 
3065 NDQQLADRPRNHSAERLSRGGTDLIWADYGPHYVKVRKLCNLELFAPRRMEALRPIS 2895
2894 EDEVNAMVESIYRAVTAP 2841 (1)
969 GEEGKPIGVRKHLSMVAFNNITRLTFGKRFIVAAGELDEQGCEQKAIVKAGIKIGASLPI 790
789 AEHILVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFV 640 
641 FTLRDQYDLSDDTV 600 
598 VIGLLWDMIAAGSDTAVITAEWAMAELVRNPRVQMKAQEELDRVIGRGRVMLEADIPNLP 419
418 YLQAVVKESFRLHTPTPLMLPHKASA 341
341 RVKIAGYD 318 
317 VPKGANVIVNVWAVGRDLSVWDSPLP 240 
240 PLEYRPERFLEESIDIKGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQFTWALPD 61
60  GTWPEDLDMMESSGLVTFMA 1
25696 TPLQVVAMPRLDKEELFKRVPVDMS* 25773 

>aaaa01028453.1 CYP98A17 (indica cultivar-group) 66% to 98A3
365 GVTFIDAAGELDEQGCELKA
425 IVKDGIKIGASVPIAEHIPVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERH 595
596 GAKQHFVDALFTLRDQYDLSDDTVIGLLWDMIAAGSDTAVITAEWAMAE 742
743 LARNPRVQAMAQEELDRVVGRGRLMLEVDIPNLPYLQAIVKESLRLHPPAPLMLPHKASA 922
923 GVKIAGYDVPKGANVIVNVWAVGRDPSVWDSPLEYRPERFLEESIDIKGSDYRVVPFGAG 1102
1103RRVCPGAQVGISLVASMIGHLLHQFTWALPDGTRPEDLDMME 1228
SPGLVTFMATPLQVVAMPRLDKEELFKRVPVDIS*

>CYP98A18 #409 = #460 reduce gene count by 1
1816 MDTPALLPLALALVAIPIVILLFNRIRPGRLPPGPRAWPVVGNLFDIHPVRCRCFMEWAGKYG 1628
1627 PIMTVWLGTSPTVVVSTSELAREVLKNNDQQLADRPRNRSSERFSRGGVDLIWADYGPH 1451
1450 YIKVRKLCNLELFAPRRMEALRPIREDEVTAMVESIYRAITAP (1) 1319

>AL662934.1 $F CYP99A2 chromosome 4 clone OSJNBa0027O01 Length = 150012
59% to 99A1
4399 MEINSAATLTLVSLLTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSHPQVALRELASKYGP 4602
4603 VMFLRMGQIDTVVVSSPAAAQEVLRDKDVMFASRPSLLVSEIFCYDNLDVGFAPYGAYWR 4782
4783 MLRKLCTVELLSTKVVRQLAPVRNDETLTLVRNIKAASSGHGGGGGKKPVTLARLLTTCT 4962
4963 NTITAKAAFGQACGVELQEQFLTALDVGLKFSGGFCFGDLFPSLRFIDAMTGLRSRLW 5136
5137 RARGQLDSVFDKIIAQCEEHQGDSLVNVLLRIRDQGDLEFPFGTTNIKAIIL (0)
     DMFTGGTETTSSAAEWVMSELMRNPEVMAKVQA 5481
5482 EVRRVFDNKSPQDHEGLIDNLRYMKMVIKETMRLNPVLPLLMPHLCRETCDIGGYEVVEG 5661
5662 TRVVINSWAMARSPEYWDDAEEFKPERFEDGMADYKGSRFEYLPFGTGRRRCPGDTFGMV 5841
5842 LLELIVARLLYYFDWSLPAGMQPDDVDMDFVVTATTRRKNHLQLVASPYKLAPIQI* 6012

>AL662933.1 $F CYP99A3 OSJN00145 chromosome 4 clone OSJNBa0096F01, Length = 141695
86110 MEINSEATVTLVSVVTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSQPQVALRDLAGKYGP 85907
85906 VMFLRTGQVDTVVISSPAAAQEVLRDKDVTFASRPSLLVSEIFCYGNLDIGFAPYGAYWR 85727
85726 MLRKLCTVELLSTKMVRQLAPIRDGETLALVRNIEAAAGGKKPFTLATLL 85577
85576 ISCTNTFTAKAAFGQACGGELQEQFLTALDEALKFSNGFCFGDLFPSLRFIDAMTGLRSR 85397
85396 LERLRLQLDTVFDKIVAQCESNPGDSLVNVLLRIKDQGELDFPFSSTHVK 85247
85246 AIIL (0?)
84901 DMFTGGTETTSSTTEWLMSELMRNPEVMAKVQAEVRGVFDNKSPQDHEGLLENLSYMKLV 84722
84721 IKETLRLNPVLPLLLPHLCRETCEIGGYEIVEGTRVLINSWAMARSPEYWDDAEKFIPER 84542
84541 FEDGTADFKGSRFEYLPFGTGRRRCPGDIFAMATLELIVARLLYYFDWSLPDG 84383
84382 MQPGDIDMELVVGATARRKNHLQLVASPYKPISMQS

>AP005302.1a CYP701A6 version 1 (japonica cultivar-group) chromosome 6 = AC087597.1a 
66118 MESLLAAGAGGIGVAAAAVGGFIAAATLAVAPPKNRRNPPP 65996 (1) 
     AVPGLPIIGNLHQLKE 2571
2572 KKPHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 2685
2780 AMVAKFSSISTRKLSKALTVLTRDKSMVATSDYCDFHKMVKRYVMSSMLGTSAQ 2950 (0?)
3102 FRDIRDMMIHNMLSTFHKLVKDDPHAPLIFRDVFKDELFRLSMIQ 3236
3320 SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFPYLSWVPNKSFETR 3493
3494 VFTTETRRTAVMRALIKQQKERIVRGE 3574
3691 AKTCYLDFLLAENTLTDEQLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQ (0)
     ERLYQEIREVCGDETVTEEHLPRLPYLNAV 4038
4039 FHETLRRHSPVPLIPPRFVHEDTKLAGYDVPAGTE 4143
4711 MVINLYGCNMNRKEWESPEEWVPERFAGGRLEVADMYKTMAFGAGRRACAGSLQATHIA 4887
4888 CAAVARFVQEFGWRLREGDEEKVDTVQLTAYKLHPLHVHLTRRGRM 5025

>AC087597.1c $F CYP701A6 version 2 chromosome 1 clone OSJNba0088C22 N-terminal exon =  
128653 MEAFVPGGAGAAAXAVGGFVAAAALAERAGVIAPRKRPNAPP 128781 (1) alt exon 1
129691 PGGVGAAAVAAVGGFVAAAALAERAGVIAPRKRSNAPP 129807 (1) alt exon 1
131498 MEAFVPGGAGAAAPAVAAVGGFVAAAALAERAGVIAPRKRTNAPP 131632 (1) 
134410 AVPGLPIIGNLHQLKEKKPHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 134571 (0)
134666 AMVAKFSSISTRKLSKALTVLTRDKSMVATSDYCDFHKMVKRYVMSSMLGTSAQ 134827 (0)
134988 FRDIRDMMIHNMLSTFHKLVKDDPHAPLIFRDVFKDELFRLSMIQ 135122 (0)
135206 SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFPYLSWVPNKSFETRV 135382
135383 FTTETRRTAVMRALIKQQKERIVRGE 135460 (0)
135577 AKTCYLDFLLAENTLTDEQLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQ 135747 (0)
       ERLYQEIREVCGDETVTEEHLPRLPYLNAV 135924
135925 FHETLRRHSPVPLIPPRFVHEDTKLAGYDVPAGTE 136029 (0)
136597 MVINLYGCNMNRKEWESPEEWVPERFAGGRLEVADMYKTMAFGAGRRACAGSLQATHIA 136773
136774 CAAVARFVQEFGWRLREGDEEKVDTVQLTAYKLHPLHVHLTRRGRM* 136914

>AC087597.1b $F CYP701A7 chromosome 1 clone OSJNba0088C22 = AP005302.1b 
115151 MEAFVSGGAGGVGAAAVVGVFVAAAVVGGFVAAVALAERAGVIAPRKRPNAPP 115309 (1)
116986 AVPGLPIIGNLHQLKEKKPHQTFTKWAEIYGPIYTIRIGASSVVVLNSTEVAKE 117147 (0)
       AMVAKFSSISTRKLSKALTVLTRDKSMVATSDYGDFHKMVKRYVMSSTLGTSAQ 117420 (0)
117581 FRDTRDMMINNMLSTFHKLVKDDPHVPLIFRDVFKDELFRLSMIQ 117715 (0)
117799 SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFSYLSWVPNKSFETRV 117975
117976 FTAEARRTAVMRALIKQQKERIVRGE 118053 (0)
119442 AKICYLDFLLAENTLTDEQLTMLVWEELIEAADTTLVATEWAMYELAKNPDKQ 119612 (0) 
119689 ERLYQEIREVCGDETVTEEHLPRLPYLNAVFHETLRRHSPVPLIPPRFVHEDTKLAGYD 119865
119866 VPAGTE (0)
120626 MVINLYGCNMNKKEWESPEEWVPERFTGGRLEVADMYKTMAFGAGRRACAGSLQVMHIA 120802
120803 CTAIARFVQEFGWRLTEGDEEKVDTVQFTAYKLHPLHVHLTPRGRM* 120943

>AP005302.1c $F CYP701A8 (japonica cultivar-group) chromosome 6 
AF088220 48% to 701A3 mRNA BF430785 OG04F06T3
51052 MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPPP (1) 51186
      AVPGLPIIGNLHQLKEKKP 54671
54672 HQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKE (0?)
56126 AMIDKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQ (0?) 56290
56388 FRGTRERMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQ (0?) 56525
56680 SLGEDVSSVYVEEFGREISKDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIV 56856
56857 STTEFRRDAIMNALIKKQKERIARGE (0?)
57020 ARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIAKNPDKQ (0) 57187
57534 ELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDDTTLAGYD 57710
57711 IAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAGRRTCAGSLQ 57890
57891 AMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRGRM* 58046

>AP005302.1d CYP701A9 (japonica cultivargroup) chr 6 ortholog to AAAA01009744.1 
88169 MESLLAAGAGGIGVAAAAAVVAATLAVVPPKDRGNNPPP 88285 (1)
      AVPGLPVIGNMHQLKEKK 91433
91434 PHHTFTKWSKTYGPIYTIKTGASSVVVLNSTEVAKE 91541 (0?)
96519 QAMIEKFSSISTKKLPKALSVISRKNMVSISDYGDFYKMAKRNIMLAILGFNAQ (0?)
      FCDTRERMVSNVLSSLHKLVAVDPHSPLNF 96878
96879 REVYTTELFGLSLIQ (0) 96923
97128 NLGEDVCSVYVEEFGREISKEEIFHVLVHEILSCVVEPDWRDYFPYLSWLPNKSFETIV 97304
97305 SSTEFRRDAVMNALIKRQKERIARGE
      ARISYIDFLLEAKNSTQLTDHQLMLLLAESIAAAVDTVLVTTEWAMYELAK 97664
97665 NPDKQ (0) 
      EWLYREIREVCGGK 97844
97845 AVTEEDLPRLPYLDAVLHETLRLHSPVPVLPTRFVHDDTTLAGYDVPAGTQVMINVFGCH 98024
98025 MDEEAWESPGEWSPERFLGEGFKLADRYKTLAFGAGRRTCAGSQQAVSIACVAIARFVQE 98204
98205 LQWTLREGDGDKEDTMQYTALKLHPLHVHLKPRG 98306

>AP004591.1 $F CYP703A3 chr 8 clone P0582D05, Length = 150428
4227 MDPFLLSIILCSW
4188 IFVVVSWKKLNCMRRRLPPGPPRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTID 4009
4008 AITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHL 3829
3828 LTTKRLESFAAHRALEAEHLCQFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL 3649
3648 QSAGPGEAMEFMHITHELFWLLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQ 3475
3474 KIIDEHRKAREAKKSASLDDDNKEDMDFVDVLLSLPGENGKEHMDDVEIKALMQ 3313
2680 DMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDGVVGRGRMVAESDLGQLTYLRCVV 2501
2500 RESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINTHALGRNTRIWDDVDAFRPERH 2321
2320 LPASADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFDWSPPDGLR 2141
2140 PDDIDTQEVYGMTMPKAKPLVAVATPRLPPQMYGRHGKQV* 2018

>AL606640.1 $F CYP704A3 chromosome 4 clone OSJNBa0019K04, 54% to 704A2 and AP000391
77409 MESPLSHPAMVALSLLLLVALYLARRAVLGKKRRYPPVAGTMF 77537
77538 HQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILKTNFANYGKGPMTHD 77717
77718 VLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTAAELAGILERGPAAK 77897
77898 GRERVDMQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGLVFARAFDDASEQVLFRFFDLL 78077
78078 WKVKRFLNISSEATMKQSIRTINDFVYSIIDRKIEQMSREQHEF (0)
      AKKEDILSRFLLEREKDPGCFDNKYIRDIILNFVIA 78437
78438 GRDTTAGTLSWFLYAVCKNQRVQDKIAREVRDATTGDRDVGVQDFSSFLTEDAINKMQY 78614
78615 LHAALTETLRLYPGVPL 78665 (0)
78800 DVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMKFLWGDNAEEFKPERWLDDSGMFVAES 78979
78980 PFKFTAFQ 79000 (0)
79119 AGPRICLGKEFAYRQMKIVSAVLLYFFRFEMWDDDATVGYRPMLTLKMDGPFYLRALAR* 79298

>AP000391 $F CYP704A4 53% to 704A2 CDS complement(join(110051..110242,110615..110815,
MVTQLTYLAASAGVCLASALAIALLSIALYIIGVVASFAVLCAKEFAERAHDRP
113301 PLVGTVFRQLKNFDRMFDEHVNYATAHRTSRIVYPGHCEVFTSDPAVVEHVLK 113143
NSFSKYSKGDFLTTA
MKDLFGDGIFATDGDMWRHQRKLASYEFSTKVLRDFSSDTFRRN
AAKLAEKISCAAANRISINIQDLLMRATMDSIFKVGFGFELNTLSGSDESGIQFSKAF
DEANSLVYYRFVDIMWKLKRYLNIGSEAKLKRNIQIIDSFVMKLIHQKREQMKIAADY
KTKEDILSRFVLASEQDPGTMDDRYLRDIVLNFLIAGKDTTGNTLTWFFYLLCKNPIV
QDKVALEIREFVEWSKEDNTIESFTKRLDEGAISKMHYLQATISETLRLYPAVPVDAK
MADEDDVLPNGYRVVKGDGINYMIYAMGRMTYLWGEDAQEFRPERWLVNGVYQQESPF
KFVSFNAGPRICLGKEFAHRQMKIMAATLIHFFKFRLEDESKEPIYKTMFTLHIDNGL
HLLANPREISP

>AC074232.2a $F CYP704A5 chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 1 
2688 MGEDGGVNSSSNSPAAAVGLVLVVAICTYLAVVATRKQKRRRRRRP
2822 PVVGTAFHQLYHVRRVHDYHTALSREHMTFRLLVPAGREQIYTCDPAVVEHI 2977
2978 LRTNFANYGK 3007
4645 GSFNHGNMSDLFGDGIFAVDGDKWKQQRKIASYDFTTRALR 4767
4943 LQGFLMRATMDSIFTIAFGQDLNTLDGSGEGRRFAAAFDDASEFTMLRYLNPFWKLSR 5116
5117 LLNVGAEAMLKERIKVVDGFVYKLIRDRSDELSNTKAHDT 5242
5337 DILTRFIQATTSDSGTVDYKYLRDIILNIVIAGKDTTAGSLAWFLYMMCKHPEVQEKICH 5516
5517 EAMEATNAGEAASIDEFSQSLTDEALNKMHYLHAALTETLRLYPAVPL 5672
5746 DNKQCFSDDVLPNGFNVSKGDIVFYIPYAMGRMESLWGKDAESFRPERWL 5925
5926 DENGVFQQESPFKFTAFQA 6096
6097 GPRICLGKDFAYRQMKIFAAVLLRFFVLKLRDEKEIISYRTMITLSVDQGLHLTAMAR* 6273

