Rice P450 sequences

Dec. 29, 2003 D. Nelson


#n are numbers for the ortholog pairs or unique sequences.  489 numbers were given out, 31 of these were combined and 4 were not from rice.  Therefore, there are 454 unique rice sequences.  Fragments get the same number as parents.  Order is by CYP name.

Three sequences aaaa01039155.1, aaaa01093055.1, aaaa01067419.1 are probable fungal P450 contaminants.  One seq aaaa01062516.1 is a probable insect P450 contaminant.  These are not counted in the total. 

CYP names have now been assigned to all 454 sequences.

27 sequences are partial and they may join to make a smaller number of genes.

This will probably reduce the gene count by 4 to 450 genes and pseudogenes



>aaaa01012243.1 $FI CYP51G1 = old CYP51A5 Indica rice genome CYP51 New April 24, 2002

ortholog of AB025047 99%











>AB025047 CYP51G1 = old CYP51A5 rice (partial)   80% to 51A2 missing N-term 64 aa

BE040549.1 OE08G10 OE Oryza sativa cDNA 5' Length = 255 I-helix CYP51

BE230288.1 99AS641 Rice Seedling cDNA clone 99AS641.Length = 586

BE230302.1 99AS655 Rice Seedling cDNA clone 99AS655.Length = 627

BE607441.1 OE202C10 OE cDNA clone ID707 C-term CYP51 Length = 428











>aaaa01066056.1 CYP51G1 = old CYP51A5 (indica cultivar-group) = aaaa01012243.1 $FI Indica rice genome CYP51





>aaaa01014709.1 CYP51G3 = old CYP51A15 (indica cultivar-group) 49% to 51A2






no japonica ortholog found 9/11/02



>aaaa01028263.1 CYP51G3 = old CYP51A15 (indica cultivar-group) 73% to AP003866.1






no japonica ortholog found 9/12/02



>aaaa01028263.1 CYP51G3 = old CYP51A15 (indica cultivar-group) 73% to AP003866.1






no japonica ortholog found 9/12/02


all three fragments CYP51G3 = old CYP51A15 #418, #453, #346 joined reduce gene count by 2














>aaaa01065204.1 CYP51G3 = old CYP51A15 (indica cultivar-group) exon 3

ortholog of AY022669.1 searched Genbank for extensions





>AY022669.1 CYP51G3 = old CYP51A15 (partial)   microsatellite MRG4994 containing (CCG)X8, Length = 224

82% to CYP51 pseudogene above



>AK107185.1 CYP51A15 (japonica cultivar-group) cDNA clone:002-124-H08

AC135914.2 genomic seq













>aaaa01005681.1b $PI CYP51G4P = old CYP51A16P (indica cultivar-group) ortholog of AP003866.1b












>AP003866.1b $P CYP51G4P = old CYP51A16P chromosome 7 clone OJ1092_A07

No obvious N-terminal, two in frame stops, three frameshifts = Pseudogene

82%  to AY022669.1 seems to be a CYP51 pseudogene








56879 DHAYTVFGGGRHACVGE 56929 frameshift




>aaaa01003099.1b CYP51H1 = old CYP51A6 (indica cultivar-group)  Nterm aa 4-160

ortholog to AP005448.1b 100%





>aaaa01003099.1c CYP51H1 = old CYP51A6 (indica cultivar-group)  Nterm aa 61-160

ortholog to AP005448.1b 100% these two are duplicates only count once




>aaaa01003099.1d CYP51H1 = old CYP51A6 (indica cultivar-group)  Nterm aa 61-160

ortholog to AP005448.1b 100% these two are duplicates only count once




>aaaa01003099.1e CYP51H1 = old CYP51A6 (indica cultivar-group) nearly  gene, runs off end

ortholog to AP005448.1b $F 99% plus one frameshifted region











>AP005448.1b $F CYP51H1 = old CYP51A6 (japonica cultivar-group) chromosome 7 21 June 2002

100% to AP005188.2c











>AP005188.2c $F CYP51H1 = old CYP51A6 (japonica cultivar-group) chr 7 orth to aaaa01003099.1e 99%











note: sequences aaaa01003099.1b to e are all probably from a single gene



>aaaa01003099.1a CYP51H2P = old CYP51A7P (indica cultivar-group)  Nterm aa 4-94

ortholog of AP005448.1a 100%




>AP005188.2b $P CYP51H2P = old CYP51A7P (japonica cultivar-group) chr 7 N-term fragment

orth to aaaa01003099.1a 100% after frameshift

52199 MDHLTSS (frameshift)




>AP005448.1a CYP51H2P = old CYP51A7P (japonica cultivar-group) chromosome 7 21 June 2002





>aaaa01001626.1 $FI CYP51H3 = old CYP51A8 (indica cultivar-group) Cterm ONE FRAMESHIFT

ortholog to AP005188.2a 98%












>AP005188.2a $F CYP51H3 = old CYP51A8 (japonica cultivar-group) chr 7










14541 FEIKMVSPFPET 14576 (frameshift)



Note this cluster continues on AP005188.2b and 2c



>aaaa01009323.1 CYP51H4 = old CYP51A9 (indica cultivar-group) 55% to AP005448.1b $F

orth of AP004890.1




6951 FELK 6962


>AP004890.1 $F CYP51H4 = old CYP51A9 (japonica cultivar-group) chr 2












>aaaa01023253.1 CYP51H5 = old CYP51A10 (indica cultivar-group) orth of AP004090.1 $F chromosome 2









>AP004090.1 $F CYP51H5 = old CYP51A10 chr 2 clone OJ1399_H05 49% to 51A2

AQ843111.1 nbxb0005D03r CUGI Rice BAC genomic cloneLength = 507 49% to 51A2












>aaaa01024682.1 CYP51H5 = old CYP51A10 (indica cultivar-group) orth of AP004090.1 $F chr 2

Nterm join with AAAA01023253.1 see this accession for ortholog






>aaaa01008685.1 CYP51H6 = old CYP51A11 (indica cultivar-group) orth of AC108875.1a $F chr 5 100%






>AC108875.1a $F CYP51H6 = old CYP51A11 chr 5 51% to 51A2 same as AQ050946 AQ687182 AQ258479

58% to AP004090 this might require subfamilies in CYP51












>aaaa01010435.1 CYP51H7 = old CYP51A12 (indica cultivar-group) orth of AC108875.1b $F 99% chr 5 similar to 51A2






2866 AIWSHLLRNF 2895


>AC108875.1b $F CYP51H7 = old CYP51A12 chromosome 5 48% to 51A2












>aaaa01067145.1 CYP51H7 = old CYP51A12 (indica cultivar-group) orth of AC108875.1b $F chromosome 5 1 diff see aaaa01010435.1 for ortholog




>aaaa01004091.1 CYP51H8 = old CYP51A13 (indica cultivar-group) orth of AC108875.1c $F chr 5 similar to 51A2





12728 IWSHLLRNF 12754


>AC108875.1c $F CYP51H8 = old CYP51A13 chromosome 5 50% to 51A2












>aaaa01005681.1a CYP51H9 = old CYP51A14 (indica cultivar-group) orth AP003866.1a $F chr 7 >99%








>AP003866.1a $F CYP51H9 = old CYP51A14 chr 7 clone OJ1092_A07 53% to 51A2

AQ326645 and AQ291927 mid to K-helix region 52% identical to wheat CYP51

60% identical to AQ327456 68% to EST T88278 705 family

AQ689048.1 nbxb0078H10r CUGI Rice BAC genomic clone Length = 737

AQ396185.2 nbxb0066K16r CUGI Rice BAC genomic cloneLength = 327



      GGFYSRPE 51261









no japonica ortholog found 9/11/02



>aaaa01000238.1f $FI CYP71C12 (indica cultivar-group) AP003909.1a 99%

also aaaa01079567.1 (98%)











>AP003909.1a $F CYP71C12 chromosome 8 clone OJ1300_E01 55% to 71C4

orth aaaa01000238.1f












#10 part

>aaaa01079567.1 CYP71C12 (indica cultivar-group) orth AP003909.1a $F chr 8

99% 98% to aaaa01000238.1f $FI see aaaa01000238.1f for ortholog







>aaaa01000238.1g $PI CYP71C13P (indica cultivar-group) end of clone poor quality seq

allowing frameshifts (fs) and deletions this seq 95% to AP003909.1b

(plus strand)



46406 ILRTHDRVFASRQQSAIT 46459 gap (frameshift) XILF (deletion and fs)


      AKI*EATTHMAV 46628 (deletion)

(minus strand)