>AC074232.2b $F CYP704A6 chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 2
28049 MGMDGDSSYSPALAAVAGAVALVAFCSYYLAVTRATGDGEARRRRRRHP
28196 PVVGTVFHQLYHVRRLHDYYTALCREHTTFRLLATPGRRNIYTCDPAVVEHI 28351
28352 LRTNFPSYGK 28381
29955 GPLNSEILNDLFGEGIFAVDGEKWKTQRKIASYDFTTRALRDFSSDVFKRNAAKLAGVV 30131
30132 SNHAASNSKCSFLQGLLTRATMDSIFTIAF 30311
30312 GQDLNTLDGSGEGRHFAKAFDDAGEYLLLRYLNPFWKLARLLNVGAEATLKERIKVVD 30485
30486 EFVYKLIRARSDELS 30530
30653 DDLLSRFIQATTSDSGTVDYKYLRDIVLNIVIAAKDSTSGSLAWFLYMACKRPEVQEKIF 30832
30833 DEVMETTNAGDCASIDEFLTSLTDQALNKMHYLHAALTETLRLYPSVPLVI 30985
31122 NGFSVSKGDGVFYMPYAMGRMEFLWGKDAEAFRPERWLDEHGVFQQESPFKFTAF 31286 
31388 AGPRICIGKDFAYRQMKIFAAVLIRSFVFKLRDKKDNVSYRTAITLAIDQDLHLTATAR* 31567

>AC074232.2c $F CYP704A7 chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 3
85065 MGAERGGDSCYSPAAVMATAGALALVAICSYLAVTSNKQKRRRRP
85198 PVVGTVFHQLYNVRRIHDYHTALSREHTTFRMLVPAGGDQIYTCDPAVVEHI 85353
85354 LKTNFANYGK 85383
87710 GPFNHGNAKDLFGDGIFAIDGEKWKQQRKIASYDFSTRALR 87832
      DFSCAVFKRNAAKLAGIVSNHAA
      TYGLCRTFVQGLMLRATMDSIFTIAFGTDLNTLDGSGEGSRFAAAFDDASEFTM
      LRYISPLWKLARLLNVGVEAMLKERIKVVDEFVYRLIRARSDELS
88423 DILSRFLQATTSDSVVDYKYLRDIILNIVIAGKDTTAGALAWFLYMVCKHPEVQ 88584
88585 EKICHEAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTETLRLYPSVPM 88764
88765 ENKQCFSDDVLPNGFNVSKGDIVFFIPYA 88944
88945 MGRMESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQ 
      AGPRICLGKEFAYRQMKIFAAVLLRFFVLKLRDEKEIVSYRTTLTLAI 89298
      DQGLHLTATAR* 89334

>aaaa01058627.1 CYP704A8 (indica cultivar-group) 70% to AL606640.1 $F
747 ILTALLALSIALLLALLHFSWRRRAGAGKNRNHPPVAGTILHQLLNYDRLMDYHTELSRR 568
567 HRTFRILTPTCNDVYTVDPANVEHILKANFSSYGKGALMHGVMEDLLGDGI 415
414 FNVDGAMWRHQRKVASHELSTRVLRDYSSAVFRDTAAELAAIIVAAAGAGEKVDMEDLL 238
237 MRSTLDSILKVGFGVSLGAVFGSGNEEGAAFARAFDDASQQVMYRFIDPLWKVKRLLN 64
63  VLSEADMKRSVRTINDFV 10

>AC073556.1 $F CYP704B2 unknown clone OSJNBa0091P11 14 unordered pieces 
49583 MKSPMEEAHAMPVTSFFPVAGIHKLIAIFLVVLSWILVHKWSL
49712 RNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTVDMPFTSYTYI 49864
49865 ADPVNVEHVLKTNFTNYPK 49921
50010 GEVYRSYMDVLLGDGIFNADGEMWRKQRKTASFEFASKNLRDFSTVVFREYSLKLSSI 50183
50184 LSQACKAGRVVDMQ 50225
50317 ELFMRMTLDSICKVGFGVEIGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKK 50484
50485 FLHVGSEALLEQSMKLVDDFTYSVIRRRK 50571
50718 NGEQIKHDILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIAGRDTTATTLSWFTYMA 50897
50898 MTHPAVADKLRRELAAFEDERARELSYDAVGKLVYL 51077
51078 HACVTETLRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGPDAASF 51257
51258 RPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYTFDLV 51428
51429 EDHPVKYRMMTILSMAHGLKVRVSTSV* 51513

>AP004704.1b $F CYP706C1 chromosome 8 clone P0544G09, Length = 137478
100654 MEVTSTPAMLLYAALFAAALLYLAVAVRRGRGAGLPPGPTGLPLVGSLLSLDPELHTYFAGLAARYG 100454
100453 PIFSIRLGSKLGVVVTSPALAREVLRDHDLVFSNRDTPDAACSISYGGGQNIVWNPVGPT 100274
100273 WRLLRRICVHEMIGPAGLDSLHGLRRREFMATLHHLRARSGEPVNVGAQMFLTVMNVVTG 100094
100093 ALWGGNVGSESERTTVGKEFRELVADITELLGAPNVSDFFPALAPLDIQGIRNKSDLLKD 99914
99913  RFDDIFARIIQKRTESDHAAAAGETASDFLEYMLKLEKEGGDGKTAFTMTNVKALLM 99743 (0)
       DMVIGGTETTSNTVEWGMAEMLQNRGTLRKVRE 99561
99560  ELDAVVGRDGVVEESHLPKLHYLNLVVKETLRLHPALPLMVPHCPGEDATVGGHRVPAGA 99381
99380  RVFVNVWAIQRDPAVWKDPEHFIPERFLPADGGGGRRLDFTGSEQEYMPFGSGRRICAGV 99201
99200  AMAERMVAYSLAMLVQAFDWELPAGERLDLAERFGIVMKKATPLVAVPTPRLSNPQLYSA* 99018

>AP003378.1a $F CYP706C2 chromosome 1 clone P0047E11, 49% to 706A5
28850 MATANLLYAALLVPTVLYLAVTRRRSRRLPPGPVGLPLVGSLPFIDPNLHTYFASLAAKH 29029
29030 GPILSIRLGSKVDIVVNSAQLAREVLRDQDSVFANRVMLDAGDAVSFGGAQNIVGNPLGP 29209
29210 MWRLLRRVCVQEMMSPAGLASVHGLRRREFRSTLRYLHSKPGEPVDVGAQMFLNTM 29377
29378 NVITGTMWGGTIGSESERSAVGSEFRGLVAEVTELLGTPNVSDLFPVLKPFDLQGIRRKM 29557
29558 ERLRSRFDLLFTKIIQQRMRSQQDGGEMTTDFLECLLKMEKEGSDGKTTFTMDNVKGFLL 29737 (0)
      EMVVGGTDTTSNSVE 29917
29918 WIMAELLQNPQVLNKVQQELDSIVGRDAVVEESHLPQLHYLRMVIKETLRLHPPVPLLVP 30097
30098 HSPSAAATVGGYHVPEGCRVLINVWAIQRNPLVWNKPLDFNPDRFARDGGHKGDFTGSQL 30277
30278 DYLPFGSGRRMCAGMAMGEKVMVYSVAMLLQAFDWKLPQGVQLDLSEKFGIVMKKATPLV 30457
30458 AIPTPRLSKPELYYS* 30505

>aaaa01014982.1 $FI CYP706C3 (indica cultivar-group) 
4398 MQPMAPANVLYAALLVPMVLYLAVTRRRSRRLPPGPAGLPLVGSLPFIDPNLHTYFAGLAA 4216
4215 KHGPILSIRLGSKVDIVVTSPELAREVLRDQDSVFANRVMPDAGNAVSFGGVQNIVGNPV 4036
4035 GPMWRLLRRLCVHEMLSPSGLANVHDLRRREFRSTLRYLHTKSGEPVDLGAQMFLNTMNV 3856
3855 ITSAMWGGTIGSESERAAVGSEFRGLVAEVTELLGTPNVSDFFPALAPFDLQ 3700
3699 GIRGKMERFRSRFDLMFAKIIQQRMKAQQDGGETATDFLECMLKMEKEGGDGKAPF 3532
3531 TMDNVKALLL (0) 3502
3404 DMVVGGTETTSNTVEWAMAEMLQNPQVLKKAQQELDSVVGRDEVVEEWHLPQLHYLRMV 3228
3227 IKETLRLHPALPLMVPHSPSAASTVSGYHVPEGSRVFVNVWAIQRNPLVWNEPLEFNPER 3048
3047 FAGDEGHKWDFTGSQFDYFPFGSGRRICAGIAMAEKMTAYSVAMLLQAFDWKLPQGVQP 2871
2870 DLSEKFGIVMKKAAPLVAIPTPGYLSLSCTISEASFYLAKKRKKHVQPAQPNS* 2709

>aaaa01014217.1 $FI CYP706C4 (indica cultivar-group) no introns
4554 MEITTATTSALTAASASTLLYAALAAAAFLYITIVRHRRGGDLPPGPAGLPLIGCLPFLEPNL 4366
4365 HAYFARLAEKHGPVFSIRIGSKLEVVVTSPEVAREVLRDQDHVFANRVIPEAGRAIAFGE 4186
4185 EDNIVGNPAGPKLRLLRRICVSEMLGPSGLSKMYGLRRREFRSTLRHLYTQSLCGTPVCV 4006
4005 GAQMFLTAMNTITNSLWGGKIGSESERTAVGQEFRALIAEITELLGRPNVSDFFPVLAP 3829
3828 LDLQGVQKRMRGIRTQFEHMFARIIQTRAKAEQDGGEASSDFLEYMLKLEKEGGD 3664
3663 GKTPFTMINVKALDMVVGGT 3484
3483 ETISNTVEWAMAEMILNPRILEKVQQELDQVVGRDSLVEESHIGQLHYLRLVFKETIRL 3307
3306 HTPLPLMVPHCPSSTSTIGGYRVPKGTRVFVNVWAIHRNPRVWKAPQEFIPERFSGDDGQ 3127
3126 KWDFSGKEFDYFPFGSGRRMCAGIAMAERMTIYSLALLLQAFDWKLPEGTQLDMDEK 2956
2955 FGVVMKKAKPLVVIPTPRLTKPELYS* 2875

>AP004129.1 $F CYP707A5 chr 2 clone OJ1007_A03 71% to 707A1
76179 MGAFLLFVCVLAPFLLVCAVRGRRRQAGSSEAAACGLPLPPGSMGWPYVGETFQLYSSKNPNVFF 76373
76374 NKKRNKYGPIFKTHILGCPCVMVSSPEAARFVLVTQAHLFKPTFPASKERMLGPQAIFFQ 76553
76554 QGDYHAHLRRIVSRAFSPESIRASVPAIEAIALRSLHSWDGQFVNTFQEMKT 76709 (0)
76814 YALNVALLSIFGEEEMRYIEELKQCYLTLEKGYNSMPVNLPGTLFHKAMKARKRLGA 76984
76985 IVAHIISARRERQRGNDLLGSFVDGREALTDAQIADNVIGVIFAARDTTASVLTWMVKF 77161
77162 LGDHPAVLKAVT 77197 (0)
77278 EEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVED 77433
77434 VEYQ 77445 (1)
77627 GYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFE (0) 77734
77890 VAPKPNTFMPFGNGTHSCPGNELAKLEMLVLFHHLATKYR 78009
78010 WSTSKSESGVQFGPFALPLNGLPMSFTRKNTEQE* 78114

>AP004162.1 $F CYP707A6 chr 8 clone OJ1320_D12, = AY023201.1 searched with 707A3 
35847 MAFLLFFVFVTAAVLCFVVPAFLLLCTSVQRRRDVGQGGGRDWQKKK
35706 KLRLPPGSMGWPYVGETLQLYSQDPNVFFASKQKR 35602 (2)
35464 YGEIFKTNLLGCPCVMLASPEAARFVLVSQARLFKPTYPPSKERMIGPSALFFHQGEYH 35288
35287 LRLRRLVQAALAPDSLRALVPDVDAAVAATLAAWSGGHVASTFHAMKK 35144 (0)
34944 LSFDVGVVTIFGGRLGRRHREELRTNYSVVERGYNCFPNRFPGTLYHKAIQ 34792 (0)
34706 ARKRLRAILSEIVAERRARGGGGGGGGDDLLGGLMRSRDDGTAGAVALLTDDQIADNV 34533
34532 VGVLFAAQDTTASVLTWILKYLHDSPKLLEAVK 34434 (0)
      AEQMAIYVANEGGKRPLTWTQTRSMTLTHQ (0)
33645 VILESLRMASIISFTFREAVADVEYK 33568 (1)
32047 GFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFK 31940 (0)
31338 VAPRPSTFLPFGSGVHACPGNELAKLEMLVLVHRLVTAYR 31219 (2)
31105 WEIVGASDEVEYSPFPVPRGGLNAKLWKQEAEEDMYMAMGTITAAGA* 30962

>AP003752.1a $F CYP709C4 chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
45% to 709B2
7127 MGYGWALAAVLATWCLLDALSR
7061 LVWRPRAVAAALRRQGVRGPGYRLLVGSLGDINKLRADAAGAGGAAALDVASHDFIPFVQ 6882
6881 PQFRQWIPLY (1)
6770 GRVFLYWFGWTPDMCVADVEVAKQVLSDRTGLFPKNVTTPMLLKLFGRGLVLA 6612
6611 NGDEWQRHKKVVHPAFNTDKLK 6546 (0)
6457 MMTATMAGVARSMVSRWEEKVASHGGKVVIELSSQFEELTADVISHTAFGSSYAEGKQV 6281
6280 FMAIKELQFIAFSSLLSVQIPGS 6212 (2)
6152 RYFPTKKNLKVWRLDRKVRSTLMQIISNRLAAAAKEKAGGGGGGYGEDLLGLMLEAS 5982
5981 APPELGTKRRQPPVLSMDEIIDECKTFFFAGQETTSHLLSWTMFLLSTHPDWQDKLREEA 5802
5801 VRECAGAGAGDDDDQLPTYDMLGKLKLVGMQF 5706 (0)
5130 FLLETLRLYSPVPAIRRRTAAAVEMGGVTVPGGTMLTFPIATMHRDEEVWGAD 4975
4974 AGVFDPMRFDGGGGAMAKLLSFSTGPRACVGQSFA 4870
4869 MVEAKAVVAAILRRFRLELSPEYVHAPTDVITLRPKHGLMVVTRVHA* 4723