>AP003909.1b $P CYP71C13P chromosome 8 clone OJ1300_E01, 4 in frame stops pseudogene

orth aaaa01000238.1g note this seq is out of order in this gene cluster













>aaaa01000238.1e $FI CYP71C14 (indica cultivar-group) AP003909.1c 99%












>AP003909.1c $F CYP71C14 chromosome 8 clone OJ1300_E01

orth aaaa01000238.1e

same as AP004462.1 152574-152287 region








57185 EIVTEEQLGRMPY 57153 frameshift






>aaaa01000238.1c $FI CYP71C15 (indica cultivar-group) AP003909.1d 99%






24746 LVX 24741






>AP003909.1d $F CYP71C15 chromosome 8 clone OJ1300_E01

orth aaaa01000238.1c

AQ868830.1 nbeb0032E11f CUGI Rice BAC genomicLength = 759 57% to 76C5

same as AP004462.1 139663-140091 region













>aaaa01000238.1b $FI CYP71C16 (indica cultivar-group) AP003909.1e 100%











>AP003909.1e $F CYP71C16 chromosome 8 clone OJ1300_E01

orth aaaa01000238.1b

same as AP004462.1 128584-129021 region













>aaaa01000238.1a $FI CYP71C17 (indica cultivar-group) orth of AP003909.1f

2 diffs N-terminal Met not identified














>AP003909.1f $F CYP71C17 chromosome 8 clone OJ1300_E01

AK067200                2151 bp    mRNA    linear   PLN 24-JUL-2003

Oryza sativa (japonica cultivar-group) cDNA clone:J013097P19, full

insert sequence.

orth aaaa01000238.1a

AZ127316.1 OSJNBb0086E03f CUGI Rice BAC genomic Length = 498 54% to 71A14

AQ871024.1 nbeb0042C09f CUGI Rice BAC genomic Length = 495 56% to 71B23

same as AP004462.1 147428-146820 region













#6 duplicate

>aaaa01000238.1d $FI CYP71C17 (indica cultivar-group) AP003909.1f 99%

this seq 100% identical to aaaa01000238.1a, probably an error in assembly

only count this gene once see aaaa01000238.1a for ortholog

N-terminal Met not identified







31081 QEYNLTRHNIHAILM (0) 31137







>AP004232.1 $F CYP71C18 chromosome 1 clone OSJNBa0051H17 like CYP71C4

90% to aaaa01002989.1 version 4 in Genbank does not allow for

frameshift and skips beginning of heme signature

probably not an ortholog no 99% match in indica 9/5/02




56996 E 56998 (0)










>AK100062.1 CYP71C18 UniGene info Oryza sativa (japonica cultivar-group) cDNA MEQAAGLVYQLFQNEMFPWILALFPFLLLALHYLATNHRTPTTCKETRNHLSPPSP 187









1594 VEYKGSV 1614



>aaaa01059480.1 CYP71C19 (indica cultivar-group) orth of AP004233.1 100%






>AP004233.1 $F CYP71C19 chromosome 1 clone OSJNBa0065J17 50% to CYP71C4

= AQ857130 duplicate of the AP004232 gene at 27203-29726

probably not ortholog only 91%




21343 E 21335 (0)










>aaaa01003879.1 $FI CYP71C20 (indica cultivar-group) ortholog to AP004757.1a 97%










6265 LHLR 6276


>AP004757.1a $F CYP71C20 52% to AF321858 Lolium rigidum 70% to AP003909

chromosome 6 clone P0652D10













>aaaa01002989.1 $FI CYP71C21 (indica cultivar-group) 91% to AP004233.1















>aaaa01000238.1 CYP71C22P

Duplicated end of exon 1 from CYP71C17 = AP003909.1g




>AP003909.1g $P CYP2C22P chromosome 8 clone OJ1300_E01 lone pseudogene fragment

identical to Duplicated end of exon 1 on aaaa01000238.1a




>aaaa01000238.1a $FI CYP71C22P (indica cultivar-group) orth of AP003909.1g

Duplicated end of exon 1 same as AP003930.1g




>aaaa01006247.1 CYP71C23P (indica cultivar-group) orth of AP004757.1b 2 diffs



>AP004757.1b $P CYP71C23P chr 6 Pseudogene fragment last exon similar to AP003909




>aaaa01000733.1 $FI CYP71E4 (indica cultivar-group) 99% to AC092559.2












>AC092559.2 $F CYP71E4 chromosome 3 clone OSJNBb0096M04, 45% to 71B37

same as AC096688.3 chromosome 3














>aaaa01011852.1 $FI CYP71E5 (indica cultivar-group) ortholog of AL731888.1

58% to AC092559.2 46% to 71B23













>AL731888.1 CYP71E5 chr 12













>aaaa01015254.1 CYP71E6 (indica cultivar-group) 94% to AC084319.5a 7 diffs

53% to AC092559.2




>aaaa01021677.1 CYP71E6 (indica cultivar-group) orth AC084319.5a  99%






>AC084319.5a CYP71E6 chr 3 Genbank translation is wrong at N-terminal

does not identify frameshift and conserved motifs PPGPXXLPIIGNL

same as AC084404.8 partial





8170 VMLPDYYCCM 8199









>AC084404.8 CYP71E6 chr 3 incomplete = AC084319.5a







>aaaa01009177.1b CYP71K1 (indica cultivar-group) orth AP002968 $F 98%












>AP002968 $F CYP71K1 40% to 71B24 complement(1875..2513,2584..3501)

AP003204 40% to 71B24 CDS complement(121487..122125,122196..123113)

AQ870215.1 nbeb0036N08f CUGI Rice BAC genomic Length = 754 58% to 99A1













>aaaa01009177.1a $P CYP71K2P (indica cultivar-group) AP002968 $F 97%

only 363 bp away from start of second gene, cannot be complete gene






no ortholog found in japonica 9/13/02, may be indica unique pseudogene

does not exist on AP002968 or AP003204 so it might be a sequence assembly




>aaaa01007181.1a CYP71K3 (indica cultivar-group) orth AP003990.1h $F chr 2 99%

N-term (orientation probably incorrect on either a or b)






180  IKSILX 166



>aaaa01007181.1b CYP71K3 (indica cultivar-group) orth AP003990.1h $F chr 2 100% C-term





>AP003990.1h $F CYP71K3 chromosome 2 clone OJ1073_F05






67282 IKSILI 67299 (0)







>aaaa01007181.1c CYP71K4 (indica cultivar-group) orth AP003990.1i $F chr 2 99%










>AP003990.1i $F CYP71K4 chromosome 2 clone OJ1073_F05











70179 LVRPIHRVSVPVE* 70220



>aaaa01007181.1d CYP71K5 (indica cultivar-group) orth AP003990.1j $F chr 2 99%


10476 VEX 10481 frameshift









>AP003990.1j $F CYP71K5 chromosome 2 clone OJ1073_F05






71704 QYPLTTENIKTVMM 71745 (0)







>aaaa01012971.1b CYP71K6 (indica cultivar-group) orth AP003523.1c $F chr 6 99%







>AP003523.1c $F CYP71K6 chromosome 6 clone P0416A11 six different genes

73% to AP003523.1d 64% to AP003523.1f







       QREGDLEVSRESIRSTIG bad exon boundary should be phase 0







>aaaa01008944.1 CYP71K6 (indica cultivar-group) orth AP003523.1c $F chr 6 98%

see aaaa01012971.1b for ortholog







>aaaa01001026.1a $PI CYP71K7P (indica cultivar-group) 3 defects, probable pseudogene

probable ortholog of AP003523.1d







2572 PLLSTESIRTTIG bad boundary 0 expected 2540






>AP003523.1d $F CYP71K7P chromosome 6 clone P0416A11 six different genes

probable ortholog of aaaa01001026.1a






       SPLLSTESIRTTIG bad exon boundary should be phase 0







>aaaa01012971.1a CYP71K7P (indica cultivar-group) orth AP003523.1d $F chr 6 99%

see aaaa01001026.1a for ortholog







>aaaa01001026.1b $PI CYP71K8 (indica cultivar-group) Pseudogene of AP003523.1e

japonica gene does not look like a pseudogene

      MAGFPVYL (deletion and fs) LAA (fs) LIILPMANLIRSARHRRLAGAR (fs)






this segment is homologous to 108 aa region before the sequence gap at 17972

gene may not be assembled correctly


      missing Ihelix exon





>AP003523.1e $F CYP71K8 chromosome 6 clone P0416A11 six different genes AQ331067 AQ364007.2

AQ331067 55% identical to AQ328148 47% identical to C74921 57% to 71B4 58% to 76C1 64% to AP003523.1f

AQ364007.2 nbxb0060E04f CUGI Rice BAC Length = 393 65% to 99A1

End of this gene matches AP003571 at 155149






152120 SLTTDNIKAAIA 152155 (0)







>aaaa01001026.1c $FI CYP71K9 (indica cultivar-group) Cterminal differs from AAAA01001026.1b and AP003523.1f may be a frameshift (check)

may be ortholog of AP003523.1f 95%






21868 PLSTERIKTTVG (0) 21903






>AP003523.1f $F CYP71K9 chromosome 6 clone P0416A11 six different genes

AU096456 AU096455 71% to AP002968 65% to 71B24 also = AU032983

may be ortholog of aaaa01001026.1c 95%






169450 RIKTTVG 169470 (0)







>aaaa01001026.1d $FI CYP71K10 (indica cultivar-group) orth of AP003571.1h $F 99%






29660 ESIKATIG (0) 29683






>AP003571.1h $F CYP71K10 chromosome 6 clone P0458E02 continuation of contig AP003523.1

40% to 71B23

AQ687385 nbxb0074N19f 50% to 71B20

AQ258331 nbxb0020M04r 71-like sequence 36% to 71B33






144507 SESIKATIG 144481 (0)







>aaaa01008885.1 $FI CYP71K11 (indica cultivar-group) almost same as AAAA01011410.1

ortholog to AC118346.1a gene 1



6524 PEGSQ (0)










>AC118346.1a $F CYP71K11 Gene 1, 94448-96200, 3 exons 97% identical to gene 2 (12 diffs)

36% to 41% with 71As and 71Bs







95432 KGDFPLSTDNIKTTIG (0) 95479







>aaaa01011410.1 $FI CYP71K12 (indica cultivar-group) Ortholog to AC118346.1b gene 2












>AC118346.1b $F CYP71K12 (japonica cultivar-group) chromosome 11 clone Ba0039F06,

Gene 2 = AU096586.1, D48250 97% identical to gene 1 (12 diffs)













>AC118346.1c Gene 3 $P CYP71K13P pseudogene 56% to AC118346.1 genes 1, 2 no ortholog








>aaaa01005413.1 $FI CYP71P1 (indica cultivar-group) ortholog to AL713951.1










4233 LSEV* 4219


>AL713951.1 $F CYP71P1 chromosome 12 clone Monsanto- 39% to 83B1

AF088221 BI305808.1 49% to 76C6 mRNA










42996 GEELSEV* 42973



>aaaa01009895.1 $PI CYP71P2P (indica cultivar-group) orth of AP003544.1


     CSDVTFAPAGPYHRM frameshift

     QMAR 6094




5668 FVDVLLRVQ 5642


>AP003544.1 $P CYP71P2P chr 6 clone P0599C12 same as AP003686.1 8668-8037 pseudogene of AL713951.1

this gene matches a barley EST BF255745.2 75% and a sorghum EST BE354971.1 79%

so there must be a functional copy of this gene in rice 


107762 GCSDVTFAPAGPYHRM 107715 frameshift


107520 GRRFPRDEGDKLSAVLANAQDLL 107452 frameshift





>aaaa01003512.1 i CYP71Q1 (indica cultivar-group) ortholog to AP004346.1a 95%










>AP004346.1a $F CYP71Q1 two genes and a pseudogene

71B like 47% to AC092559.2 75% to AP004346.1b














>aaaa01043764.1 CYP71Q1 (indica cultivar-group) orth AP004346.1a $F 97%

see aaaa01003512.1 for ortholog





>aaaa01017559.1 CYP71Q2 (indica cultivar-group) orth AP004346.1b $F 98%

see aaaa01003239.1b above







>aaaa01025743.1 CYP71Q2 (indica cultivar-group) orth AP004346.1b $F 99%

see aaaa01003239.1b for ortholog





>aaaa01003239.1b i CYP71Q2 (indica cultivar-group) exon 2 ortholog to AP004346.1b 95%




17100 DMDEIGQLAFRK 17065


>AP004346.1b $F CYP71Q2 two genes and a pseudogene 48% to AC092559.2 75% to AP004346.1a




72047 NYNYLDVAVSPYS 72083 (frameshift)









note there is another gene on AP004346.1



>aaaa01003239.1a $PI CYP71Q3P (indica cultivar-group) exon 2 ortholog to AP004346.1c 96%






>AP004346.1c $P CYP71Q3P two genes and a pseudogene

probable pseudogene 89% to AP004346.1b





93741 VPMKH* 93758



>aaaa01002200.1 $PI CYP71Q4P (indica cultivar-group) ortholog of AC087599.11 $P 94% PERF region resembles CYP71Q sequences





>AC087599.11 $P CYP71Q4P chromosome 10 clone OSJNBa0057L21, pseudogene fragment like 71A1 44% to AAAA01006105.1b

16812 GGGGRWTETLEWIMAELTANTRVMAKLQDEISRAADGK 16925 24 aa deletion and frameshift






>aaaa01004200.1 CYP71R1 (indica cultivar-group)







      NMFIA (frameshift)

      GTDTIYKSIEWT 17374




17885 DVESFEVVESS 17917


>AK062293                2395 bp    mRNA    linear   PLN 24-JUL-2003

DEFINITION  Oryza sativa (japonica cultivar-group) cDNA clone:001-100-F01, full

            insert sequence.












>aaaa01007242.1 $PI CYP71R2P (indica cultivar-group) ortholog of AP003575.1 99%







      DMFAAGTDTVYKSIE frameshift

      MAEL 12359






>AP003575.1 $P CYP71R2P chromosome 6 clone P0528B02, similar to 71A24 one in frame stop codon 395 to 71A14













>aaaa01059584.1 CYP71R3 (indica cultivar-group) 59% to CYP71R1




no japonica ortholog found 12/23/03 in nr, est, htgs



>aaaa01016223.1 CYP71S1 (indica cultivar-group) orth AL606614.1b $F chr 4 96%











>AL606614.1b $F CYP71S1 chromosome 4 clone OSJNBb0011N17 40% to 71A25












>aaaa01040889.1 CYP71S1 (indica cultivar-group) orth AL606614.1b $F chr 4 100%

see aaaa01016223.1 for ortholog



1167RFVPERHRD 1193



>aaaa01011971.1 CYP71S2 (indica cultivar-group) orth AL606614.1a $F chr 4 96%







>AL606614.1a $F CYP71S2 chromosome 4 clone OSJNBb0011N17 90% to AL606614.1b












>aaaa01000559.1 $FI CYP71T1 (indica cultivar-group) 98% to AP003434.1a












>AP003434.1a $F CYP71T1 chromosome 1, PAC clone:P0452F10, complete 41% to 71A24 = C98812

C98812 52% identical to D48413 43% to 71A13, 44% to 71B10














>aaaa01002066.1 $PI CYP71T2 (indica cultivar-group) ortholog of AP003434.1b $F 99%



1368 SERLFYGRDM 1339 frameshift and deltion



>AP003434.1b $F CYP71T2 chromosome 1, PAC clone:P0452F10, complete = AA754300

AA754300      42% IDENTICAL TO 71A14   1/98 I-HELIX 43% to 703A2













note there are 4 sequences on AP003434.1



>aaaa01006724.1 CYP71T3 (indica cultivar-group) orth AP003434.1c $F chr 1 99% also AU163704.1











>AP003434.1c $F CYP71T3 AU163704.1 chromosome 1, PAC clone:P0452F10, complete 44% 71A14







48926 AGVQLGTIEIKAIIL 48970 (0)







>aaaa01006398.1c $FI CYP71T4 (indica cultivar-group) AP003434.1d 95%

probably orthologs since 6398 and 3434 have only 3 nuc diffs and two

1 nuc indels in the intron.












>AP003434.1d $F CYP71T4 chromosome 1, PAC clone:P0452F10, complete like 71A













#205 = #203 = #445 reduce gene count by 2

>aaaa01006398.1d $PI CYP71T5 (indica cultivar-group) seq gap before 12414

first exon has two frameshifts and part is missing (1205) no ortholog









#203 = #205 = #445 reduce gene count by 2

>aaaa01006398.1b $FI CYP71T5 (indica cultivar-group) no ortholog












aaaa01006398.1b no ortholog found in japonica 9/7/02


#445 = #203 = #205 reduce gene count by 2

>aaaa01054542.1 CYP71T5 (indica cultivar-group) 76% to AP003434.1c $F

96% to aaaa01006398.1d $PI >99% over 970 bp eve outside the coding region




47  TRPVDR 30


no japonica ortholog found 9/12/02



>aaaa01006398.1a CYP71T6 (indica cultivar-group) (partialI)



2199 GGRDVAFAPYGEYWR 2243 sequence gap here


aaaa01006398.1a no ortholog found in japonica 12/23/03 nr, est, htgs














aaaa01002288.1 $FI has no ortholog in nr or HTGS on 9/5/02



>aaaa01000893.1 CYP71T8 (indica cultivar-group) Nterm 49% to AP003434.1





>AK120767 CYP71T8      2904 bp    mRNA    linear   PLN 29-OCT-2003

DEFINITION (japonica cultivar-group) cDNA clone:J023007M03, full insert sequence.

AP005682.1 (japonica cultivar-group) chromosome 9 clone

C-term = aaaa01035499.1 = CYP71Z11













>aaaa01042159.1 CYP71AK1 = old CYP71T9 (indica cultivar-group) 60% to AP003434.1b

58% to wheat AL821861 This seq may belong in another family or

subfamily like CYP703 = 71AK1



no japonica ortholog found 9/12/02


#275 = #377 reduce gene count by 1

>aaaa01010398.1 CYP71T10 (indica cultivar-group) not an exact match 71 like pseudogene fragment 75% to 71T5 in a small region





no japonica ortholog found 9/10/02


#377 = #275 reduce gene count by 1

>aaaa01017833.1 CYP71T10P (indica cultivar-group) N-term pseudogene fragment





No japonica ortholog found 9/11/02



>aaaa01005635.1 $PI CYP71U1P (indica cultivar-group) one stop codon, one fs

62% to AAAA01000843.1








7022 IKETLR (fs) 7005


6829 GDDIKATTVHMGFIPFGAGR (deletion of 18 aa heme signature region in seq gap) 6770



aaaa01005635.1 no ortholog in japonica on 9/7/02



>aaaa01000843.1 $FI CYP71U2 (indica cultivar-group) 63% to AAAA01005635.1 37% to 71B2

92% to AP004872.1 and AP005536.1 (00843 is best indica match for these seqs)







20418 SLTSPLTAEVIGALVI (0) 20371







aaaa01000843.1 $FI may not have an ortholog



>AP004872.1 $F CYP71U3 (japonica cultivar-group) chr 2 = AP005536.1  92% to aaaa01000843.1 (best match in indica) low percent for an ortholog












#486 incorrectly labeled as #200

>aaaa01025826.1 CYP71V1 (indica cultivar-group) orth AC096855.1 $F chr 3 98%









>AC096855.1 $F CYP71V1 chromosome 3 clone OJ1365_D05 54% to AC087550 frameshift before PERF?