>AP003752.1b $F CYP709C5 chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
18593 MGNLGWMVAAAVAAVVASWAFDAVVK
18515 LVWRPRAITRRLRAQGVGGPGYRFFSGNLGEIRRLRDEGAGVVLDVSSHDFVPIVQPHFR 18336
18335 KWIPLY 18318 (1)
18171 GKTFMYWFGARPTICLADVSMVRQVLSDRTGMYPKNVSNPYFARLLGKGLVLTDGDEWKR 17992
17991 HRKVVHPAFNMDKLKMMTVTMSDCAQSMISEWESELGTKGDIVEIELSRRFEELTA 17824
17823 DVISHTAFGSSYKEGKQVFLAQRELQFLAFSTFLSIQIPGSSYLPTKKNLKTWSV 17659
17658 DKKVRSMLTDIIKSRLNNKDVAGYGNDLLGLMLEACAPE 17542
17541 HGESQPQLSMDEIIAECKTFFFAGHDTTSHLLTWTMFLLSTHPEWQEKLREEVATECDGK 17362
17361 VPTGDMLNKLKLVNMFLLETLRLYGPVAFIQRRVNAELELGGITVPEGTVLS 17206
17205 IPIATIHRDKEVWGEDADIFKPERFKNGVSKAGKYPNAL 17089
17088 LSFSSGPRACIGQNFAMIEAKAVIAMILQRFSFTLSPKYVHVPTDVITLRPKYGLPMI 16915
16914 LKSLKV* 16894

>AP003752.1c $F CYP709C6 chromosome 7 clone OJ1332_C12, Best match zea mays AF391808 same as AP004334.1 3175-4374 region
25600 MGFEWTVATAAAAVAASWAFIAVVVK
25522 LVW*PRAITRRLGAQGVAGPGYRFFSGNLSEIRRLRAEGANLVLDVSSHDFVPIVQPHIR 25343
25342 KWIPLY 25325
25229 GKTFLYWFGTRPNICLADMNMVRQVLSDRTGMFPKYIDNMQFARLLGKGLVLTDDDEWKR 25050
25049 HYKVVHPAFDMDKLKMMTETISDYAQSMMFEWESELGMKGGSTEIELSRWFEELTA 24882
24881 DVISRTAFGSSYREGKQVFLAQRKLQFLAFSVFLTIQIPGFSYLLTKK 24738
24737 NLKTWSLDKKVRSMLMNIIKSRLTNKETMGYGNDLLGLMLEACVPEHGGSQPQLSMDD 24564
24563 IIAECKTFFFAGHDTTSQLLTWTMFLLSTHQHWMEKLRKEVRMVCNDEVPTGDMLNKLKL 24384
24383 VNMFLLETLRLYGPVSLVTRRAGTDVKLGSIKVPKGTILTIPIATIHRDKEV 24228
24227 WGEDADEFKPERSENGVLNAAKHPSALLSFSIGLRSCIG 24111
24110 QNFAMIEARTIIAMILQRFSFTLSPKYVHTPISVITLRPKYGLPMILRSLKVKRDR* 23937

>AP003752.1d $P CYP709C7P chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
same as AP004334.1 8332-8514 region lone C-term pseudogene fragment 
29328 NGVSKEAKNPNALLSFSSGPRSCIGQNFAMLEAKAVITMILQRFFFTLSPKYVHA 29164
29163 PTSLITLWPKYGLPKILRSLKMCRMESQELSQPEGGEWLVYPKT* 28979

>AP003752.1e $F CYP709C8 chromosome 7 clone OJ1332_C12, Best match zea mays AF391808 
34102 MGNFVWMVAAAAAAVASWAFIAVVVK
34024 LVWRPRAISRRLRAQAVGGPGYRFFSGNLGEIRRLRAEGAGVVLDVSSHDFVPIVQPHFR 33845
33844 KWVSLY (1)
33706 GKTFLFWFGAQPNICLADINIVRQVLSDRTGMYPKDLTNPYFAHLLGKGLVLIDGDEWKR 33527
33526 HYKVVHPAFDMDKLKMMTVTISDCTGSMMSEWESELGMKGGSAEIELSQRFQELTA 33359
33358 DVISRTAFGSSYSEGKQVFLAQRKLQFLAFSMFLTIQIPGFRYLPTKK 33215
33214 NLKIWSLDKKVRSMLRNIIKIRLANKDTMGYGNDLLGLMLETCAPEHDESQQLS 33053
33052 MDEIIAECKTFFFGGHDTTSHLLTWTMFLLSTHPEWMRKIRKEVTTMCGDEVPTGDMLNK 32873
32872 MNLLNMFLLETLRLYSPVSLISRRTGTNAKFGGIKVPEGTILRIPIATIHRD 32717
32716 KEVWGEDADEFKPARFENGVSKAAKHPNALLSFSNGPRS 32600
32599 CIGQNFAMIEAKAVITMILQRFSFTLSPKYVHTPISVITLRPKYGLPMILRSLKVKRDL* 32420

>AP004264.1 $F CYP709C9 chromosome 7 clone P0025D09 orth of AAAA01013633.1
58901 MGLLAWMVAAAAAAVLASWAFSAVVHLVWRPRAISRRLRAQGVGGPGYRFFSGNLGEIKR 59080
59081 FRGDGAGVVLNVSSHDFLPIVQPHFRKWIPLY 59176 (1)
59544 GRTFLYWFGAQPNICLADVSMVWQ VLSDRTGIYPKNLTNPHFVRLLGKGLVLTDGDEWKR 59723
59724 HRKVVHPAFNMDKLKMMTMTMSDCSRSMMSEWESELAAKGGLVEIELSRRFEELTADVIS 59903
59904 HTAFGSSYKEGKQVFLAQRELQFLAFSTFLTVQIPGF 60014 (2)
60110 SYLPTMKNFKTWSLDKKVRGMLMDIIKTRHANKDVAGYGNDLLGLMLEACAPEHGESCPQ 60289
60290 LSMDEIIDECKTFFFAGHDTTSHLLTWTMFLLSTHPDWQEKLREEIAMECGDKVPTGDMLNKLKMVNMFL 60499
60500 LETLRLYSPVSLIRRKVDTDIELGGIKMPEGALLTIPIATIHRDKEVWGEDADEFRPER 60676
60677 FENGVTRAAKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRF 60814
60815 SFTLSPKYVHAPTDVITLRPKYGLPMILKSLKL* 60916

>AP003514.1a CYP709C10 (japonica cultivar-group) chr 6 = AP003330.1 = AP004738.1b
4354 MAQLVWRPYAVGRALGQQGVRGPAYRLLVGNIGEANEMRAAASGGVLDRRCHDVVPRVLP 4533
4534 HYRAWMSRYGKVFVSWTGPFPALCVGDYAMAKEILADRTGLYAKPDPGASILALFGNGLA 4713
4714 FVNGDDWARHRRVVHPAFAMDKLKMMAKTMAECARKVIQAWEARAAAAADGERMVQVEVG 4893
4894 EQFHELTADVISHTAFGSSYRQGKEVFVAQRELQYIAMSALNSVRIPGSQYIPTKANIRR 5073
5074 RQLAKKVRGTLMAIIRERQATAAAAKEDRGYGNDLLGLMLEANAAAGGGEKSMTMDE 5244
5245 IVDECKTFFFAGHDTTSHLLTWAMFLLGTHPEWQQRLREEVLRECCGGGGGDTEALPNGD 5424
5425 ALNKLKL 5445
5528 MTMVLYETLRLYGPVSMLVRTATADAELGGVRVPKGTMTMMPVAILHRDADVWGADAGEF 5707
5708 DPLRFRGGVNKAAAHAGALLAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYVH 5887
5888 APLDLLTLQPKCGLPMVLKLLDQ 5956

>AP003514.1b $F CYP709C11 chromosome 6 clone P0698A06, start MET is missing
9625 MAT (0)
9530 LVWRPYAVARAFGRQRIRGPAYRLFVGSDGEANAMRAATRGDVLDRRCHDIVPRVMPHY 9354
9353 RAWMSRYGKVFVSWSGATPALCVGDYAMVKQILSDRTGLYGKPEPEPSILALIGNGL 9183
9182 IFIGGDDWARHRRVVHPAFAMDKLKMMAKTMADCAREVIREWEARATADGERRVQVEVGG 9003
9002 QLQELTADVISHTAFGSSYREGKEVFVAQRELQSIAFSAINSTRFPGSQYIPTKTNLRRR 8823
8822 HLAKKVRGTLMAIIRERQAAAAKEDSGHGNDLLGLMLEANATDACGSGGEKSMTMDEIV 8646
8645 DECKTFFFAGHDTTSHLLTWAMFLLGTHPEWQHRLREEVLRECGGGGDTEALPNGDALNK 8466
8465 LKL 8457 (0?)
8374 MTMVLYETLRLYGPVSLMARTATADAELGGVRVPKGTMTMIPMAILHRDADVWGAGAGEF 8195
8194 DPLRFRGGVNKAAAHAGALLAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYVH 8015
8014 APLDLLTLQPKCGLPMVLKLLDQ* 7943 

>AP003745.1 $P CYP709C12P chromosome 7 clone OJ1123_B01 
60823 VLSDRTGIYPKNLTNPHSVRLLGKGLVLTDGD 60917
60918 EWKRHRKVVHPAFNMDKLKMMTMTMSDCSRSMMSEWESELGAKGGLAEIELSRRFEELTA 61097
61098 NVISHTVFGSSYKEGKQVFLAQRELQFLAFSTFLTVQVPGF 61220 (2)
61310 SYLPTMKNFKTWSLDKKVRGMLMDIIKTRHANKDVVGYGNDLLGLLLEACAPEHRESHPQ 61489
61490 LSMDEIIDECKTFFFAGHDTTSHLLT*TMFLLSTHPDW*EKLREEIAMECGDEMPTGDML 61669
61670 NKLKMVNMFLLETLRLYSPVLLIRRKVGTDIELGGIKMPEGALLMIPIATIHRDKEVWGE 61849
61850 DADEFRPERFENGVTRAAKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRFSFTLS 62029
62030 PKYVHAPTDVITLRPKYGLPMILKSLKL* 62116

>AP004738.1c CYP709C13P (japonica cultivar-group) chr 6 
151520 LVWRPYAVARAFGRQGIRGPAYRLFVGSDAEANAMRAAT 151636
151627 RGDVLDLRCHDIVPRVLPHYRAWMWRYGKVFVSWSGATPALCVGD*AMVKQILSDRTGLY 151806
151807 GKPEPGPSFLALIGNGLAFVNGDDWVRHRRVVHPAFAMDKLKMMAKTMAECAREVIRAWE 151986
151987 ARAAAGERRVQVEVGQKFQELTADVISHTAFGS
153392 SYREGKEVFVAQRELQSIAFSTIYSIRFPGSECIATKTNLRRRHLAKKVRGTLXXXX 153550
153564 RARQAAAAAKEDSGYGNDLLGRMLEANAAVGGGGGEKS

>AP003258.2 $F CYP709D1 genomic DNA, chr 1, PAC clone:P0463A02, complete 46% to 709B2
MLKSTIELYIFTTAIAKKSLHSQTKHKSKMDVPSVVIP
151039 ILVVLVSRLLTSALVHLLWKPYAITKLFRGQGITGPKYRLFVGSLPEIKRMKAAAAADEVA 150857
150856 AGAHSHDFIPIVLPQHSKWATDHG (1)
       KTFLYWLGAVPAVSLGRVEQVKQVLLERTGSFTKNYMNANLEA 150497
150496 LLGKGLILANGEDWERHRKVVHPAFNHDKLK 150404 (0)
149815 FMSVVMAESVESMVQRWQSQIQQAGNNQVELDLSRELSELTSDVITRSAFGSSHEEGKE 149639
149638 VYQAQKELQELAFSSSLDVPALVFLR 149561 (2)
149237 GNTRAHQLVKKSRTMLMEIIEGRLAKVEAAEAGYGSDLLGLMLEARALEREGNGLVLTTQE 149055
149054 IIDECKTFFFAGQDTTSNHLVWTMFLLSSNAQWQDKLREEVLTV CGDAIPTPDMANRLKL 148875 (0)
148359 VNMVLLESLRLYSPVVIIRRIAGSDIDLGNLKIPKGTVLSIPIAKIHRDRDVWGPDADEF 148180
148179 NPARFKNGVSRAASYPNALLSFSQGPRGCIGQTFAMLESQIAIAMILQRFEFRLSPSYVH 148000
147999 APMEAITLRPRFGLPVVLRNLQG* 147928

>AC082644.10a $F CYP709E1 50% to 709B2 EST AU066048, AU032967 from this gene
140516 MATLLLLAVAAAAAAWVWWGRYAWRARAVARRLAAQGVRGPRRGG 140650
140651 LLRGCNDEVRRRKAEAEADGVAMDVGDHDYLRRVVPHFVAWKELY 140785 (1?)
141949 GTPFLYWFGPQPRICVSDYNLVKQILSKKYGHFVKNDAHPAILSMIGKGLVLVEGADWVR 142128
142129 HRRVLTPAFTMDKLK 142173 (0?)
142311 VMTKTMASCAECLIQGWLDHASNSKSIEIEVEFSKQFQDLTADVICRTAFGSNSEKGKEV 142490
142491 FHAQKQLQAIAIATILNLQLPGFK 142559 (?)
142648 YLPTKRNRCKWKLENKLRNTLMQIIQSRITSEGNGYGDDLLGVMLNACFSTEQGEKRDEL 142827
142828 ILCVDEIIDECKTFFFAGHETTSHLLTWTMFLLSVYPEWQDRLREEVLRECRKENPNADM 143007
143008 LSKLKE 143025
143212 MTMVLLETLRLYPPVIFMFRKPITDMQLGRLHLPRGTAIVIPIPILHRDKEVWGD 143376
143377 DADEFNPLRFANGVTRAAKIPHAHLGFSIGPRSCIGQNFAMLEAKLVMAMILQKFSFALS 143556
143557 PKYVHAPADLITLQPKFGLPILLKALDA* 143643

>AC082644.10b $F CYP709E2 chr 3 BAC OSJNBa0013M12 genomic sequence, 
146763 MASLALVFLALLLPTISWLWDYIIVPHIWRPYIAAKRLREQGIRGPPY 146906
146907 KFLKGCNEDVKKMKDAADDLVLDVHDHNYLPRVMP*YLKWRSQY 147038 (1) 
147228 GRALCILVWGKA
147262 RICIFNYEWARQILSSKSGHFLKNDTTPTVLALLGKGLVLVEGIDWERHRRV 147417
147418 INPAFTMDKIK 147450 (0)
147771 MMTKTMVACAQNMVKELEDQASSNKNGETQVELDKQFQELTADIISHTAFGSS 147929
147930 YKLGIEAFHAQKELQEIAVKSLLNVQIPG 148016 (?)
148136 FSYLPTKGNWRKLTLEKKLRGTLMQIIQSRLSSKGSGYGSDLLGLMLEACIATDQGREQH 148315
148316 QLSLSIDEIIHECKTFFFAGHETTSLLLTWTVFLLSVYPEWQARLRLEALRECGKENPNG 148495
148496 DNLSKLKE 148519 (0?)
148671 MSMVFLETLRLYGPALFLQRKPLTDITVGETKIPKDHAIIIPSAIMHRDKEIWGDDTDE 148847
148848 FNPLRFQNGVTRAAKVPHALLAFSIGPRSCIGQNFAMLEAKSVMAMILKKFSFTLSPNYV 149027
149028 HAPVDLLTLQPKFGLPVVLRLLDA* 149102