= AQ326032 AQ329780 73% to AF321860 Lolium rigidum similar to CYP71D sequences












>aaaa01006345.1 CYP71V2 (indica cultivar-group) 77% to AC096855.1 $F

no orth 9/15/02














>aaaa01004037.1  CYP71V3 (indica cultivar-group) ortholog to AL732378.3 99%











>AL732378.3 $F CYP71V3













>aaaa01006105.1a $FI CYP71V4 (indica cultivar-group) similar to Lolium rigidum AF321859












aaaa01006105.1a  no japonica ortholog found 9/7/02



>aaaa01045745.1 CYP71V4 (indica cultivar-group) 64% to AC096855.1 $F

98% to aaaa01006105.1a $FI 2 diffs




no japonica ortholog found 9/12/02



>aaaa01006105.1b $FI CYP71V5 (indica cultivar-group)












aaaa01006105.1b no japonica ortholog found 9/7/02



>aaaa01006105.1c $PI CYP71V6P (indica cultivar-group) 79% to AAAA01006105.1b

but no Nterm exon present in 2000bp to end of clone









aaaa01006105.1c no japonica ortholog found 9/7/02



>aaaa01023722.1 $FI CYP71W1 (indica cultivar-group






944 ALTTEIISTVIF (0) 979






no japonica ortholog found 9/12/02



>aaaa01013880.1b CYP71W2P (indica cultivar-group) orth of AC120537.1a

stops are even in the same location






5227 TLRLH 5241


>AC120537.1a CYP71W2P chromosome 3 clone pseudogene fragment








>aaaa01013880.1a $FI CYP71W3 (indica cultivar-group) ortholog of AC120537.1b AQ869247.1












>AC120537.1b $F CYP71W3 chromosome 3 clone

AQ869247.1 nbeb0034D08r CUGI Rice BAC genomic Length = 447 53% to 99A1

AZ130570.1 OSJNBb0104D19r CUGI Rice BAC genomic Length = 327






81044 DLITNVVL (0) 81067







>aaaa01021177.1 $FI CYP71W4 (indica cultivar-group) ortholog to AC120537.1c

AAAA01039974.1 (indica cultivar-group) Nterm 132 aa







3411 IATVIM (0) 3394






>AC120537.1c $F CYP71W4 chromosome 3 clone OSJNBb0042N11

AQ573952 nbxb0083G09r 60% to AQ259669 52% to 99A1 51% to 71B23

BM039053 clone V013G04.Length = 527













>AC078894.1 $P CYP71W5P chromosome 10 clone OSJNBa0096G08 12 unordered pieces starts 123

probable pseudogene fragment 47% to 71B1 2 diffs with AP004175.1 $P

80% to 71W4




>AP004175.1 $P CYP71W6P chromosome 2 clone OJ1006_B12 pseudogene fragment

94% to AC078894 51119-50994




>aaaa01012657.1 CYP71X1P (indica cultivar-group) orth AP003990.1g $P chr 2 99%









>AP003990.1g $P CYP71X1P chromosome 2 clone OJ1073_F05 pseudogene





      missing mid region








>aaaa01007431.1b CYP71X2 (indica cultivar-group) orth AP003990.1f












>AP003990.1f $F CYP71X2 chromosome 2 clone OJ1073_F05






39144 ELETPLTMEQIKAVIL 39191 (0)







>aaaa01007431.1a CYP71X3 (indica cultivar-group) orth AP003990.1e $F chr 2 99%

lower case does not match japonica seq, but matches seq b











>AP003990.1e $F CYP71X3 chromosome 2 clone OJ1073_F05














>aaaa01070587.1 CYP71X3 (indica cultivar-group) orth AP003990.1e $F chr 2 96%

see aaaa01007431.1a for ortholog







>AP003990.1d $F CYP71X4 chromosome 2 clone OJ1073_F05 no ortholog






28291 GNLKAVIL 28314 (0)







>aaaa01017763.1 CYP71X5 (indica cultivar-group) orth AP003990.1c $F chr 2 97%






2182 KAIIL






>AP003990.1c $F CYP71X5 chromosome 2 clone OJ1073_F05 one in frame stop at W

AQ259669 61% identical to AQ328148 53% to 76C2 also has stop at W

AQ690680.1 nbxb0082B18f CUGI Rice BAC genomic clone Length = 768

AQ579195 nbxb0084A11f AQ509836 nbxb0094K16f 72% identical to AQ259671






17404 IKAIIL 17421 (0)







>aaaa01002047.1c $PI CYP71X6 (indica cultivar-group) ortholog of AP003990.1b 99%













>AP003990.1b $P CYP71X6 chromosome 2 clone OJ1073_F05






11908 MGNIKAVVL 11934 (0)


12730 IIKETLRLHPVVPLLLPRE 12786 frameshift





note cluster continues on AP003990.1 to sequence j



>aaaa01002047.1b $FI CYP71X7 (indica cultivar-group) ortholog of AP003990.1a 99%












>AP003990.1a $F CYP71X7 chromosome 2 clone OJ1073_F05 42% to 71B24

AQ259671 323-379 region I-helix 55% to 71B4

AQ691116.1 nbxb0088K01f CUGI Rice BAC genomic clone Length = 544













>aaaa01002047.1a $FI CYP71X8 (indica cultivar-group)

ortholog of AP004000.1a 99%






3582 IKAVVL 3599






>AP004000.1a $F CYP71X8 chromosome 2 clone OJ1115_B01






94407 VVL 94399 (0)







>aaaa01027906.1 CYP71X8 (indica cultivar-group) orth AP004000.1a $F chr 2 99%

see aaaa01002047.1a for ortholog







>aaaa01012191.1 CYP71X8 (indica cultivar-group) orth AP004000.1a $F chr 2 98%

see aaaa01002047.1a for ortholog








>aaaa01030108.1 CYP71X9P orth of AP004000.1b




>AP004000.1b $P CYP71X9P chromosome 2 clone OJ1115_B01 pseudogene fragment

3 aa diffs with AAAA01030108.1




>aaaa01025401.1 CYP71X10 (indica cultivar-group) orth AP004000.1c $F chr 2 98%









>AP004000.1c $F CYP71X10 chromosome 2 clone OJ1115_B01













>aaaa01002996.1a $FI CYP71X11 (indica cultivar-group) ortholog of AP004000.1d >99%






14179 TMGIIKAVIL 14208






>AP004000.1d $F CYP71X11 chromosome 2 clone OJ1115_B01






124750 TMGIIKAVIL 124779 (0)







>aaaa01002996.1b $FI CYP71X12 (indica cultivar-group) ortholog of AP004000.1e 99%












>AP004000.1e $F CYP71X12 chromosome 2 clone OJ1115_B01

AP004066.1 chromosome 2 clone OJ1572_F02, 55% to 71B17 aa 342-511 runs off beginning

contig of AA751324 and AQ327456 54% IDENTICAL TO 71B24   1/98 K-HELIX

58% identical to AQ328148




127690 VNVSERAAVLVTDTX 127731 frameshift









>aaaa01002645.1a $PI CYP71X13P (indica cultivar-group) sequence gap at 950 sequence

similarity stops at 236 (80% identical to AAAA01002645.1b)

ortholog to AP005385.1b $P 99%






>AP005385.1b $P CYP71X13P (japonica cultivar-group) chr 2 = aaaa01012992.1








       FS and Small deletion 19aa






>aaaa01012992.1 CYP71X13P (indica cultivar-group) 80% to AAAA01002645.1b

runs off end of clone (partialI) orth of AP005385.1b

see aaaa01002645.1a for ortholog




709 DMT 717 (fs)




>aaaa01002645.1b $FI CYP71X14 (indica cultivar-group) no introns 40% to 71B23

ortholog to AP005385.1a $F 99%












>AP005385.1a CYP71X14 (japonica cultivar-group) chr 2













>aaaa01008333.1a $FI CYP71X15 (indica cultivar-group) very similar to AP003990.1












no japonica ortholog on 9/7/02



>aaaa01008333.1b CYP71X16 (indica cultivar-group) runs off end of clone (partialI)

like AP004000 exon 2






no japonica ortholog on 12/24/03 NR, EST, HTGS



>aaaa01001712.1 $PI CYP71X17P (indica cultivar-group) missing C-terminal exon

not found in 20000bp of seq.