>AC087220.7 $F CYP709E3 chr 3 clone OSJNBb0097F01 similar to 709B2 
154905 MDSILLLPLVALLVVAISWLWDYTVVRLIWRPHCIAK 155015 
132837 EFREKQGIRGPAYKFLGGNNGEISRLKEEADGQVLDNLRDHNYLPRIAPHFLKWRAQY (1)
129645 GEAFLFWYGAKP RICIFDYELARQILSSKSGHFLKNDAPPTLVALMGKGLVLLEGTDWVR 129466
129465 HRRVINPAFNMDKLK 129421 (0)
129177 MMISTMTGCAQSLAKELEDVAAKNKDRVTEVDLNQKFR*LTADIIAHTAFGSS 129019
129018 YQLGKEAFQAQHELTEITMATLFQVQLPGLN 128935 (2)
128834 YLPTERNRRKWRLQKNLRDTLMQIIRSRLSSKDGGYGNDLLGLMLGACASDEQ 128667
128666 GEASSLSMDEIVDECKTFFLAGHETTSLLLTWTVFLLSVYPEWQERLRNEVLRECGTDQ 128490
128489 CPDANSLGKLKE 128457 (0) 
127940 MTMVLLETLRLYNPALFIQRKPTADITVGSLAIPAGVAVYIPVPIMHRDREVWGHDAGEF 127761
127760 NPLRFRDGAARAAAAAGIPHALLSFSIGPRSCIGQGFAMLEAKAAMAAMLRRLSFRVSPG 127581
127580 YVHAPVDLITLKPKFGLPVIVRLPDA* 127500 

>AP002092a $F CYP710A5 CDS complement(54602..56137) 60% TO 710A1
MRTSTDPSGSIESFHGLVHLRTAAPLLAAAVALYMLI EQLSYHR
KKGSMPGAPLVVPFLGSAAHLIRDPVGFWDVQAALARKSGAGLAADFLFGRFTVFIRD
SELSHRVFANVRADAFHVVSHPFGKKLFGEHNLVYLVGEEHKDLRRRIAPNFTPRALS
TYAVIQQRVIISHLRRWLDRSASNGGKAEPIRVPCRDMNLETSQTVFVGPYLTEKARE
RFDRDYNLFNVGFITLPVDLPGFAFRRARLAGARLMHTLGDCARQSRQRMLGGGEPEC
LLDYLMQETVREI
DEATAAGL 
PPPPHTSDVEVGALLFGFLFAAQDASTSSLCWAVSAL
DSHPNVLARVRAEVAALWSPESGEPITAEMMSAMKYTQAVAREVVRYHPPATLVPHIA
VEAFQLTAQYTIPKGTMVFPSVYESSFQGFQDADAFDPDRFFSEARREDVVYKRNFLA
FGAGPHQCVGQRYALNHLVIFMALFVSLVDFRRERTEGCDVPVYMPTMVPRDGCVVYL
KQR*


>AP002092b $F CYP710A6 CDS complement(60811..62349) = AP002093b comp(104342-105880) 
MVESFHGLVVVDLRTAAPLLATAVALYILIEQLSYHRKKGSMPG
PPLVVVPFLGSVTHLFRDPVGFWDLQATRASKSGAGLTADFLFGRLMVFIRDSELSRR
VFANVRADAFHLVGHPFGKKLFGDHNLIYMVGKEHKDLRRRIAPNFTPRALSTYAVIQ
QRVILSHLRRWIDRSVANGGKAEPIRVPCRDMNLETSQTVFVGPYLTVETRERFDRDY
NLFNHGFITLPIDLPGSAFRRARLAVPRLKHILEDCARQSKQRMRGGGEPECLVDYLM
QETVREIDEAAAAGLPPPPHTSDMETGNLLFDFLFAAQDASTSSLCWAVSALDSHPDV
LARVRAEVAALWSPESGEPITAEMMTEMKYTQAVAREVVRYWPPGPVVPHIAGEAFQL
TEQYTIPKGTIVFPSVYESSFQGFPDAGTFDPERFFSEARREDVVYKRNFLAFGAGPH
QCVGQRYALNHLVIFMALLASLIDFRRERTEGCDVPVYMPTIVPRDGCVVHLKQRCAK
LPSF

>AP002092c $F CYP710A7 CDS complement(80797..82311) 61% to 71A10
MVDSLLYGLLDLRMAAPLLAAAVALYVLVEQLSYHRKKGSLPGP
PLVVPFIGSATHMIRDPTGFWEMQAARARKSGVGFTADFLAGKFTIFIRDSELSNRVF
ANVRPDAFFVIGHPFGKKLFGDHNLIYLFGDDHKDLRRRMATNFTPRALSTYAAIQQR
GIVSHLRRWLDRSAANGGKAEPIRVPCRDMNLETSQTVFAGPYLTEEARERFKSDYNL
FNVGLLAFPVDLPGLAFRRARQAVARLVRMLRDCARESKARMRAGGEPECLVDYWMQE
TVREIDEAKAAGLPPPAHISDDEEIGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVL
ARVRAEVASLWSPDSGEPITADKIAEMKYTKAVAREVVRHRPPATLMPHIALQNFQLT
ESYTIPKGTLVLPSMYESSFQGFHDPDAFDPERFFSEARREDVVYKRNFLAFGAGPHQ
CVGQRYALNHLVIFMALFVSLVDFRRERTEGCDVPVYMPTMVPRDGCVVYLKQR*

>AP002093d $F CYP710A8 CDS complement(143977..145503) 65% to 710A1
MAAVVDFLDLRAAAPFVVAALAFYFLVEQLSYHRKKGPLPGPPL
VVPFVGSVAHMIRDPTGFWDAQAARARKSGAGLAADFLIGRFVVFIRDSELSHRVFAN
VRPDAFHLIGHPFGKKLFGDHNLIYMFGEDHKDLRRRIAPNFTPRALSTYAAIQQRVI
LSHLRRWLDRSAANGGKAEPIRVPCRDMNLETSQTVFAGPYLTKEAREKFERDYNFFN
VGLMALPVDLPGFAFRSARLGVARLVRTLGECARASKARMRAGGEPECLVDFWMQETV
REIDEAKAAGKPPPAHTDDEELGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVLAGV
RAEVASLWSPESGEPITAEKIAEMKYTQAVAREVVRHRPPATLVPHIAGEEFQLTEWY
TIPKGTIVFPSVYESSFQGFPEPDTFDPERFFSEARREDVVYKRNFLAFGAGPHQCVG
QRYALNHLVLFMALFVSVVDFRRDRTEGCDEPVYMPTIVPRDSCTVYLKQRCAKFPSF*

>aaaa01036102.1 CYP710A9P (indica cultivar-group) 91% to AL713941.2
PGWCACSARLGVLRLVCTLGEGA*V 1222
1221 SKARMRADGEPEYLVDYWMQETVREIDEAKAARKPPP 1121

>AC108884.1 CYP710A10P (japonica cultivar-group) chr 10 inside another predicted gene
AHTEDEELGGFLFVTQDMSISSLCWPMSALYSYPDMLTRV 62132

>AP003254a $F CYP711A2 60% to 711 no indica ortholog found on 9/6/02
MEISTVLGAILAEYAVTLVAMAVGFLVVGYLYEPYWKVRHVPGP
VPLPLIGHLHLLAMHGPDVFSVLTRKYGPIFRFHMGRQPLVMVADAELCKEVGVKKFK
NFPNRSMPSPITNSPVHQKGLFFTSGSRWTTMRNMILSIYQPSHLATLIPSMESCIER
AAENLEGQEEINFSKLSLSFTTDVLGQAAFGTDFGLSKKLASSDDDEDTRKIAADTCA
EAKASSEFIKMHVHATTSLKMDMSGSLSIIVGQLLPFLHEPFRQVLKRLRWTADHEID
RVNLTLGRQLDRIVAERTAAMKRDPAALQQRKDFLSVMLTARESNKSSRELLTPDYIS
ALTYEHLLAGSATTAFTLTTALYLVAKHPEVEEKLLREIDGFGPRDRVPTAEDLQTKF
PYLDQ
VLKEAMRYYPSSPLIARELNQQLEIGGY
PLPKGTWVWMAPGVLGKDPKNFPEPEVFRPERFDPNGEEEKRRHPYALFPFGIGPRAC
IGQKFAIQEMKLSAIHFYRHYVFRPSPSMESPPEFVYSIVSNFKNGAKLQVIKRHI

>AP003254b $F CYP711A3 82% to seq on same contig
MEIISTVLGSTAEYAVTLVAMAVGLLLLGYLYEPYWKVRHVPGP
VPLPFIGHLHLLAMHGPDVFTVLARKYGPVFRFHMGRQPLVMVADAELCKEVGVKKFK
SIPNRSMPSAIANSLINQKGLCFTRGSRWTALRNMIISIYQPSHLASLIPTMQSCIEC
VSKNLDGQEDITFSDLALGFATDVIGQAAFGTDFGLSKISASSNDDDIDKIATDTSAE
AKASSEFIRMHVHATTSLKMDLSGSLSIIIGQLLPFLQEPFRQVLKRIPWTADHEIDH
VNLALGGQMDKIVAERAAAMERDQAAPHAQQRKDFLSVVLAARESNKSWRELLTPDYI
SALTYEHLLAGSATTAFTLSTVLYLVSKHPEVEEKLLREIDGFGPHDHAPTAEDLQTK
FPYLDQVVKESMRFYFLSPLIARETCEQVEIGGYALPKGTWVWLAPGVLAKDPKNFPE
PEVFRPERFDPNGEEEKRRHPYAFIPFGIGPRACIGQKFSIQEIKLSVIHLYRNYVFR
HSPSMESPLEFQYSIVCNFKYGVKLRVIKRHTA

>AP003378.1b $F CYP711A4 chromosome 1 clone P0047E11, 64% to 711A one in frame stop
82666 MDISEVLGATAEWAVTLVAMAVGLLVVAYLYEPYRKVWHVPGPVPLPLIGHLHLLAMHG 82842
82843 PDVFSVLARKHGPVFR 82890 (2)
83176 FHMGRQPLIIVADAELCKEVGVKKFKSIPNRSMPSPIANSPIHKKGLFFIR 83322 (2)
83850 GPRWTSMRNMIISIYQPSHLASLIPTMESCIQRASKNLDGQKEITFSDLSLSLAT 84014
84015 DVIGLAAFGTDFGLSKLPVTPDDSNIDKIAADTSVEAKASSEFIKMHMHATTSLKMDLS 84191
84192 GSLSILVGMLLPFLQEPFRQVLKRIPGMGDYKIDRVNRALKTHMDSIVAEREAAMEHDLA 84371
84372 ASQQRKDFLSVVLTARESNKSSRELLTPDYISALTYEHLLAGSTTTAFTLSTVLYLVAKH 84551
84552 PEVEEKLLKEIDAFGPRYCVPMADDLQTKFPYLDQ (0)
      VVKESMRFYIMSPLLARETLEQVEIGGYVLPK 84848 (0)
85342 GTWVWLAPGVLAKDPKNFPEPEIFRPERFDPNGEEERRRHPYAFIPFGIGPRVCIGQKF 85518
85519 SIQEIKLSMIHLYRHYVFRHSPSMESPLEF*FAIICDFKYGVKLQAIKRHHA* 85677

>AP005826.1 CYP711A5  Download subject sequence spanning the HSP Oryza sativa 
MQASSMEASNCSIALEISHV
ATPGLPVLLLGSSLALLAVFLVYFYAPFWSLRTVPGPPTRFPIGHLHLLAKNGPDVFRAITKEYGPIFR
FHMGRQPLVIVANAELCKEVGIKKFKDIRNRSTPPPNVGTLHQDALFLTR
DSTWSSMRNMVIPLYQPARLAGLIPTMQSYVDALVDNIAGCPDQDCIPFCQLSLCMAID
IIGKTAFGIEFGLSRKAADTAAGDDGDGDDDDDVKEFLREYKKSMEFIKMDLSS
SLSTILGLFLPCVQTPCKRLLRRVPGTADYKMDQNERRLCRRIDAIIAGRRRDRDA
GDGAALDFIAALLDARESGGGGHGGFALEDRHVRALAYEHLIAGTKTTAFTVSSVVYLV
SCHPRVEERLLREIDGFAPRGRVPGADELHAGLPYLNQVIKEAMRFHLVSPLIARETSEP
VEIAGHLLPK (0)
GTYVWLAPGVLARDAAQFPEPEEFRPERFAAGAAEERARHPYAHIPFGIGPRACVGHRF
ALQQVKLAAVGLYRRYVFRHSPAMESPLQFDFDLVLAFRHGVKLRAIKR

>AP005456.1 CYP711A6 (japonica cultivar-group) lower case not japonica chr 6 46633 MEALVAAAAAAARDQPWLLLPWSWLAGVV
      VVVVYFYAPWWGVRRVPGPAALPVVGHLPLLAAHGPDVFAVLAKKYGPIF 46397
46254 RFHLGRQPLVIVAEAELCKEVGIRQFKSIANRSLPAPIAGSPLHQKGLFFT 46102
45532 RDARWSAMRNTII 45494
45492 TLYQPSHLAGLIPTMHSCLSRAADAIAG 
45407 ADQRDVDFSDLSLKLAPDVI 45348
81 GQAAFGTDFGLS 116 
asgpgceaaefire FROM ZEA MAYS CG452593
215 HVHATTSLKMDMSGSLSII 271 
lglvapalqvparrllsr 112 
112 patadwrtaranerlrarvgavv
44350 SRRERAAGEARQARGDFLSAVLNARDGGSDRMRALLTPDYVG
ALTYEHLLAGSATTAFTLSSAVYLVAGHPGVEAKLLDEVDRFGPPDAVPTADDLEHKFPYLDQ 44039 
VIKEAMRFYTVSPLIARETSEQVEVGGYTLPK 
43324 GTWVWLAPGVLSRDEAQFRDAGEFRPERFDAGGEEERRRHAYAHVPFGLGPRACPGRRFA 43145
43144 L 
43140 QEVKLAMAHLYRRFVFRRSPRMESPPELQFGMVLSFRRGVKLTAVERRHAAAA* 42979

>AP005099.1 $F CYP714B1 (japonica cultivar-group) chromosome 7 44% to 714A1
AQ258184.1 nbxb0019H10f
73606 MVVVVAAAMAAASLCCGVAAYLYYVLWLAPERLRAHLRRQG
73483 IGGPTPSFPYGNLADMRSHAAAAAGGKATGEGRQEGDIVHDYRQAVFPFYENWRKQY 73313 (1)
70996 GPVFTYSVGNMVFLHVSRPDIVRELSLCVSLDLGKSSYMKATHQPLF 70856
70855 GEGILKSNGNAWAHQRKLIAPEFFPDKVK 70769 (0)
70616 GMVDLMVDSAQVLVSSWEDRIDRSGGNALDLMIDDDIRAYSADVISRTCFGSSYVKGKQI 70437
70436 FDMIRELQKTVSTKKQNLLAEMTGLSFLFPKASGRAAWRLNGRVRALILDLVGENGEEDGG
      NLLSAMLRSARGGGGGGGEVAAAAEDFVVDNCKNIYFAGYESTA
      VTAAWCLMLLALHPEWQDRVRDEVQAACCGGGGRSPDFPALQKMKN (0) 69984
69906 LTMVIQETLRLYPAGAVVSRQALRELSLGGVRVPRGVNIYVPVSTLH 69766
69765 LDAELWGGGAGAAEFDPARFADARPPLHAYLPFGAGARTCLGQTFAMAELKVLLSLVLCR 69586
69585 FEVALSPEYVHSPAHKLIVEAEHGVRLVLKKVRSKCDWAGFD* 69460

>aaaa01009691.1 $PI CYP714B2 (indica cultivar-group) ortholog of AQ856705.1
6272 GPIFTYSMGNVVFLHVSRPDVVRDINLCVSLDLGKSSYLKATHEPLFGGGILKSNGEAWA 6093
6092 HQRKIIAREFFLDKVK 6045 (0)
     GMVDLMVDSAQTLLKSWEEGIDKNGGTIDIKIDDDIR 5260
5259 AYSADVISRTCFGSSYIKG 5203
5203 AELKTLISLIISKFVLKLSPNYEHSPTLKLIVEPEFGVDLSLTRVQGAYRH* 5048

>aaaa01013573.1a $FI CYP714C1
3100 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 
     RQELKFSQKQGTNNFISTLFPHFLLCRETYGMHML 3384 (?)
4290 GPVFLYSTGALEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTEN 
     GDEWAYQRKIIAPEFFMDKIK (0?) 4517
4616 MIQLIEDATVTVLEAWEDMIDDVGGCREIVVDDYLRNLSADVIARACFGSSFTEGEEIFC 
     KLRQLQKAIAQQDSFVGLSALW 4861
5156 KYLPTKSNQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLLNAIIDGAQDGRSAAEA 
     EDFIVGNCKTIYFGGHE STVVTAIWCLMLLATHSEWQERARSEAMEVCRGRSTLDVDA 
     LRRLKI 5515 (0?)
5611 VTMVIQETLRLYPPASVMMQEALTDVKLGNIEVPRGTIVQVPRLMLHLDKEAWGAH 
     ADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMAELKVVLARLLTKFAFSPSP 
     RYRHSPAFRLTIEPGFGLPLMVTKLP* 6033

>AK066943.1  CYP714C2 UniGene info Oryza sativa (japonica cultivar-group) cDNA 350 MELFSSQQWLALLPPIILCILLFSYVYIILWLRPERLRQKLRSQGVRGPKPSFLFGNIAEMR 535
536 RIQQLAKSAHEQEAGSTDMFSSNYVATLFPYFLHWSRVYGSIYLYSTGSIQVLNVTDPNM 715
716 VKELANCKSLDLGKPCYLQKERGALLGMGILTSNGDLWVHQRKVIAPELFMERVKGMVNL 895
896 MMEAAMSMLNSWKNEVEDRGGSAEIVVDEFLRTFSADVISRACFGSSFSEGKEIFIKIRQ 1075
1076LQKAMAKQSMLIGVPGSRYLPTRSNRGIWNLDSSIRTLILN 1198
1199ISKKYEHDSSTSVNKDLLHSIIQGSKDGPFASCTPEDFIVDNCKNIYFAGHETTSTTAAW 1378
1379CLMLLASHHEWQSRARVESLDICQGRPLDFDILRKLKKLTMVIQETLRLYPPASFVAREA 1558
1559LNDMKLGGIDIPKGTNIWIPIAMAHRDPSVWGPSADKFDPDRFANGIAGACKPPHMYMPF 1738
1739GVGVRTCAGQNLAMVELKVVLSLLLSKFEFKLSPNYVHCPAFRLTIEPGKGVPLIFREL* 1918

>aaaa01004558.1 $FI CYP714C3 (indica cultivar-group) 96% to AAAA01013573.1 43% to 
7614 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 7793
7794 RQELKLSQKQGTNNFISTLFPHFLLWRETYGMYML 7898 (?)
8802 GPVFLYSTGAMEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTENGDEWA 8981
8982 YQRKIIAPEFFMDKIK 9029 (0?)
9125 GMIQLIEDATVPVLEAWEDMIDDEGGCREIVVDDYLRNLSADVIARAC 9268
9269 FGSSFTKGEEIFCKLRQLQKAIARQDSFVGLSALW 9373
9674 XYLPTKSSQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLVNAIIDGAQDGRSAAEAEDFI 9850
9851 VGNCKTIYFGGHESTAVTAIWCLMLLATHPEWQERARAEAMEVCRGRSTLDVDALRRLKI 10030
     VTMVIQETLRLYPPASVMMREALTDVKLGSIEVPRGT 10259
10260 IVQVPRLMLHLDKEAWGADADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMA 10439
10440 ELKVVLARLLTKFAFSPSPRYRHSPAFRLTIEPGFGLPLMVTKLP 10574

>AC137619.1 CYP714D1 (japonica cultivar-group) chromosome 5
111923 MESFFVFFTAAALPVVVAAAVIAGLCITAAWLARPRRVAEVFRRQGIDGPPPSSFLAGNL 112102
112103 PEMKARVAAAASAAAPTADGEETASAGGGGGGRDFEKDGFDDYCTRIFPYFHKWRKAY (1) 112276
120151 GETYLYWLRRRPALYVTDPELIGEIGRCVSLDMGKPKYLQKGQEPLFGGGVLK 120309
120310 ANGACWARQRKVIAPEFYMARVRAMVQLMVDAAQPLIASWESRIDAAGGAAAAEVVVDGD 120489
120490 LRSFSFDVISRACFGSDYSRGREIFLRLRELSGLMSETSVIFSIPSLRHLPTGKNRRIWR 120669
120670 LTGEIRSLIMELVRERRCAARAAREHGGKAAPPSPPERDFLGSIIENSGGQPRPDDFVVD 120849
120850 NCKNIYFAGHETSAVTATWCLMLLAAHPEWQDRARAEVLEVCGGDGAAAPAAPDFDMVSR 121029
121030 MRTVGMVVQETLRLFPPSSFVVRETFRDMQLGRLLAPKGTYLFVPVSTMHHDVAAWGPTA 121209
121210 RLFDPSRFRDGVAAACKHPQASFMPFGLGARTCLGQNLALVEVKTLVAVVLARFEFTLSP 121389
121390 EYRHSPAFRLIIEPEFGLRLRIRRAGGQDATSQVDTSTAPVHSSHN* 121530

>aaaa01023188.1 CYP714D2 (indica cultivar-group) 45% to 72B
2708 KGTYLFVPVSTIHHDVAAWGPTARLFDPSRFRDGVAAACKHPQASFMPFGL 2556
2555 SARTCLVQNLALVEVKTLVAAVLGRFEFTLSPE FGLRLRI 2436

>AP004026.1 $F CYP715B1 chromosome 2 clone OJ1136_C04, 52% to 715A1
88341 MELVVQALAAAAALLAVFFLSTLYLSPAATARRLRNAGFRGPTPSFPLGNL
      REIASSLASNNDTDESNTKGGDIHAAVFPYFARWRRA
88605 FGKVFVYWLGTEPFLYVADPEFLKAATAGALGKLWGKPDVFRRDRMPMFGRGLVMAEGDE 88784
88785 WARHRHIIAPAFSATNLNDMIGVMEETTAKMLGEWGDMVASGRSCVDVEKGVVRNAAE 88958
88959 IIARASFGISADDDDATGARVFHKLQAMQAILFRSTRLVGVPLAGLLHIRAT 89114
89115 YEAWKLGREIDALLLDIIESRRRREGGGGGKKKKKTTSNDLLSLLLAGSEASAGAERK 89288
89289 LTTRELVDECKTFFFGGHETTALALSWTLLMLAAHPEWQAAVREEVVEVAGRSGPLDAAA 89468
89469 LGKLTKMGCVLSEVLRLYPPSPNVQRQALQDVVVVAGDGEKKVVIPKGTNMWIDVVAMH 89645
89646 RDGELWGEEASEFRPERFMREGVQGGCRHRMGYVPFGFGGRICVGRNLTAMELRVVLAM 89822
89823 VLRRFAVEVAPEYRHAPRIMLSLRPSHGIQLRLTPLC* 89936

>AP003727.3 $P CYP715B2P chromosome 1 clone:P0672D08 Pseudogene fragment 
NRMPMFGRGRVMAEGDEWARHRCIVAPAFSATNLN
DMIGVMEETTSKMLGEWSDIVALGHSCIDIEKGVVRNAAEIIAKASFSIAADDATVFHK (frameshift)
VRLVSVPLASLLHIRADRATYEAWKLGRKIDALLLDIIESRRRCEGGGRK
TTTTDLLWLLLAGNEASAAAERKLTTALALSWTLLMLATHPEWRAAVRE 
EVEEVTGWSGPMDAAAMGKLTKMGCMLNEVLRLYPPSPNVQRPAACDAEV

>AP004365.1 $P CYP715B3P chromosome 1 clone P0458E05, Length = 194415
184935 ETTSKMLGEWSDMVVSG*SCIDIEKGVVWNAAEIIAKASFGIGTDDDATGAGVFHKLQAMQAMLFRSTRLVGVP 
       RANYEAWKLGREIDALLLDIIESRRHXXXXXXXX 
       TNDLL*LLLGGNKASAGA 
184557 ERKLTTRELVDECKTFFFXXXXXXXXX 
184108 LSWTLLMLAAHPEWQAAVREEVVEAAGRSGLLDAAALGKLTKMGCVLNEVLRLYQPSPNVQRQALQDVVV 183902

>AP004123.1 $P CYP715B4P chromosome 2 clone OJ1654_A02, related to AP004026.1 dashes 
indicate deletions, missing N and C-terminal sequences
GAFGKL*GKPAVFRHDRMP 
MFGRGRIMAEGDEWARHRCIIAPAFSATNLN
DTIGVMEETTSKMLGEWSDMVALGHSCIDIEKGVVRNAAEIIAKANFSIAAADATVFHK 
LQAMLFHST 
RLVGVPLASLLHIRATYEAWKVGRKIDALLLDIIDSRRRREGGG
MK 
EVEEVTGWSGPMDAAVMEKLTKM
GCMLNEVLRLYPPSPNVQRPAACDAEV

>AC104708.1a $F CYP721B1 two 72A like seqs 46% to 721
27908 MAALLGILLAAFLAAAAVLFALRLLHSFLWVPRRLERRFRRQGIRGPPRRPLSGNAAGY 28084
28085 RDLLAAAQSAPLASFHHAVVARVAPHHREWPERYGRPFVFWLGPRPRLVVSDPEVVKAVL 28264
28265 TDTTGTFGKAGPGGNNPLARQLFSEGLVGLTGEAWARHRRVIAPAFNMERVK 28420 (0)
29030 AWIPEITSITSSMLDKWELQDEVRTEFEIDVNKEFHTLIADVISCVAFGSSYEEGKRVFQLQ 29215
29216 EEQLKLVILAMRTVYIPGFR 29272 (2)
29354 FVPTKKNQRRKIVNQEIRNSLRKLIEINGRKCEDSNNLLGMMLSASKIDSEF 29509
29510 KMGIEEIIDECKTFYFAGKETTATLLTWATLLLALHQEWQNKARDEVLQVCGKYEHPKAE 29689
29690 NLSELKI 29710 (0)
29798 VNMVLKETLRLYPPAVFLNKIANRDVKLGKLDIPAGTQLQLPILDIHHDVSIWGADADEF 29977
29978 DPSRFAEGKSYHLGAYFPFGIGPTICVGQNLAMVEAKVALAMILQRFALVVSPSYVH 30148
30149 APMLVVTLQPQYGAQVLVHKI* 30214

>AC104708.1b two $F CYP721B2 72A like seqs
41941 MAALLGILLVAFLAAAVPFALRLLHSFLWVPRRLERRFRRQGIRGPPRRPLSGNAAGYRDLLA 42129
42130 AAQSAPLASFHHAVVARVAPHYREWPERYGRPFVFWLGPRPRLVVSDPEVVKAVLTDPTG 42309
42310 TFDKAGSGGGNPLARQLFGEGLVGLTGEKWARHRRVIAPAFNMERIK 42450 (0)
43002 GWISEITAITSSMLDKWEVQDEARAEFEIDVHKEFHTLIADVISSVAFGSSYEEGKRVFELQEEQLKLAI 43211
43212 LAMTTVYIPGFR 43244 (2)
43277 FVPTKKNRRRHMLNQEVRNSLRKLIEINGRKC 43435
43436 EDSNNLLGMMLSASKLGSEFRMGIEEIIDECKTFYFTGKETTANLLTWATLL 43591
43592 LALHQEWQNKARDEVLQACGKSEHPNAENLSNLKI 43696 (0)
      VNMVLKETLRLYPPAMFLNRMVNRDVKLGKLDIPAGT 43909
43910 QLHFPILDIHHDVNIWGTNADEFDPSRFAEGKSYHLGAYFPFGIGPTICVGQNLTMV 44080
44081 EEKVALAMILQRFALVVSR 44137 
44137 SYVHAPMHGVTLQPQYGAQVLAHKI* 44214

>AC073405.2 $F CYP722B1 chromosome 5 clone P0036D10, complete sequenceLength = 156772 
      MESLAAGAWWVVVLLLLVLTIVASWYRSWWKTTEAGGPLLPPPAAGAGPWWVWVWQWR
72407 ETAAFLASHGSGRGFYHFVQERYKLYKGEGEGEATCCFRTALMGRVHVFVSASHPAASQL 72228
72227 LTAEPPHLPKRYARTAADLLGPHSILCSTSHAHHRHARRALATTLFATPSTAAFAAAFDR 72048
72047 LVIRHWTTLLPPHNQNQVVVVLDAALHISYRAICEMLLGAGGGKLRPLQSDVFAVTQAM 71871
71870 LALPLRWLPGTRFRRGLHARKRIMAALREEMAARNHHHHHHHHHHDLLSVLMQRRQLGH 71694
71693 PDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLSDNRLIQDKLR 71556
      AEAFRLELKGDYSLTMQHLNAMDYAYK
71216 AVKESLRMATIVSWFPRVALKDCQVA 71139
70844 GFHIKKDWIVNIDARSLHYDPDVFDNPTVFDPSRFDV 70734
70609 QPQKRRLLVFGAGGRTCLGMNHAKIMMLIFLHRLLTNFR 70493
70397 WEMADDDPSLEKWAMFPRLKNGCPILLTPIHNS* 70296

>AL662964.1b $F CYP723A2 chromosome 4 clone OSJNBa0027H09, Length = 155601
104753 MMLLLTLLLVLTLFLCLAVFRRTTSRARRAPVSLRQPTVEIHDGDVARRALLDHADAFVNRP 104938
104939 AIGAEPRGRRSDNLTTVRYGPQWRVLWRNLTAGFLRPSRVGLLAPLQQKAVDAL 105100
105101 VADIAARGADGGEVGVRDVVHDALFPLAVRFCFGDDIDERHVRDLRRVMQELKLDVVVK 105277
105278 GFSGSMLANLVHWWRLRRFIASGRRRAEIFLPLIAQRRRTQHRDADGGVF 105427
105428 RPYVDSLLDLRVPVGHDADADAAGCEDNEGRNSGRALTDDEMVGLVAEFLSGGTETVVSC 105607
105608 VEWTLAHLVIEPEIQDKLCRQVVAAADHHGGERGTTPAYLRAVILESLRMHPPVPLTMRD 105787
105788 VRSPQAVEHLSLPDGGARVHFILGDIGRDGKAWTDPDEFRPERFMAGGEAEGVG 105949
105950 PLPGPREVRMMPFGAGRRYCPGMGLGVAHACLLVAALVREFEWAPTAVAATGGVDLTEVN 106129
106130 GFFKMMRTPLRARATPRGTSA* 106195

>AL662964.1a $F CYP723A3 chromosome 4 clone OSJNBa0027H09, Length = 155601
91854 MDTSVLLLVLFVFTLLCCLALLRRAARAPAAV
91950 QLPTIEISDAAVARRALVDYADVFANRPFLPFPVALVTGRRRRRSDNLTSVPYGPHWRVL 92129
92130 RRNLTAGIFHPSRLGLLAPLQRDAVDDLVAGISESAAGGAVPVVVRDVAYAAVFRLAARM 92309
92310 CFGDGVGERQVRALRRVIREFVLDVGVANNVFPVSTSTALARLRRWRRIRRLLSSRR 92480
92481 RQAELYLPLIDERRRRMAARRRDRDDDGGTFRPYVDALIELRVPGDGESTPAPLTDDEMV 92660
92661 SLLMEFLAASTETVVSCIEWTLAHLVLNAEAQSKLRREVGDGEHVHGRHRGRTPYM 92828
92829 RAVILESLRLHPPVPFVIREVVGGAAPPVLDELAAMPMPGGGARVHFVIGDIGR 92990
92991 DSKAWRDPKEFRPERFMAGGEAEGVGPVPGPKEVRMMPFGAGRRSCPGMGVAMAHVGLF 93167
93168 VAALVREFEWTPAAGGGVDLTQQDDFFNVMRTPLRARATPRPRAPA* 93308