aaaa01001712.1 $PI no ortholog yet, no match in nr or HTGS 9/5/02



>aaaa01025223.1 CYP71Y1 (indica cultivar-group) orth? AP003571.1g $F chr 6 95%








637 RPERF 623




>AP003571.1g $F CYP71Y1 chromosome 6 clone P0458E02





       LVLLERTIEFAGGFNPADLWPS 139719 (?) bad exon boundary


140387 LQFPLAMDDIKSIIF 140428 (0)







>aaaa01101459.1 CYP71Y2P (indica cultivar-group) orth AP003571.1f $P chr 6 97%




>AP003571.1f $P CYP71Y2P chromosome 6 clone P0458E02 pseudogene fragment






>aaaa01007286.1 CYP71Y3 (indica cultivar-group) orth AP003571.1e $F chr 6 100%







>AP003571.1e $F CYP71Y3 chromosome 6 clone P0458E02






129811 DMLAIKQVIF 129837 (0)







>aaaa01048884.1 CYP71Y3 (indica cultivar-group) orth AP003571.1e $F chr 6

97% 3 diffs see aaaa01007286.1 for ortholog






>aaaa01040160.1 CYP71Y3 (indica cultivar-group) orth AP003571.1e $F chr 6 96%

see aaaa01007286.1 for ortholog



1021FRPERFED 1044




>aaaa01012291.1 CYP71Y4 (indica cultivar-group) orth AP003571.1d $F chr 6 99%











>AP003571.1d $F  CYP71Y4 chromosome 6 clone P0458E02






119291 VKCVVV 119308 (0)







>aaaa01020516.1 CYP71Y5 (indica cultivar-group) orth AP003571.1c $F chr 6 95%






>AP003571.1c $F CYP71Y5 chromosome 6 clone P0458E02

AQ328148 49% identical to C72289 58% to AQ327456 61% to AQ259669

56% to 71B3






107808 QFPFDMDVIKSVIH 107846 (0)







>aaaa01021346.1 CYP71Y5 (indica cultivar-group) orth AP003571.1c $F chr 6 98%

1 diff see aaaa01020516.1




>aaaa01083019.1 CYP71Y5 (indica cultivar-group) orth AP003571.1c $F chr 6 99%

see aaaa01020516.1 for ortholog






>aaaa01032282.1 CYP71Y5 (indica cultivar-group) orth AP003571.1c $F chr 6

100% see aaaa01020516.1 for ortholog







>aaaa01032612.1 CYP71Y5 (indica cultivar-group) orth AP003571.1c $F chr 6 100%

see aaaa01020516.1 for ortholog


1644 THDVSFATR 1670



>aaaa01053818.1 CYP71Y6 (indica cultivar-group) orth AP003571.1b $F chr 6 100%



960 ARRVASF 980


>AP003571.1b $F CYP71Y6 chromosome 6 clone P0458E02






81848 IT 81853 (0)





84154 LLRPVLRMPVPGV* 84195



>aaaa01076398.1 CYP71Y6 (indica cultivar-group) orth AP003571.1b $F chr 6

99% see aaaa01053818.1 for ortholog






>aaaa01098934.1 CYP71Y6 (indica cultivar-group) orth AP003571.1b $F chr 6 99%

see aaaa01053818.1 for ortholog






>aaaa01012578.1 CYP71Y7 (indica cultivar-group) orth AP003571.1a $F chr 6 99%







>AP003571.1a $F CYP71Y7 chromosome 6 clone P0458E02












>aaaa01011521.1b $FI CYP71Y8 (indica cultivar-group)












no japonica ortholog found 9/10/02



>aaaa01011521.1a $PI CYP71Y9P (indica cultivar-group)








2451 HKATAEVRHAFAAAGDVSEDALGELRYLQL 2540 (deletion of about 104 aa)




no japonica ortholog found 9/10/02



>aaaa01011369.1 CYP71Z1 (indica cultivar-group) orth AL606625.1 $F chr 4 99%









>AL606625.1 $F CYP71Z1 chromosome 4 clone OSJNBa0032I19 similar to 71B28 = AQ858445.1

AQ858445.1 nbeb0013M22r CUGI Rice BAC genomic Length = 824 54% to 71B23













>aaaa01002274.1a CYP71Z2 (indica cultivar-group) ortholog of AP003805.1 $F 100%

a duplicate of 1b






1188 TNQVITVLLW 1159


>aaaa01002274.1b CYP71Z2 (indica cultivar-group) ortholog of AP003805.1 $F 100%

duplicate of 1a count only once






23079 TNQVITVLLW 23108


>AP003805.1 $F CYP71Z2 chromosome 7 clone OJ1080_F08, similar to AC087550.2

39% to 71B23












>aaaa01000275.1 CYP71Z3 (indica cultivar-group) orth AC087550.2 $F chr 10, 100%

same as AAAA01002847.1 $FI see that accession below for ortholog





>aaaa01002847.1a $FI CYP71Z3 (indica cultivar-group) ortholog to AC087550.2a 99%

also aaaa01000275.1 part












>AC087550.2a $F CYP71Z3 chromosome 10 clone nbeb0016G17 74% to AC087554 seq 14167






131126 EGDTPIPITMELIVMLLF 131073 (0)







>aaaa01002847.1b $FI CYP71Z4 (indica cultivar-group) = aaaa01000275.1

ortholog to AC087550.2b >99% 1 diff






20863 ITNEVIVVLLF 20831






>AC087550.2b $F CYP71Z4 chromosome 10 clone nbeb0016G17 same as seq on AC087544 from 1-3082

AQ330340 nbxb0046P18r 60% to D48250 65% to 76C4 almost identical to AC087550.2













>aaaa01005737.1 $FI CYP71Z5 (indica cultivar-group) orth of AP004790.1 >99%











>AP004790.1 $F CYP71Z5 (japonica cultivar-group) chr 2






52568 VVLLF 52582







>aaaa01000393.1 $FI CYP71Z6 (indica cultivar-group) 89% to AP005114.1b






8847 VTDEIIVVLLF (0) 88315






aaaa01000393.1 has no ortholog in nr or HTGS 9/2/02



>aaaa01013736.1 $FI CYP71Z7 (indica cultivar-group) ortholog of BI811079.1 AP005114.1b






5531 LF (0) 5526






>AP005114.1b $F CYP71Z7 (japonica cultivar-group) chromosome 2

BI811079.1 clone K015D02.Length = 347 57% to AC087550.2 C-helix

41% to 71B11






121545 IIVVLLF (0) 121565







>aaaa01000805.1a CYP71Z8 partial (indica cultivar-group) 100% to AC087544.2






3653 PITNETMMLLLH 3618 sequence gap



>aaaa01000805.1b CYP71Z8 partial (indica cultivar-group) 100% to AC087544.2

duplicate of first 46 aa probably an assembly error. Count only once.



>AC087544.2 $F CYP71Z8 chromosome 10 clone nbxb0046P18,

47% to CYP71D7

AZ131846.1 OSJNBb0111D08r CUGI Rice BAC Length = 377 59% to 71B9

AZ132319.1 OSJNBb0062F12r CUGI Rice BAC genomicLength = 683













>aaaa01011405.1 CYP71Z8 (indica cultivar-group) orth AC087544.2 $F chr 10 99%

see aaaa01000805.1a = aaaa01000805.1b for ortholog



2514 KICPGITLG 2540



>aaaa01088222.1 CYP71Z10 i  not an exact match 64% to AP005114.1b $F

651bp frag. N-term runs off the end 69% to Zea mays BG836429




no japonica ortholog found 12/24/03



>aaaa01092069.1 CYP71Z9 (indica cultivar-group) 61% to AC087544.2 frag = 623bp

91% to Zea mays BG836429






no japonica ortholog found 12/24/03


>Note 71Z9 and 71Z10 may be from the same gene. An ortholog of Zea mays

CG360193, BG836429, CG360202, CC013336, CG376419  Zea mays













>aaaa01002599.1a CYP71AA1P (indica cultivar-group) orth of AP004326.2d 100%

even the frameshifts are the same








>AP004326.2d $P CYP71AA1P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence Gene 4 pseudogene



81304  KNTAIFVNTWALGR 81345 frameshift






>aaaa01002599.1b $FI CYP71AA2 (indica cultivar-group) ortholog of AP004326.2c $F 99%












>AP004326.2c $F CYP71AA2 genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence Gene 3 39% to 71B11







78390 VLF 78398 (0)







>aaaa01002599.1c $FI CYP71AA3 (indica cultivar-group) ortholog of AP004326.2b $F >99%












>AP004326.2b $F CYP71AA3 genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence

Gene 2 no good matches in NR 79% to AP004326.2c













cluster continues on AP004326.2 seq a



>aaaa01014066.1 CYP71AA4P (indica cultivar-group) orth AP004326.2a $P

chr 1 100%





>AP004326.2a $P CYP71AA4P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence

Length = 102983

4 genes 71B like

Gene 1 pseudogene 71 family

67989 LPPVPWPLPVIGSMH*LLGSLPHH 68060 frameshift with deletion


68228 GARP 68239 frameshift with small deletion



68886 GILAGGSDTTTTTVMWAMSELLRCPRAMQ 68972 frameshift with deletion






>aaaa01051575.1 CYP71AA5 (indica cultivar-group) 69% to AP004326.2b






no japonica ortholog found 12/24/03 best japonica match = 69% but Zea = 74%


>CG055548, CG372667, CG055546, CG349250  Zea mays genomic clones

74% possible ortholog of 71AA5

60% to 71AA2,




     LPPGPRPLPVIGNLHCLLGALPHH CA138911 Saccharum officinarum











>aaaa01010273.1 $FI CYP71AB1 (indica cultivar-group) ortholog of AC113337.1











>AC113337.1 $F CYP71AB1 (japonica cultivar-group) cultivar Nipponbare clone OSJNBa0061H20,

from chromosome 10

AC074355.2 Oryza sativa clone OSJNBa0071I20, gene 1 43% to 71A13

AQ288798 65-164 region C-helix 54% to 71A12 same as AC074355.2

AQ840770.1 nbxb0071I20f CUGI Rice BAC genomic cloneLength = 754

AQ840078.1 nbxb0051B18f CUGI Rice genomic cloneLength = 694

similar to lotus 71D

AQ865944.1 nbeb0026D10f BAC genomic Length = 473 59% to 99A1 69% to AP004000.1












>aaaa01009869.1 CYP71AB2 (indica cultivar-group) orth AP004684.1b $F chr6 98%










4421 EDL 4429


>AP004684.1b $F CYP71AB2 chromosome 6 clone P0012H03, Length = 163117

New seq similar to AP004000 57% to AP003523.1 78% to AP004688.1 

36% to 41% with 71A and 71B sequences possibly new subfamily in 71






118775 LTMGIIRAVIF 118807 (0)







>aaaa01002000.1 CYP71AB3 (indica cultivar-group) ortholog of AP004688.1 $F 98%






5146 IIF 5138






>AP004688.1 $F CYP71AB3 chromosome 6 clone P0036C11, Length = 137929

New seq similar to AP004000 37% to 71B23 52% to AP003523.1 78% to AP004684.1b 






58195 IKAIIF 58209 (0)







>aaaa01010030.1b CYP71AC1 (indica cultivar-group) orth AP003523.1b $F chr 6  99%






>AP003523.1b $F CYP71AC1 chromosome 6 clone P0416A11 six different genes

54-58% with genes in AP003090 and AP004000 group

38% to 41% with 71A and 71B sequences possibly new subfamily in 71







117196 MRIQKEGDDLDD 117161 (frameshift) LTMATVKAVIL (0)







>aaaa01031277.1 CYP71AC1 (indica cultivar-group) orth AP003523.1b $F chr 6 99%

see AP003523.1b above for ortholog






>aaaa01000575.1 $FI CYP71AC2 (indica cultivar-group) 74% to AP003523.1

same seq as aaaa01002303.1 $FI orth to AP005610.1 AP005192.1







30661 GGGTLSMSTVKAVIL (0) 30617







>aaaa01002303.1 $FI CYP71AC2 (indica cultivar-group) same seq as AAAA01000575.1

except 2 aa diffs and one short frameshifted region

see AAAA01000575.1 for ortholog












>AP005610.1 $F CYP71AC2 (japonica cultivar-group) chr 6 = AP005192.1












>AP005192.1 $F CYP71AC2 (japonica cultivar-group) chr 6













>aaaa01007044.1 $PI CYP71AC3P (indica cultivar-group) seq gap at 5222 no Nterm exon

might be in this gap but also one frameshift so probably a pseudogene of an

AP003523 like gene.

6146 DMFAGGSETTSTTLEWA 6196 (frameshift and deletion of )





aaaa01007044.1 no japonica ortholog found 9/7/02



>aaaa01034252.1 CYP71AC4P = same gene as AC3P (indica cultivar-group)

77% to AP003523.1b may be a pseudogene





>AC137921.2  Download subject sequence spanning the HSP Oryza sativa chromosome 3 BAC OSJNBa0027H16 genomic sequence, complete


          Length = 163108


CYP1C3P/4P combined


deletion of 15 aa



159770 GRPMTDLALRAIMGE 159726 (AA 219)

deletion of 34 aa



THIS PIECE = ORTHOLOG OF aaaa01007044.1 = 71AC3P  2 AA DIFFS

(AA 337) DMFAGGSETTSTTLEWAL (FS and 6 aa deletion)







>aaaa01021566.1 CYP71AC5P (indica cultivar-group) orth of AL606658.1 2 diffs

lone pseudogene fragment


1228 AVGSRSGD 1251


>AL606658.1 $P CYP71AC5P chromosome 4 clone OSJNBb0016D16 lone pseudogene fragment

72% to AP003523 118132-115478




>aaaa01013200.1 $PI CYP71AC6P (indica cultivar-group) 3 diffs with AL606658.1 95%

94% to AP004571.1 and AP004327.1 lone pseudogene fragment


7645 VESRSGD 7665


>AP004571.1 $P CYP71AC6P (japonica cultivar-group) chr 6 94% to AAAA01013200.1

identical to AP004327.1 lone pseudogene fragment


60285 VGSRSGD 60265


>AP004327.1 $P CYP71AC6P (japonica cultivar-group) chr 6 94% to AAAA01013200.1 4 diffs

identical to AP004571.1 lone pseudogene fragment


105944 VGSRSGD 105964



>aaaa01017762.1 $PI CYP71AC7P (indica cultivar-group) 89% to AL606658.1

92% to AAAA01013200.1 lone pseudogene fragment


4016 IRSRSGD 3996



>aaaa01011555.1 CYP71AD1 (indica cultivar-group) orth AC109595.1 $F chr 5 >99%



7970 RY 7965







6909 IPLRLV 6892


>AC109595.1 $F CYP71AD1 chr 5 39% to 71As 40% to 71Bs

44% to 71Cs clone OJ1212B02, Length = 126962












>aaaa01019060.1 $FI CYP71AE1 (indica cultivar-group) one stop in exon 2












No japonica ortholog found 9/11/02


#382 = #425 = #40 reduce gene count by 2

>AQ573853 nbxb0085A03r CYP71AE2 (partial)   50% to 71A24 AQ691042 nbxb0086M20r

AQ795917.1 nbxb0058F03f CUGI Rice BAC genomic clone Length = 684

No indica ortholog found




#40 = #382 = #425 reduce gene count by 2

>AQ573853 nbxb0085A03r CYP71AE2 (partial)   50% to 71A24 AQ691042 nbxb0086M20r

AQ795917.1 nbxb0058F03f CUGI Rice BAC genomic clone Length = 684

No indica ortholog found 9/3/02




#425 = #382 = #40 reduce gene count by 2

>aaaa01032609.1 CYP71AE2 (indica cultivar-group) 70% to AAAA01019060.1

orth of AC132003.1 100%









>AC132003.1 $F CYP71AE2 (japonica cultivar-group) chr 11 65% to aaaa01019060.1














>aaaa01010030.1a CYP71AF1 (indica cultivar-group) ortholog of AP003523.1a

see aaaa01010030.1c for ortholog












>aaaa01010030.1c CYP71AF1 (indica cultivar-group) AP003523.1a $F chr 6 100% 1 diff with 1a may be an accidental duplication in assembly count only once






>AP003523.1a $F CYP71AF1 chr 6 clone P0416A11 six different genes

AQ271656 nbxb0026B09r 53% to 71A16 N-term

35% to 40% with 71A and 71B sequences possibly new subfamily in 71












>aaaa01041444.1 CYP71AF1 (indica cultivar-group) orth AP003523.1a $F chr 6 100%

see AP003523.1a above for ortholog





>aaaa01066426.1 CYP71AG1 (indica cultivar-group) 39% to AP003434.1

C-helix to J-helix

    APHGPYWX (frameshift)







no japonica ortholog found 12/25/03


>CK207340   FGAS018961 Triticum aestivum FGAS: Library 5 GATE 7 Triticum

           aestivum cDNA.

          Length = 1048







             F KDV GRIV G  A    DG G R ++DALLEE   LLG FH G+Y P    ++  DG




             +A+V   F++I  +L+E+ D    R    +  G G G











>aaaa01035499.1 CYP71AK1 = OLD CYP71Z11 (indica cultivar-group)

3% to AP005114.1b (partialI)

no ortholog in known set, IN a new subfamily WITH AK120674 CYP71AK2 (64%)



363 RCRTI* 380



>BI808626.1 CYP71AK2 = OLD CYP71Z12 (partial) clone D005B07.Length = 538 EST with numerous frameshifts similar to AAAA01035499.1 and 71Bs no ortholog found in indica

no extensions in htgs nr gss or est sections of Genbank 8/3/02

66% to AY104083.1 Zea mays




>AK120674   CYP71AK2    1763 bp    mRNA    linear   PLN 29-OCT-2003

DEFINITION  Oryza sativa (japonica cultivar-group) cDNA clone:J013161I12, full

            insert sequence. PROBABLY NOT 71Z SUBFAMILY 45% TO 71T4

55% to 71T8 names need revision













>aaaa01007330.1b (indica cultivar-group) orth CYP72A17 $F AP002839 100%





>CYP72A17 $F AP002839 Oryza sativa genomic DNA, chromosome 1 36553-39431

AG025591.1 strain ND3008 PCR from rice genomic DNA clone T8121T.Length = 401

AG025107.1 strain NC2542 PCR from rice genomic DNA clone T5184T.Length = 504

AU071192 very similar to AQ050520 = 72A17

AP002744 CYP72A17 join(109468..109819,110022..110245,110529..110781,










NGVSRLKV (phase 0 intron)






>aaaa01007330.1a (indica cultivar-group) orth CYP72A18 $F AP002839 100%





>CYP72A18 $F AP002839 Oryza sativa genomic DNA, chromosome 1 44993-41630

AU100789.1 Rice callus Oryza sativa cDNA clone C50810.Length = 419 C-term

AU102126.1 Rice callus cDNA clone C10756.Length = 571

AZ130306.1 OSJNBb0103O04r CUGI Rice BAC genomicLength = 320

C26802 36% TO 72  8/97 N-TERMINAL 19-67 REGION opposite end = C96903

C96903, C97406 58% IDENTICAL TO 72 C-TERM 65% to AQ050520

C96799, C28139 219-340 REGION 55% IDENTICAL TO 72 opposite end = C97406

D22332        48% TO 72     12/93  7/98 C-HELIX 89-191 REGION

AU081507.1 Rice callus Oryza sativa cDNA clone C12518_12Z.Length = 581

C26235        36% IDENTICAL TO 72     8/97 AMINO ACIDS 89-216 REGION

AP002744 complement(join(114545..114970,115379..115757,


D21882        53% TO 72   5/93  7/98 245-352 REGION = 72A18
















>aaaa01029515.1 (indica cultivar-group) orth CYP72A19 $F AP002839 chr 1 100%





>CYP72A19 $F AP002839 Oryza sativa genomic DNA, chromosome 1 comp(53699-51708)

AU100635.1 Rice callus clone C10787.Length = 594

AG024141.1 strain ND3053 PCR from ricegenomic clone ND3053_0_734_1A.Length = 374

AP002744 complement(join(124623..125048,125181..125565,

125743..125987,126105..126584)) this annotation missing first 10 aa















>aaaa01012480.1 (indica cultivar-group) orth CYP72A20 $F AP002839 98% chr 1





>CYP72A20 $F AP002839 Oryza sativa genomic DNA, chromosome 1 56581-59004

AP002744 join(129496..129808,130309..130529,130636..130883, 131004..131919)




RRILNPAFHLEKLK (phase 0 intron)





NFDGLSRLKT (intron joint not correct as in gene 3)






>aaaa01070145.1 (indica cultivar-group) orth CYP72A21 $F AP002839 chr 1, 100%





>CYP72A21 $F AP002839 Oryza sativa genomic DNA, chromosome 1 61993-63890

AZ045374.1 nbeb0080P16f CUGI Rice BAC genomic Length = 843

AQ857269.1 nbeb0005G04r CUGI Rice BAC genomic Length = 855

AQ865258.1 nbeb0025C03f CUGI Rice BAC genomicLength = 738

AP002744 join(134887..135417,135523..135767,135888..136272,

136380..136805) this annotation adds first 7 aa

AQ050520, AQ272173, AQ159375, AU031882 (opposite end = D24685)

AQ575977 nbxb0088K02r

D24685.1 RICR2374A Rice root cDNA clone R2374_1A.Length = 419 = 72A














>aaaa01018418.1 (indica cultivar-group) orth CYP72A22 $F AP002839 100%





>CYP72A22 $F AP002839 Oryza sativa genomic DNA, chromosome 1 66435-68424

AP002744 join(139350..139880,140025..140278,140419..140806,









GLSRLKI (intron joint not correct)






>aaaa01017648.1 (indica cultivar-group) orth of CYP72A23 $F AP002839






1820 HAPHTVMTL 1794


>CYP72A23 $F AP002839 Oryza sativa genomic DNA, chromosome 1 72149-74091

AP002744 join(145064..145603,145697..145941,146081..146465,


AU067870 Rice callus Oryza sativa cDNA clone C10320_12Z, CYP72 like Nterm

AU067871 AU067869 very similar to AQ050520 K-helix to heme















>aaaa01002256.1a (indica cultivar-group) orth CYP72A24 $F AP002839 chr 1 100%




>CYP72A24 $F AP002839 Oryza sativa genomic DNA, chromosome 1 109970-113787

AQ864347.1 nbeb0023A03r CUGI Rice BAC genomicLength = 735
















>aaaa01002256.1b (indica cultivar-group) orth CYP72A25 $F AP002839 2 diffs



21832 GINHLK





>CYP72A25 $F AP002839 Oryza sativa genomic DNA, chromosome 1 115472-117492

AG021553.1 strain NC0134 PCR from rice genomic DNA clone NC0134_0_102_1A.

Length = 636 AG021553

AG023207.1 strain NC2780 PCR from rice clone NC2780_0_701_1A.Length = 474















>aaaa01009673.1 CYP72A31P (indica cultivar-group) orth AP003278 $P chr 1 96%





>AP003278 $P CYP72A31P chromosome 1, PAC clone:P0518F01, similar to 72A22 missing N-term half

AP003330.1 chromosome 1 clone B1085F01 CYP72A like

Pseudogene, no N-term in 9000bp upstream until next p450 ends near 22400






32390 APHTMVTLHPMHGAQMKVRAI 32452 or frameshift after KVR to



Note there are two more P450s on AP003278 called a and b



>aaaa01035549.1 CYP72A31P (indica cultivar-group) orth AP003278 $P chr 1

see aaaa01009673.1 for ortholog






>aaaa01013993.1 CYP72A32 (indica cultivar-group) orth AP003278a $F chr 1 100%





>AP003278a $F CYP72A32 19863-22437 chromosome 1, PAC clone:P0518F01, similar to 72A22

AP003330.1 50023-47446 chromosome 1 clone B1085F01, CYP72A like 536aa

AP004738.1 Oryza sativa chromosome 6 clone OSJNBa0090D06 chrom. conflict










      VTMILYEVLR 47842



47481 MHGAQIKIRAI* 47446



>aaaa01003187.1a CYP72A33 (indica cultivar-group) orth of AP003278b $F chr 1, 82% to 72A22






>aaaa01003187.1b CYP72A33 (indica cultivar-group) orth of AP003278b $F chr 1, 82% to 72A22 these two seem identical only count once






>AP003278b $F CYP72A33 chromosome 1, PAC clone:P0518F01, 82% to 72A22

AP003330.1 59493-56536 chromosome 1 clone B1085F01, CYP72A like 516aa

N-term does not match in both, 3278 has MVLGGGWLSMWAPASSPTILAAFGLVGLVLAWQ

before the AGLQ seq.














note: there is one more gene on AP003278



>aaaa01009485.1 CYP72A34 (indica cultivar-group) ortholog of AC119289.1 AQ916317.1



1624 RILNHAFHHEKIK 1662 (0?)





3125 SRLKI 3139 (0?)





>AC119289.1 $F CYP72A34 (japonica cultivar-group) chromosome 5 clone

AQ916317.1 nbeb0063E04r CUGI Rice BAC genomicLength = 521 52% to 72A7

AQ871967.1 nbeb0045H22r CUGI Rice BAC genomicLength = 824




54887 HRRILNHAFHHEKIK (0) 54931





56394 SRLKI 56417 (0?)






>aaaa01001473.1 CYP72A35 (indica cultivar-group) orth of AP002899 $F 99%





>AP002899 $F CYP72A35 52% to 72A14 = AQ161379















>aaaa01004480.1 CYP72A36P (indica cultivar-group) ortholog of AP003142.2


7499 GMSIED 7482


>AP003142.2 $P CYP72A36P chromosome 1, PAC clone:P0435H01 probable pseudogene

53% to 72A15 86% to AP002899


5180 EVGMSIED 5157

1115 IIEECRLFYFAGSETTS 1065 frameshift




>aaaa01005990.1 CYP72A37P (indica cultivar-group) orth of AP004019.1b




>AP004019.1b $P CYP72A37P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice Pseudogene fragment 2

37945 LSLMSLAFPTCNEELVWR*TE 37883 frameshift




>AP004019.1a $P CYP72A38P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice Pseudogene fragment 1 no indica ortholog 9/7/02




>aaaa01004255.1 $PI CYP73A35P (indica cultivar-group) ortholog of 73A35P




15677 LRADPA 15660 (fs)










>CYP73A35P   $P Oryza sativa (rice)  GenEMBL AP003446.1 March 29, 2001

AP003302.1  Feb. 21, 2001 Both sequences have the same frameshifts



VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 (25 nuc. deletion and frameshift in both sequences)




AIETTLWSMEWAIAEL (2 nuc. insertion and frameshift in both seqs.)