>AC097280.1 $P CYP723A4P chr 3 clone OSJNBb0111B07, Length = 129338 New like 89A7 missing N-terminal and K-helix region
      PQQQAAVEALVVDIAARVGGG
83429 SGSDGEVLIRDVVHDTLFPVAAWFCFGERDVRDLQRVLREFELDVVVEGFGGSMLANLV 83605
83606 HWWRLRRFVASGRRQAEVFLPLISQQRRTQHRGEHKFCPYVD 83731 83732 SLLDLRVPVGDNAAAGEGKEEHRLSHCALTDDEMVGLVSEFLGSGTEST 83879 
83878 RVEHLSLPSGGVRVHFILGDIGRDGKAWTDPDEFRPDRFMASGEAEGVSPLP 84033
84034 RPKEVRMMPFGAGRRYCPSMGLGVAHACLLVAALVREFEWAAAATSGVELMEGER* 84201

>AL606588.1 $F CYP724B1 chromosome 4 clone OSJNBa0016O02 = D15214 AQ576430 nbxb0089K21f 85 clan 50% to 724A1 ortholog of aaaa01001005.1
165880 MVGGELVLAALVILLALLLTLVLSHFLPLLLNPKAPK
165769 GSFGWPLLGETLRFLSPHASNTLGSFLEDHCSR 165671 (2)
165313 YGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSSMLVVLGEDH 165137
165136 KRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFCEEARK 164999 (0)
164739 FAFSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKA 164587 (0)
164467 ARARISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGYETTSLLISMVVYFLGQS 164255
164254 AQDLELVK (0) 
       REHEGIRSKKEKDEFLSSEDYKKMEYTQH 164042 (0)
163752 VINEALRCGNIVKFVHRKALKDVRYK 163675 (1)
163488 EYLIPSGWKVLPVFSAVHLNPLLHGNAQQFQPCRWE 163381 (0)
162923 GASQGTSKKFTPFGGGPRLCPGSELAKVEAAFFLHHLVLNYR 162798 (2)
162134 WRIDGDDIPMAYPYVEFQRGLPIEIEPLCSES* 162036

>AP003765.1 $F CYP727A1 = AQ574081 = AP003832 37701-42682
orth aaaa01000152.1
140359 MASPCEHHVPYTLLGALLSGGGPHAAACGGAAFLRDYAERGTNALL
       WAALLAVTWLLVLRLAALLRLWALGARLPGPPAFPADPGLAAGDIT (1) 140634
142650 GYLSKLHGSYGPVVRLWLGPSQLLVSVKDSRVIKELLTKAEDKLPLTGKTYNLACGKLGLFISSFEK (0) 142851
143011 VKSRRESLKSFLDEKLSVGTGGSSFKIIQIVLDRVDSIMARDFLDCRYFSQHMAFNIVGSAL
       FGDAFFDWSDASAYEELMMTVAKDACFWASYAVPPFWKPDYRRYRTLCARLKLLTQGIVAKS
       RNQNGVLSLIDLSSCQRSERMIKDPCRGFSLLDGVISSRCLNEAAEGPLSSEEEICGNIMGL
       MLHGISTCANLIGNILTRLALYPNLQCQ 143652 (0)
144033 LHSEIVSGHSESSELKIDDVLRMKFLLATVCESARLLPAGPLLQRCSLQQ 144182 (1)
144578 DVNLNSSITIPAGAILVIPLHLVQMEASTWGNDACQFNPNRFLKKEINFE 144721 (1)
144825 EILAAAHKGSNGINLFTDECDKTESFLPFGSGSRACVGQKFAVLGIAMLIASLLRSYE 144992 (0)
145233 VQPHPALSQEMESLVDSNSLHHIPNPKIILKKRSI* 145340

>aaaa01016714.1 CYP728A1 (indica cultivar-group) runs off end, one frameshift
MDASAMLVALLTILATAAAVASSSLRRRKNQPPGSLGLPVVGHTLALLRALRSNAA (fs)
RAAAYGPVSTISLFGRPTAFL 4604
4605 AGASCNKLLFSSDKLAAMSSASFLRMVGRRNIREVAGDDQRRVRAMMARFLRL 4763
4764 DAVKNYVSAMDDEVRRHLRAEWGGRAAVAVMPSMKSLTFDVMCTVLFGLERRGDHAAVRR 4943
4944 ELSSEFQQLVRGIWAVPVNLPFTTFGKCLAASRRGRRAVARIVE 5075
5076 ERRRAMPRGGGGGGSAGDLVTHMLAEGMDEEEIIDNVVFLMVAAHDTTAV 5225
5226 LLTFLLRHLDGNRAAYERVAAEQEAIATQRRRRGGSGSGSGSALTWDDLAGMRYTWAAAM 5405
5406 ETLRMVPPTFANMRKAVADVEVGGYVIPKGWQVITAATMTHLDPTIFPDPGRFEPARFE 5582
5583 AAAAKSAPPPFSYVPFGGGARACPGNEFARAETLVAMHYIVTGFRWRLAAGCD 5741
5742 GGFSRHPLPCPNQGLLLDIEPKE 5810

>aaaa01041819.1 CYP728A2 (indica cultivar-group) 96% to AAAA01016714.1 $FI
411 AMLVALLTILAAAAAAAVASSSLRRRKNQPPGSLGLPVVGHTLALLRALRSNAAEDWLHR 232
231 RAAAYGPVSTISLFGRPTAFLAGASCNKLLFSSDKLAAMSSASFLRMVARRNI 73

>AP003850.1i $F CYP728B1 chromosome 7 clone OJ1793_E11 gene 7 36% to 716A2 79% to 
65671 MALAVVVVALLVAFLTPLAVYLAGRSTRTKPPPRRNLPPGSLGLPLVGQSLSLLRAMRRNTAER 65862
65863 WLQGRIDRYGPVSKLSLFGAPTVLLAGPAANKAVFLSEALAPKQPRSLAAIIGRRNMLEL 66042
66043 VGDDHRRVRGALAQFLRPEMLRRYVGRIDGEVRRHLAGRWAGRRTVAVLPLMKLL 66207
66208 TLDVIATLLFGLARGAVRERLAAAFADMLEGLWAVPLDLPFTAFRRSLRASARARRL 66378
66379 LAATVREKKANLEQGESSPSDDLISYLVSLRDGDGGGGRPLLTEEEIIDNSIVCLTAGHD 66558
66559 TSAILLTFMVRHLADDPAILAAM (0) 
      HEEIARSKRD 66738
66739 GEALTWEDVARMKLTWRVAQETLRMVPPVFGSFRRALEDVELDGGYVIPKGWQVFW 66906
66907 APCVTHMDPAIYHDPDKFDPSRFDAQAAASAPPPYSFVAFGGGPRICPGMELARVETLV 67083
67084 TMHYLVRHFRWRLCCGGEENTFVRDPLPSPANGLPVELDHIAPLRCDEFNS* 67239

>AP004051.1 $F CYP728B2 chromosome 7 clone OJ1218_C12 79% to AP003850 gene 7
27221 MAVVAVAVVIALLAAFLTPLAVYLARRASPPPP
27122 PRRNLPPGSLGLPLIGQSLSLLRAMRRNTADRWLQDRIDRYGPVSKLSLFGAPTVLVAG 26946
26945 PAANKVVFHHEALAPKQPRSLAAIIGRRNILELVGDDHRRVRGAILQFLRPDMV 26784
26783 RRYVGKIDSEVRRHLAARWAGRRTVAVFPLMKTLAFDVIATLLFGLDRGAIREQLA 26616
26615 DAFDGMHEGLWTVPVDLPFTPFRRGLMASARARRLVEATVREKAAKLEH 26469
26468 GESSPSDDLISCLLSLRDGGRQLLTEEEIVDNSVLALVAGHDTSAVLLTFMLRH 26307
26306 LANDPATLAAM 26292 (0?) 
      HEEIARGKRDGEALTCEDVAKMKLSWRVAQETLRMVPPVLGSFRRAPVDVEFEGYTI 26017
26016 PRGWQIFWSPSVTHMDPAIFHEPTKFEPSRFDGAAAAAAYSFVPFGGGPRICPGMEL 25846
25845 ARVETLVTAHYLVRHFRWKLCLGEEKNTFLRDPMPTPHDGLPVELDHIAPLC* 25687

>AP005103.1b $F CYP728B3 chr 7 (3 genes on this clone) 1aa diff to aaaa01000381.1a
96908 MEFSLVVALIAVASSCVFVHFLARGATKKRRSPAAKKLPPGSLGLPVIGQSLGLLRAMRS 97087
97088 NSGERWVRRRIDRYGAVSKLSLFGKPTVLVAGAAANRFVFFSGALALQQPRSVQRILGDR 97267
97268 SILDLVGADHRRVRGALSEFLRPEMLRMYVGKIDGEARRHVAGCWSGRAAVTVMPLMKRL 97447
97448 TFDIIASLLFGLGPGAAARDALAGDFERVMGGMWAVPVDLPFTAFRRSLRAAARARRLLA 97627
97628 GITRERKAALERGAATRSSDLIACLLSLTDDRGGAPLLSEEEIVDTAMVALVAGHDTSSI 97807
97808 LMTFMVRHLANDPDTLAAM (0?)
      HEEIARSKRD 97987
97988 GEALTWEDLTRMKLTWRVAQETLRMVPPIFGNFRRALEDIELDGYVIPKGWQVFWVASVT 98167
98168 HMDAAIFHDPDKFLPSRFDSQSSSPSTAKAAPPCSYVAFGGGPRICPGIEFARIETLVMM 98347
98348 HHLVRKFRWKLCCKEDTFARDPMPTPLHGLPIEIEPRISP 98467

>AP003850.1h $F CYP728C1 chromosome 7 clone OJ1793_E11 gene 6 0ne in frame stop codon
60284 MDSSMPFALLLALLIPTLLRFVIRRKY
60365 SSYNLPPGSLGFPLIGQSISLLRALRSNTDYQWYQDRIKKYGPVFKMSLFGSPTVLMAGP 60544
60545 AANHFVFSNQDLIFTQTKAINTILGRSILTLSGEELKRVRSALQGYLRLEMVTKYMRKMD 60724
60725 EEVRRHIDLNWVGHKTVK  (0) 
60884 AAPLAKRLTFDIICSVVFGQGIGPIREALATDFETLVQALLSLPVNIPFTKFIKGLRASRRIRKVLR 61084
61085 QIAREREAALQQGHSSSADDFFTYMLVLRSEGTHSLTVEDIVDNAIV 61225
61226 LLTAGYGNSAVLITFLLRYLANDPDILGKITE 61321 (1)
61420 EQEEIARRKGPNEPLTWDDVSRMKYTWKVALETLRTVPPIFGSFRTAVKDIEYHGYHIPKGWQ (0) 
61762 VFTAQRITHLDGNFFNDPVKFDPTRFDNHTSIPPYCFVPFGGGPRMCPGNEFARTEILVTMH*L 61953
61954 VRQFRWKLCCEEEGYRKDPVPIPVLGLPIELETRSPPEYAHA* 62082

>AP003850.1g $P CYP728C2P chromosome 7 clone OJ1793_E11 pseudogene 5 
48172 SIPPGSLGLPLIGQSLALLRAMP 48240 
48243 RNTAERWLQDRIDRYGPVSKLSLFGAPTVLLAGPAANKVVFLHEALAPKQPRSLATI 48413 
48415 PREEEHPGARQRADAVPQAGDAAAVRGKDRRRGE
48517 VRRHLADRWAGRRTVTVLPLMKTLTFDIIATLLFGLERGAIREQLADAYTGMLEGTQSVP 48696
48697 VDL 48705 
48711 PFTAFRNGLKAIERDGAPAARGDRELREKKANLEEQGKSS 48830
48831 PTDDPISCLVSLRLRRRRRPAAADRWRRRSSITPCSNALVAGHDTSAILLTFMVRHLAND 49010
49011 PATLAAMVQ (1)  
      EHDEIAKSKQEGEALTRE 49190
49191 DVTRMKLSWRVAQESTR 49241 14 
49243 DIEVDGYVIPKGWQAFWSPCVTHMDPAKFLPSRFDAQAASAAPPPPL 49383
49384 P*SFVAFGGGPRVCPGMELARVETLVTTHYLVRHFRWQLCC 49506 
49517 EENTFVRDPLPTPLNGLPVELDRIAPLW* 49603

>AP003850.1f CYP728C3 $F chromosome 7 clone OJ1793_E11 gene 4 
44135 MPFALLLALLIPILLHFVIRRKYSSYNLPPGSLGFPVIGQSISLLRAL 44278
44279 RSNTDYQWYQDRIKKYGPVFKMSLFGSPTVLMAGPAANHFVFSNQDLIFTQTKAINTIIG 44458
44459 RSILTLSGEELKQVRGALQGHLRPEMVTKYMRKMDEEVRRHIDLNWVGHKTVK (0)
      VAPLAKRLTFDIICSVVFGQGIGPIREALATD 44818
44819 FETLVQALLSLPVNIPFTKFNKGLSASRRIRKVLRQIAREREAALQQ 44959
44960 GHSSSADDFFTYMLVLRSEGTHSLTVEDIVDNAIVLLTAGYGNSAVLITFLLRYLANDPDILGKITE 45160 (1)
45259 EQEEIASSRGPNEPLTWDDVSRMKYTWKVALETLRTVPPIFGSFRTAIKDIEYRGYHIPKGWK (0) 
45601 VFTAQSITHLDGNFFNDPVKFDPTRFDNQTSIPPYCFVPFGGGPRMCPGNEFARTETLVTMHYL 45792
45793 VRQFRWKLCCKEEGYRKDPLPMPVLGLPMELETRSPP* 45906

>AP003850.1e $F CYP728C4 chromosome 7 clone OJ1793_E11 gene 3 37% to 725A1 85% to gene 
32688 MSMDSSIPFALLLALLIPILLHVVIRRKYSSYNLPPGSLGFPVIGQTISLLRALHSNTDYQ 32870
32871 WCQDRIEKYGAVSKMSLFGSPTVLLAGPGANHFVFSNQDLIFTETKAINALVGRSILTLS 33050
33051 GEELKQVRGALHGYLRPEMVTKYMRKMDEEVRRHIDLNWVGHKTVT (0)
      VAPLARRLAFDIICSVIFGQGVGPIREALAADFETMVK 33410
33411 AMLSIPVNIPFTKFNKGLNASRRIRKVLRQIARDMEGALQQGYSSSA 33551
33552 DDFFTYMLVLRSKGTHSLTVEDIVDNAIVLLAAGYETSSVLITFLIRCLANEPDIFGKITD 33734 (1)  
      EQEEIARSKGPNEPLTWDDVSRMKYT 33911
33912 WKVALEILRTISPIFGSFRTAIKDIEYRGYHIPKGWQ 34022
34162 VFHAQSITHLDGKFFNDPIKFDPTRFDNQSLIPPYCFVPFGGGPSMCPGNEFPRTETLV 34338
34339 AMHYLVRQFRWKLCCKEEGYRKDPLPTPVLGLPIELETRTPPEYAHA* 34482

>AP003850.1d $F CYP728C5 chromosome 7 clone OJ1793_E11 gene 2 37% to 725A1 59% to Zea 
26522 MDSSMPFALLLALLIPILLHFVIRRKYSSYNLPPGSLGFPVIGQSISLLRAL 26677
26678 RSNTDYQWYQDRIKKYGPVSKMSVFGSPTVLLTGPAANRFVFSNQDLIITETKAANALIG 26857
26858 RSILTLSGEELKQVRSALQGYLRTEMVTKCIRKMDEEVRRHIDLNWVGQKTVT 27016 (0)
27144 VAPLAKRLTFDIICSVIFGQGAGPIREALAADFKKMVQAMLSIPVNIPFTKFNKGL 27311
27312 SASRRVRKVLRQIARDREAALQQGHSSSADDFFTYMLVLRSEGTHSL 27452
27453 TVEDIVDNAILLLLAGYETSSVLITFLLRYLANEPDILGKITE 27581 (1)
27674 EQEEIARYKGPDEPLTWDDVSRMKYTWKVAMETLQTVPPIFGSLRTAIKDIEYQGYHIPKGWQ 27862 (0)
28024 VFTAIIITHLDANFSDDPNKFNPARFHNQSSVPPYCFVPFGGGPRMCPGNEFARTETLV 28200
28201 AMHYLVRQFRWKLCCKDEGYRKDPVPMPLELPIELETRSSPWICLK* 28341 

>AP003850.1c $P CYP728C6P chromosome 7 clone OJ1793_E11 pseudogene fragment end of 
24875 SFTVEDIVDNAIFLLIAGYETTSVLITFIPWHLDKEPEILGK 25000

>AP003850.1b $F CYP728C7 chromosome 7 clone OJ1793_E11 gene 1 36% to 725A1 83% to gene 
22610 MSMDSSMLLALLLALFIPILLHLVTRRKYASYNLPSGSLGFPLIGQTISLLRALRKNT 22783
22784 DYQWYQDRIKKYGPVSKMSVFGSPTVLLTGPAANRFAFCNPDLIFTQTKALNALV 22948
22951 RSILMLSGEELKQVRSAVQGYLRPEMVTKYIWKMDKEVRRHIDLHWVGQKTLT (0)
      VAPLAKRLTFNITCSVFFGEEAGP 23310
23311 IREALATDFEALVKATLSIPVNIPFTKFNKGLSASWRIRKLLSRIARERE 23460
23461 AALQQGRCSSTDDFFTYMIALRSEG 23535 
23535 HTLTVEDIVDNAILLLTAGYETTSVLIIFLLRYLANEPDILGNITE (1) 23672
      EQEEIARNKGPNEPLTWDDVSRMKYTWKVAMETLRTVPAIFGSFRT 23894
23895 AIKDIEYQGYHIPKGWQ 23945 (0)
24091 IFTDQIVTHLDTNFFDGPRKFDPARFHNQSSIPPYCFVPFGGGPRMCPGNEFAKTGTLV 24267
24268 AMHYLVRQFRWKLCCKEEGYRKDPTPMPLLGLPIDLETRSPPGYAHS* 24411

>AP003850.1a $P CYP728C8P chromosome 7 clone OJ1793_E11 pseudogene fragment last half 
14670 SLRYLVRQFRWKLCCKEEGYRNATPMPVLGLPIELETRSPPDYAHA* 14810

>AP005103.1c $F CYP728C9 (japonica cultivar-group) chr 7
123894 MDSSILPALLIALFIPILLHLVTRFKYSSYNLPPGSLGFPFVGQSISFLRALRSNTDHQW 124073
124074 YQGRIGKYGPVSKMWLFGSPAVLMAGPAANRFIFSNKDLLFT 124199
124200 GTRSMNLLSGRNILMLSGEELKQVRGALQNFLSPEMVIRYVSKMDEEVRRHVKVNWVGHK 124379
124380 TVK 124388
124514 TLLDFLVRCKYN 124549
124898 VLPLAKRLTLDIICSVIFGQEAGSVREALATDFPAMVRAAL 125020
125021 SIPVKIPFTRFSRGLSASQRIRKLLRGIARERETLLQQQQAHGASAADDFFTYMLALRAE 125200
125201 GAHSLTVEDIVDNAIFLLIAGYETTSVLITFMLWHLDKEPEVLSKITEGEQ 125353
125446 DEIARNKGPEDALTWDDVSRMKYTWKVAMETVRTIPPIFGSFRTATRDIEYQGYHIPKGW 125625
126005 VFTAQSVTHLDANIFPEPSNFDPARFENNSSIPPYCFVPFGGGPRMCPGNEFARTETLVT 126184
126185 MHSLVTQFRWKLCCKEESYKKDPSPTPLLGLPVELEPRCLPENAHA* 126325

>AP005103.1a $F CYP728C10 chr 7 (3 genes on this clone) 99%
90545 MSMDSSMPFALLLALFIPILLHLVTRHKYSSDNLPPGSLGFPLIGQSISLLRALRSNTDY 90366
90365 QWYQDRIKKYGPVSKMSVFGSPTVLMAGPASNHFVFSNQDLIFTQTKAINVLIGCSIMTL 90186
90185 SGDELKQVRSALQGYLSPEMVTKYVWKMDEEVRRHIDLNWVGHKTIK (0?)
89917 VAPLAKRLTFNIISSVMFGQGAAPFREALAIDFEKVVRAALSIPVNIPFTKFNKGLSASR 89738
89737 RIRKLLRQIAHEREAAFQQGYCSSADDFFTYMLALRSEGKHSLTVEDIVDNAILLLIAGY 89558
89557 ETSSVLITFLIRQLANEPDIL 89495
89393 EQEEIARNKGPNKPLTWNDVSRMKYTWKVAMETLRTVPALLGSFRTATKDIEYRGYHIPK 89214
89213 GWQ 89205 (0)
89055 IFTAQIVTHLDTNFFDEPSKFDPSRFDNLSSIPPYCFVPFGGGPRMCPGNEFARTETSV 88879
88878 AMHYLVRQFRWKLCCK-EGYRKDATPMPVLGLPIELETRSAP 88756

>aaaa01010113.1 $FI CYP729A1 (indica cultivar-group) ortholog of C73729
6784 MSGATADWAWWLGLVAGAVPLLALAVWHCTDAFHSAAFAFRRRGTRAR
     LPPGHMGLPFVGETLALIWYFNLARRPDAFIEAKRRRYCYGDGDDDGGIYRTHLFGSPAV 1481
     LVCSPASNGFVFRSAPPGSFGVGWPVPELVGASSLVNVHGGRHARLRRFVLGAINRPG 1307
     SLRTIARVAQPRVAAALRSWAAKGTITAATEMKN (0) 6185
5443 VTFENICKIFVSMEPSPLTEKIHGWFTGLVAGFRSLPLDMPGTALHHARK (0) 5294
5218 CRRKLNSVFREELERRKVKMVTGEGGDDDDDGDLMSGLMHVEDEQGR
     RLD DDEVVDNIVSLVIAGYESTASAIMWATYHLAKSPSALAKLR 4946 (0)
2321 EENLAIAKEKNGDGFITLEDVSKMKYTAK 2235 (0)
2148 VVEETIRLANIAPMAHRVALRDVEYR 2071 (1)
1745 GYTIPKGWKVIVWIRSLHVDPAHYDNPLSFNPDRWD (0) 1638
9851 KSAELGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK (2) 9970
10088 WELLNPDAGIVYLPHPRPTDGAVMSFSEL* 10177

>AC079935.3 $F CYP729A2 (japonica cultivar-group) cultivar 35% to 88A3 may be new 
155791 MMSGMQTPVVAVGATDWAWRLGALVAGAVPLLALAV
       WHCTDAFHRAAFAFRRRGTRRARRLPPGHMGLPFV 155579
155578 GETLALLWYFNLARRPDAFIQAKRRRYCYGDGDDDAGIYRTHLFGSPAVLVCSPASNGFV 155399
155398 FRSAPPGSFGVGWPDPELVGVSSIVNVHGGRHARLRRFVLGAINSPNSLRSFAEVVQPRV 155219
155218 AAALRSWAAKGTITAATEIKK (0) 
       VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK (0)
       CRRKLNSVFREEVKRRKLKAKLEEHDDVMSGLMRMEDEQGRRLG
154678 DDEVVDNIVSLVLGGYKSTSSAIMWATYYLAKLSAVLAKLR 154556 (0)
148738 EENLAIAKEKNGASFITLDDISKMKYTAK 148652 (0)
148565 VVEETIRLANISPMLYRVALRDVEYR 148488 (1)
147994 GYTIPEGWKVIVWIRSLHVDPKYYDDPLSFNPDRWD 147887 (0)
146817 KAAKPGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK 146698 (2)
146576 WELLNPDAGVVYLPHPRPTDGAAMSFSKL* 146499

>aaaa01042113.1 CYP730A1 (indica cultivar-group) new family ?
2 AVETQVACQPRKIHSLGTTIPIIGDMLEVKKNLGARHDWIAATSLRFRNEPWRIKAPAAPEMIILSDPATIED 220
221 VMVKQTDVFIKGSLQREITHELFGEGILGVDGEQWYHQRKTAAKFFSARTLRLCMMQTMQ 400
401 RNVEQVYEVLDAQCGTGSLVNLTNLFQQFALQTFLEVGVGIDAPVIGTSEPGAF 562
563 KALEEAVVYIARRRILPRFVWKLQRWLNVGPEKKIKDLMETVHAYVAQLVKKSLSKENGD 742
762 DEKVRTAVELFVENSGDDASGLR
831 PRDLVDFVLNFVGAARDTSALTTQWLF*RLSKTPGKVEAKDPG 959 
962 EFAV*LAQLGV 994 
996 GRGGYITADHVKQLVYLEAVIKETLRLHPAAPTVMRVAEENTVIDGDVFIRKGQ 1157
1158IINMSVY 1178
632 AMARMTSVWGDDAEQFNPDRWLDPTSGKLVQVSPFKYPVFLGGPRTCLGMKFALMEMKI 456
455 TLAVLLSRYELRTTRDPFSFTYRAAVTMGIRGPLHIRVAARPT*

>aaaa01034116.1 CYP730A2 (indica cultivar-group) missing some Nterm seq.
TIATAMLTQYARSKSKSTVKPRKIHSLGTK
92  IPIVGDLLESLKHKARHDWISDTSLRFQNEPWQINVPGGAKTIVLSDPATIEDVMVT 262
263 QSDVFVRGVQIRDIMHDLIGDGIANADGEQWFHQRKTAAKFFSARTLRLCMTQ 421
422 TMQRNIEQVHQHLDAQCGTGRLADLTDLFQQFTLQTFLDVGVGIDARIIGKSEPEAFRAL 601
602 DEATILLMRRLALPTFVWKL QRWLNVGREKELKELLVTVRTYVNRLVTQCLSKKNNEA 775
776 GGDDEGEKIRTAVELFVEHSADDKAGLRPRDLVDFLLGFLFAARDTSAVTTMWFFYEL 949
950 GQHPEIEAKIRQELAVK LPQLGVGRGGYITADHVKQLVYLEAVIKETLRFRPAAANTTRL 1129
1130 ANQDTVIDGDIYVRKGEIVNLSTYALARNPRVWGPDAGEFKPERWIDTKTGELLSFPATK 1309
1310 FFSFGAGPRSCLGMKLAMLNLRVLIANLLHRYKFEIDPSCDGRHTAAMVMSPKHSVLA 1483 
     KVREV*

>aaaa01060623.1 CYP730A3 (indica cultivar-group) 
7 RRLVPTYVWKLQRWLNIGSEKKIKELMEHVNTYVTEKINQSLSKTNGEASGQGESDSI
181 RTAIELFVEHSGDDKAGLRPRDLVDFVLNFMVGARDTSAVTTQWLFYELSRHPEIEAKIR
361 EELASKLE 384 
386 QLGVGPDGYITADHVKELVYLEAVIKETLRLHPAAPLLMRVAKQDAV 526
527 VAGDIFIRKGQSVNMSVYAMARNPRVWGPDAAEFKPERWIDATTGTLHSFPATKFFTF 700
701 GAGARACIGMKLAMLNLRVLTANLLLRYKFEIDPANDGSHVSAIVLAMRHELLAKVERV* 880

>aaaa01081177.1 CYP730A4 (indica cultivar-group) 53% to AAAA01034116.1 39% to 86C3
SDEDKAGMTARDLRDFILQFILGARGTSALSLAWIFLLIAKHPEVEQRIRDEMAVRLPEVMANDEAYVTSDHIQDLVYLEAT 452
451 IKEVLRLYPTIPMNRREAVKDTVIGDGIPVKKGEYVVLHPYAMARLPSLWGPDAAEFKPE 272
271 RWIDPTTGELLKVSSTKFLLFGSGPRTCIGMKLAMLEMRVVTANLIKRYRFSLAQPNDCS 92
91  HIVSMDLMLANPLVMSAKRTTKETPNE* 8

>aaaa01044854.1 CYP730A5 (indica cultivar-group) new family? 55% TO 730A6
1005 RSAIDLFVEHSDPNKVGLRPQDLVDFMLTFVVAARDTTALTLAWFFYSV 859
858  HKHPEIEAKLRQELGAKLPALGITDKSDYITTDHVKHLVPLEAAIKETLRLYPAGP 691
690  FNVRQAVDDTLVNGDLFLKKDQVVAIPIYAMARNVNVWGPDANEFKPERWIDVETGKLLP 511
510  QPADRFVSFSSGPRMCIGMKLAMTSLRVVTANLLYRFKFEIDPSNDGTYVNSAALAMK 337
336  HNLLAKVERV* 304

>aaaa01050446.1 CYP730A6 (indica cultivar-group) new family? 
23  FFYELGLHPEIEAKIREELALKLPQLGVGRDGYITADHAKQLMYLEAVIKETLRF 187
188 HPAASITTRIANQDTVIGGDVYREVMNLSMYGMARNSRLWGPDAAEFKPERWIDTKT 358
359 GEPLSFPATKFFTFGAGPRSCIGMKLAMLNLRVLTANLLHRYKFEVAPENDGSHISGM 532
533 VLSMKHKLMVKVEQV* 580


>aaaa01092846.1 CYP730B1 (indica cultivar-group) 50% TO AAAA01078205.1
TDLLARQDTAAVAAATLLGGALALYVLQSLASRRTIPNKTKATDKLHLLPTRNAV
LGDLLEFARNAPRLHEWIAETSLAFGGEPWRAHIPGLQTMIVVTTQELVEEVMTTQFDTFQHGES
ANEISESLVGKAIATVDGEMWYHQRKAASRFFTTRSLRTCMTTQMRKNMTQVYNVIDSAT
ARGQAVDMLQLFHEFALQTFTEIGLG

>aaaa01078205.1 CYP730B2 (indica cultivar-group)
ADDARLPLLLVTIG
677 SALSLSLLAWYATSRAKSTTKINAHKVHTLENRHVLFGDMKEVGENAERLHKWLLERSLH 498
497 FNGEPWRFYLPGIMDTTVITTPELVEEMLATQADIFIRGKVTNDMSED MLGKSL 336
335 ISSDGPKWYHQRKAVAKFFSARALRKCMQVHMRKNVGQLHGVLDRAALDGTPVDMMPLF 159
158 QDFAMQTFAELALGIELNIIGTGKTHVMEHGIREAGPVVMRRGSVPTFWWKL

>aaaa01077059.1 730C1 (indica cultivar-group) 42% to 730B1
1 AIATAGTLVAGRGYLYTTARNCGPAGVKLRKIHRPRDTLPLLGNAVSFYRNRHDIRAWLV
    EESLEFKGEPWKRMIPGQPDMILFSTPEPIEEITTTQFENFEKGRV 320 frameshift
322 QVDVLAGLFGRGVVASDGERWVHQRKAGVKFFSARSLRALMHTSMRKNAEQVCDVIANSQRLGEMV 519
520 DLKKLFHEFTLQTFVEMGLGSDLQWIGAADPHPFQHAIDRVSPIITKRFRQPAWMWKFQ 696
697 RGSTLKRAVLP 729

>Hordeum vulgare BQ766575 48% to 730C1 39% to 730B2 36% to 730B1 TTLAVGGAVAAAAVAVILSSDKKTQDGARKIHVPKSTLPVLGNVVDALTNAHRLHDWLKD
HSVEFNGEPWRFAVLGQPDQTILSMPEAIEEVLVKQFDKFPKGPTHIDIISTMFGFGLLS
SDGERWHHQRKTAAKFFSTSVLRSFLKLSIHKGVGRMDAVLNEAAASGDAVDLKKMFHDF
TLDTFVEMGLGADLNCV

>aaaa01065390.1 CYP730? (indica cultivar-group) 
VLPSLGVTKDTFLMADHVHHLVYLEATIHEVLRLYPTAPLVQRAPPQDTIICDDVLIPAD
TTVCLHTYAMGRNPDVWGPDAAEFKPERWIDPTTRELLKFPPTKFAAFSAGPHLCIGMKL
GMLELRVVAANLVHRYAMSLAVPNDGGYLVGITLLMKNPLLVKVRHV*

>aaaa01067877.1 CYP730?? (indica cultivar-group) new family? 44% to 86A2 Arab
1 DPSDDYVPSMEDAASLTYLEAVIKESLRLNPAAPLTSRVAIEDTVLTDGTFVPKGVRVVFPTYAAARMPW 210
211 LWGEDAAAFRPDRWIDETMGKLRQVSPCKFLVFHAGPRQCIGQKLAMLEMKIVAVAL 381
382 LTRFELVVKPGQTVTYGRSLTLTMKNPFMVHAERRNV* 495

>Phytophthora sojae 56% to 730?? CF845142
VMMNRHPRVLCKVREELRRVAPELFTGELDTPTLGHLQQLTYLEAALKESLRLXXXXXXXXX
RLANRDTTLSDGTFVPKDARAVFSMYASARQPSVWGSDAADYNPGRWIDEETGKLSSFKFVT
FSAGPRQCIGMRLAMMEMMTVLSVVFSRFD

>Phytophthora sojae mycelium grown in synthetic medium CF847821 44% to 730??
ARGEIDAPSMEQLGRLPYLEAAMRENLRLNTSMTTRSPNQDTTLSCGTFIPKNSVVCVCH
YASARLKSTWGDDAAEYKPERWLDPDTGKLRQFSPYQFVTFLAVPRQCIGMRFAMLELRM
VASVLCSRFNIKTVEDPFSLTYELSTVFPVKGRLMCTVESSGLAVSS*

>aaaa01040030.1 CYP731A1 (indica cultivar-group) 33% to 94D new family?
MVPTDLSVALALLGIAVGGAYFLHVPSAQERAVRHLPTPGGA
190 FVVTLKMMWRHGARVYDWILEHSKLYGGKPWRIQLLGRPVTVIFNSPDVVXDIL 351
352 KTQFEIFDKGEYTSRAAFDVLGNGIFVADGDLWSHQRKTGSHLFSLQMMRESMEES 519
520 VRSHCVLLFERLDTVAANTAAAAGEQANVVEMKRLLDLFTMDVFTKIGFGVDVGGLQGR 696
697 GSHAFLDAFERSSLALLYRFQQPMWLWPLKKKLNIGVERQLKKDMKVINGTISGIITRSM 876
877 EERQRGQAQSDRRDLIALFLDKPPPESLASTSGGMDPALIRDMAMNFIAAGRDTTSQSM 1053
1054AWFLIMMNRYPLVLERVREELDARLPFLRAEKSRIPSMQDVQELVYLEAAIRE 1212
1213SLRLNPSSR 1239

>aaaa01061925.1 CYP732A1 (indica cultivar-group) new family?
VHEPPLPESTHWL
842 VGNTRELIKHNHRLYDWLTDLSLEFNGQPFRIEAYGLGYTVMLTSPRHVEAV 687
686 LKTHFDNFEKGAFVNEVLHDLAGQGIFASDGEAWFHQRKTASHLFTMRALRDSMTSLVHK 507
506 HLARLIETLDASAATNTAFDMAASLHDFTLRAFTDMAFGVDLSAIHERDDPQWRAFPAA 330
329 FNAAQRRLSFRLSVPRALWKFQRYWNLAGEATFKQHIKTIHAIVLDVIDKSLAQRQQAGS 150
149 DTSRATPNLVSLFLDNLEHETTGATFDPTYLRDFVVNTMVAGRDTTA 9

>AC092557.2 $F CYP733A1 chromosome 3 clone OSJNBa0096I06 38% to 722A1
11388 MAVFGAAVLVALAVTCGLIWSRSRRLSKEMRDIPGTMGWPVVGETFSFISGFSSPAGILSFMRDRQKR 11185 (2) 
11068 FGKVFKTYVLGRMTVFMTGREAAKILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGD 10898
10897 EHKKLRRLIGEPLSIDALKKHFDFINDLAVQTLDTWLDRRVLVLEEASS 10751 (0) 
10664 FTLKVIANMLISLEPEGEEQEKFRANFKIISSSFASLPLKIPGTAFHRGLK 10512 (0)
10413 ARNRMYAMLDSVIARRRDGGEVRNDFLQTLLRKHAKDGTAADEDDGGGGGDRTLNG 10258
10257 DADKLTDAQLKDNILTLLVAGHDTTTAGLTWLIKFLGENPEALQKLR 10117 (0) 
      EEHMEIKERLDGSSHLRWSDVNSMPYTNK (0
9726  VMNETLRRATILPWFSRKAAQDFSID 9649 (1)
9538  GYEIKKGTSVNLDVVSIHHDPSVFADPYKFDPNRFD (0) 
9345  GTLKPYSFLGFGSGPRMCPGMSLARLEICVFIHHLVCRYS 9244 (2)
9165  WTPLEDDDSVQPTLVRMLRNKYPIVAAAI* 9076

>AP005008.1 CYP734A2 (japonica cultivar-group) chr 2 N-term does not match look for 
      MEEDGGGGAGWGWATWRVA
83315 AVAAAAAVWVTMHVAARMADALWWRPRRLEAHSR
83415 GAGVRGPPVPVLLGSVREMVALMAEASSKPMSPPTSHNALPRVLAFYHYWRKIYG 83579
83883 FLIWFGPTPRLTVAEPELIREIFLTRADAFDRYEAHPVVRQLEGDGLVSLHGDKWALHRR 84062
84063 VLTDAFYPDNLN (0)
      RLIPHVGKSVAA 84242
84243 LAAKWGAMAEAGGSGEVEVDVAEWFQAVTEEAITRATFGRSYDDGRVVFAMQGQLMAFAS 84422
84423 EAFRKVLVPGY 84455
84542 RFLPTKKNRLSWRLDREIRRSLMRLIGRRSDEAEQGEKADDGSFRDLLGLMINAGAAAAT 84721
84722 RGNAGGEKNSPAAAIPVEDMLEECKTFFFAGKQTTTNLLTWATVLLAMHPDWQERARREV 84901
84902 FDVCGAGELPSKEHLPKLKT 84961
85089 LGMIMNETLRLYPPAVATIRRAKVDVQLSDGCMIPRDMELLVPIMAIHHDTRYWGPDASQ 85268
85269 FNPARFANGASKAAKHPLAFIPFGLGSRMCVGQNLARLEAKLTMAILLQRFEIRTSPNYV 85448
85449 HAPTVLMLLYPQYGAPLIFRPLSSHPPDSTGP* 85547

>aaaa01008222.1b CYP734A3P (indica cultivar-group) 86% AP003612.1 $F first exon 
6183 MEEDGGGGAGWGWATWRVA
6126 AVAAAAAVWVAMHVAARMADALWWRPRRLEAHFAAQGVRGPPYRFLLGSVREMVALMAEA 5947
5946 SSKPMPPAAPHNALPRVLAFYHYWRKIYG 5860
5717 LAFLIWFGPTQRLTVAEPELVREILLTRTEAFDRYEAHPVVRQLESDGLVSLHGD 5538
5537 KWARRRR 5517

>AP003612.1 $F CYP734A4 chromosome 6 clone P0457B11, 62% to 72B
109843 MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGPPYRFLVGCVR 109682
109681 EMVALMAEATAKPMPPAAPHNALPRVLAFYHYWRKIY 109571 (1)
109284 GPTFLIWFGPTPRLTVAEPEMVREIFLTRAEAFDRYEAHPVVRQLEGDGLVSLHGDKW 109111
109110 AHHRRVLTPGFYPDNLN (0) 
108953 RLVPHVGRSVAALAERWRAMACAGGGEVEVDVAEWFQAVAEEAITRATFGRSYDSGRV 108780
108779 VFRLQARLMAFASEAFRKVLVPGYR 108705 (2)
108606 FLPTKKNRMSWGLDREIRRGLVRLIGRRSGGDGGEEDETTTELKDKQDSGFNDLLGLMI 108430
108429 NAGVDRTMPVEDMVEECKTFFFAGKQTTTNLLTWATVLLAMHPDWQDRARREVLAVCGDA 108250
108249 AGELPTKDHLPKLKT (0) 
       LGMILNETLRL 108070
108069 YPPAVATIRRAKFDVTLGGGGDGDAGGIHIPRDTELLVPIMAIHHDARLWGPDAAQFNPA 107890
107889 RFASGAARAAKHPLAFIPFGLGSRMCIGQSLAILEAKLTMAVLLQRFDLALSPTYVHAPT 107710
107709 VLMLLHPQYGAPLIFRPRQSQPSN* 107635

>AP003822.1 $F CYP734A5 chromosome 7 clone OJ1316_A04, 68% to 72B
52729 MWSSWAWTWSWSGAAAVAVAAAAAWVAVYAAAARAAEAL
52846 WWRPRRVERHFAAQGVRGPGYRFFVGSSIELVRLMVDAASRPMEPPTSHDILPRVLPFYH 53025
53026 HWRKLY 53043 (1)
55138 GPMHLIWFGRTPRLVVSEPELIREVLLTRADHFDRYEAHPMICQFEGYGLSNLHGERWA 55314
55315 RRRRVLTPAFHTENLRMIAPFVAGTVTRMLDELAERARAGGAGEAEVDVAEWFQRVPQEA 55494
55495 ITFAAFGRRNYDDGAAVFRLQDELAGYATEAHSKVYIPGYRFLPTRKNRRVWQLDREIRS 55674
55675 HLAKFVTGLQSCSSSHGDDADDGGDGGGGMREFMSFMAPAMTAGEIIEESKNF 55833
55834 FFAGKETLSNLLTWTTVALAMHPEWQERARREVVAVCGRGDLPTKDHLPKLKTV 55995
56559 LGMILNETLRLYPPAVAMIRTAKEDVELGGCVVPAGTEVMIPIMAVHHDAAAWGDDAAEF 56738
56739 NPARFAADDDGGRRRHPMAFMPFGGGARVCIGQNMALMEAKVALAVVLRRFEFRLS 56906
56907 PAYVHAPRVLMILSPQFGAPVIFRPLTSAAA* 57002

>AP006237.3 CYP734A6 (japonica cultivar-group) genomic DNA, chromosome 1, BAC
72340 MGWWGWAAAAAAAAAWVAV
72373 KVLEVLWWRPRRVEEHFARQGITGPRYRFLVGCVREMVALMVAASAKPMPPPYRSHNVLP 72194
72193 RVLAFYHHWKKIYGNPPPPPLLLNSILSQKQQPRTRRWQVAVVGERFAPGRYDIDMMAAL (1) 72014
71530 GSTFLIWFGPTPRLAIADPELIREVLLARADRFDRYESHPMVRQLEGEGLVSLRGDKWAH 71351
71350 HRRVLTPAFHMDNLRLLLPCVGMTVLDMADKWRAMAEADKSGEVEIDVSDWFQVVTEDAI 71171
71170 TRTAFGRSYEDGKVVFKLQAQLMAFASEAFRKVFIPGYR (2) 71054
70869 FLPTKKNTSSWKLDKEIRKNLVTLIGRRQEAGDDEKLDGCAKDLLGLMINAAASS 70705
70704 NGGKRSALPVSPITVNDIVEECKTFFFAGKQTTSNLLTWAIVVLAMHPEWQERARQEV 70531
70530 LDVCGADGVPSREQLAKLKT (0)
70392 LGMILNETLRLYPP 70351
70350 AVATVRRAKADVELGGYLRIPRDTELLIPIMAVHHDARLWGPDAAQFNPARFAGGVARAA 70171
70170 RHPAAFIPFGLGARMCIGQNLAILEAKLTVAVILHRFEFRLSARYVHAPTVLMLLHPQYG 69991
69990 APIVFRPRSSSQPTCEKMNPLTSS* 69916

>AP004142.1 $F CYP735A3 chromosome 8 clone OJ1567_B05 53% to 709A2
66952 MAMAAAVLVAIALPVSLALLL
66889 VAKAVWVTVSCYYLTPARIRRVLASQGVRGPPPRPLVGNLRDVSALVAESTAADMASLSH 66710
66709 DIVARLLPHYVLWSNTY 66659 (1)
66576 GRRFVYWYGSEPRVCVTEAGMVRELLSSRHAHVTGKSWLQRQGAKHFIGRGLLMANGATW 66397
66396 SHQRHVVAPAFMADRLK (0) 
      GRVGHMVECTRQTVR 66217
66216 ALRDAVARSGNEVEIGAHMARLAGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYL 66037
66036 WVPGSQ 66019 (2)
65469 YFPSKYRREIKRLNGELERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKK 65296
65295 EAGGNGGGEVGYDAQMMIDECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAV 65116
65115 CGGGAPSPDSLPKLAVLQMVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWI 64939
64938 PVLAIHHDEGAWGRDAH EFRPDRFAPGRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVAL 64759
64758 AMLLSSFRFAISDEYRHAPVNVLTLRPRHGVPVRLLPLPPPRP* 64627 

>CYP735A4 AP005732.2 
MAVLVSLMVIAASSPLVALLLRAAWVTLSCYWLTPMRIRRAMAAQGVRGPPPRPLV
GNLREVSALVARATADDMPSLSHDIVGRLMPHYVLWSGTY (1)
GKLFVYLYGSEPRLCLTDTALIKEFLSSKYAHATGKSWLQRQGTKHFIGGGLLMANGAR
WAHQRHVVAPAFMADKLK (0)
GRVGRMVECTKQAIRELRDAAAGRRGEEVEIGAHMTRLTGDIISRTEFNTSYDTGKRI
FLLLEHLQRLTSRSSRHLWIPGSQ (2)
YFPSKYRREIRRLNGELEAVLMESIRRSREIADEGRAAVATYGRGLLAMLLSEMEEKE
KNGGGGGGEFSYDAQLVIDECKTFFFAGHETSALLLTWAIMLLATNPAWQEKARTEVAAVCGDH 109603
109602 PPSADHLSKLTV (0)
       LQMIIQETLRLYPPATL 109423
109422 LPRMAFEDIQLGGLRLPRGLSVWIPVLAIHHDESIWGPDAHEFRPERFAPGARRPSAAGA 109243
109242 ARFLPFAAGPRNCVGQAYALVEAKVVLAMLLSAFRFAISDNYRHAPENVLTLRPKHGVPV 109063
109062 HLRPLRP* 109039