>aaaa01002376.1 $FI CYP73A38 (indica cultivar-group) ortholog to AQ256364.1

73% to 73A5













>AQ256364.1 CYP73A38 (partial) nbxb0016O01r CUGI Rice BAC clone nbxb0016O01r.Length = 607

84% to 73A5 82% to AP003446 probable CYP73A rice gene

ortholog to aaaa01002376.1 complete

AQ576280.1 nbxb0088L20r CUGI Rice BAC genomic clone

AQ289078.1 nbxb0034K09r CUGI Rice BAC genomic clone




>aaaa01006093.1a $FI CYP73A39 (indica cultivar-group) 99% to AP004850.1b






5607 FNNNYVEKRR (2) 5578






>AP004850.1b $F CYP73A39 (japonica cultivar-group) chromosome 2 clone OJ1342_D02

100% identical to AP004859.1a AU093333.1













>aaaa01006093.1b $FI CYP73A40 (indica cultivar-group) 99% to AP004850.1a

98% to AAAA01006093.1a






12244 FNNNYVEKRR (2) 12273






>AP004850.1a $F CYP73A40 (japonica cultivar-group) chromosome 2 clone OJ1342_D02

98% identical to AP004850.1b  100% to AP004859.1b












>aaaa01002175.1 CYP74A4 (indica cultivar-group) orth of AC099043.1 $F chromosome 3 100%











>AC099043.1 $F CYP74A4 chromosome 3 clone OSJNBa0079B15, Length = 155583

63% to AP004181.1 chromosome 2 56% to 74A Arab

AU031582 AU031583













>aaaa01021750.1 CYP74A5 (indica cultivar-group) orth to AC107226.1 $F chromosome 3 100%










>AC107226.1 $F CYP74A5 chromosome 3

allene oxide synthase (AOS) gene, complete cds.AY062258

98% to AY055775 allene oxide synthase (AOS) probably same gene

N-term matches C72393, D47977, C99549 95%

Same as AC107207.1 chromosome 3 clone OSJNBb0106M04












>aaaa01001499.1 CYP74E1 (indica cultivar-group) 85% to AP004181.1 $F









>AP004996.1a $F CYP74E1 (japonica cultivar-group) chr 2












>aaaa01015196.1 CYP74E2 (indica cultivar-group) orth to AP004181.1 $F chromosome 2 96%





>AP004181.1 $F CYP74E2 chromosome 2 clone OJ1136_G09, AU184424.1 45% to 74A of Arabidopsis











>AP004996.1b $F CYP74E2 (japonica cultivar-group) chr 2 = AP004181.1













>aaaa01034814.1 CYP74E3P (indica cultivar-group) 76% to AP004181 $F

8 diffs with AP004996.1a 94%






no japonica ortholog found 9/12/02



>aaaa01005693.1 CYP74F1 (indica cultivar-group) 53% to 74B2 orth to AP004752.1 99%










>AP004752.1 $F CYP74F1 (japonica cultivar-group) chr 2












>aaaa01085971.1 CYP75A11 (indica cultivar-group) 45% to AC021892.5 48% to 75B1

AAAA01009188.1 (indica cultivar-group) orth of AC125784.1








>AC125784.1 $F CYP75A11 ortholog of AAAA01085971.1 100% AAAA01009188.1 1 aa diff

AU071096 BI796894 BI796059  50% to C99304 like 75B1












>aaaa01005609.1 $FI CYP75B3 (indica cultivar-group) orth AC021892.5 $F chr 10 98% compare to aaaa01006229.1a and 1b 100% match












>AC021892.5 $F CYP75B3 chromosome 10 clone OSJNBa0053D03 21 unordered pieces

          Length = 175567 65% to 75B1 compare to aaaa01006229.1a and 1b













>aaaa01006229.1a CYP75B3 (indica cultivar-group) orth AC021892.5 $F chr 10

these two sequences are exactly identical (probably an error in assembly)

also 100% to aaaa01005609.1 count only once see aaaa01005609.1 for ortholog












>aaaa01006229.1b CYP75B3 (indica cultivar-group) orth AC021892.5 $F chr 10

these two sequences are exactly identical (probably an error in assembly)












>aaaa01010988.1 CYP75B4 (indica cultivar-group) orth AC119149.2 $F chr 10 99%

see aaaa01018574.1 for ortholog







>aaaa01018574.1 CYP75B4 (indica cultivar-group) orth AC119149.2 $F chr 10 99%








>AC119149.2 $F CYP75B4 Nipponbare strain, clone OSJNBb0079E01, from ch 10

53% to 75B1

D48413, AU032067 AU173484.1 AU222694.1 47% IDENTICAL TO 75B1 N-TERMINAL REGION

C99304 opposite end = C19579 65% to 75B1 74% to AC021892

3 prime UTR matches AU173485 Rice root Oryza sativa cDNA clone R3314.

Which is the opposite end of AU173484 so these are from the same gene

3 prime UTR Also = AU032964 Rice shoot Oryza sativa cDNA clone S0065_2Z.

AU032242 58% identical to C97611 47% to AA754300 47% to 75B1 I helix













>aaaa01001667.1a $FI CYP76H4 (indica cultivar-group) ortholog of AC118672.1b











>AC118672.1b $F CYP76H4 (japonica cultivar-group) chromosome 3 (3 frameshifts)

C72289       63% to 76C2 337-453 region clone E1370 like AC078944

AU093938.1 Rice panicle cDNA clone E1370. Length = 642 43% to 77A4

BE230674.1 99AS896 Rice Seedling cDNA Library cDNA clone 99AS896.

BI813139 cDNA clone J002F10.Length = 569 = C72289



30003 AFSARSVPD 30029 (fs)









31340 AVAIPV* 31360



>aaaa01001667.1b CYP76H5 (indica cultivar-group) ortholog of AC118672.1a









>AC118672.1a $F CYP76H5 (japonica cultivar-group) chromosome 3 45% to 76C2












>aaaa01004378.1a CYP76H6 (indica cultivar-group) orth AC116603.1a $F chr 10, 98%

11306 GLHDDALRSVFT (0) 11271 fragment of N-term exon

seq gap here may contain missing 76H6 N-terminal exon






>AC116603.1a $F CYP76H6 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10

CB000966 = EST for C-term exon starts at exon 2 DLF so cannot tell

which exon 1 is used.

9135 MAALFLWLSWLVL 9097 (frameshift)











>possible Zea ortholog of 76H6

>CG052632 CG208675 CG328504 CG328491   OGYBY35TV ZM_0.7_1.5_KB Zea mays genomic clone ZMMBMa0644F21.

          Length = 974













>aaaa01004378.1b CYP76H7 (indica cultivar-group) orth AC116603.1b $F chr 10

This exon in both japonica and indica upstream of 76H6.  It may be

a pseudogene or an alternative first exon to 76H6

sequence gap here, missing 13 aa at N-term

13189 LSLLSIYLLD frameshift

      ILAHSRRRLPPGP frameshift







>AC116603.1b CYP76H7 (partial) Nipponbare strain, clone OSJNBb0015J03, from chromosome 10






11546 VFT (0) 11538



>aaaa01019517.1 CYP76H8 (indica cultivar-group) ortholog to AQ869312.1 AC116603.1c

N-term does not match as well. 47% to 76C2 78% to AC078944.5






3665 TLRSLFT (0?) 3645






>AC116603.1c $F CYP76H8 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10,

AQ869312.1 70% to AC078944.1 168857-163366 same as AQ913628.1












>aaaa01025351.1 CYP76H8 (indica cultivar-group) orth? AC116603.1c $F 94% 2 diffs

1aa diff and 7aa deletion vs aaaa01019517.1 see aaaa01019517.1 for ortholog




>aaaa01001606.1a CYP76H9 (indica cultivar-group) ortholog of AC078944.5b >99%

AAAA01032734.1 (indica cultivar-group) missing Cterm, runs off end












>AC078944.5b $F CYP76H9 clone OSJNBa0089D15

47% TO AJ237995.1 Vitis vinifera 76F2 45% to 76C3












>aaaa01026521.1 CYP76H10 (indica cultivar-group) ortholog of AC078944.5a 99%

AAAA01001606.1b (indica cultivar-group)









>AC078944.5a $P CYP76H10 clone OSJNBa0089D15 2 large insertions probably make this a pseudogene 47% to 76C2






9.4kb insertion here

103281 DLFAAGSDTSPSIVEWAIAELMRNPLCMIRAC 103376 probable 10.5 kb insertion here







>aaaa01012542.1 CYP76H11 (indica cultivar-group) orth AP004183.1 $P chr 8 99%






4944 TVIQL 4930






>AP004183.1 $P CYP76H11 chr 8 clone OJ1221_H04, Pseudogene 74% to AC078944.1 118250-117423

AP004751.1 chromosome 8 clone P0494D11


51067 PLMSLRLGAVTTVVASSPAVA 51005 frameshift

51003 REILHRHDAAFASRPRGDSTG 50962 numerous frameshifts in the next 60 nucleotides

possible reconstructed seq. NHARE PVAWPAHNAPGWGA LR


      but no AG junction










>aaaa01028537.1 CYP76H12P (indica cultivar-group) orth AP003261.1 $P chr 1 98% 1 diff




>AP003261.1 $P CYP76H12P chromosome 1 clone P0471B04,

N-terminal exon of a CYP75 like sequence 70% identical to X70824 but no other part of

the gene is found.  Identical to AP003227 87336-87082 almost identical to AP003214





>AP003214.3 $P CYP76H13P almost identical to AP003227 related to CYP75

90% to aaaa01028537.1 89% to AP003261.1


157244 RPPSPGGGRRLPPD 157203 frameshift





>AP003622 $P CYP76H14P chromosome 6 clone P0633E08 related to AC025783.5 exon 1

also 1 difference to aaaa01012542.1

105535 DLLGGALSLLPLLEWFRLVVGPRGFVVVCDHAFSRHVLCE 105654 frameshift and 6 aa deletion

105656 KGLVAEVSKFLFG 105694



>aaaa01007618.1 CYP76H15P (indica cultivar-group) ortholog to AC025783.5b



>AC025783.5b $P CYP76H15P chromosome 10 clone OSJNBa0001O14 1 ordered pieces Length = 180630

Extra 97C first exon (pseudogene)





>AC078944.1 CYP76H16P (partial) clone OSJNBa0089D15,9 unordered pieces

51% to 71C4 this seq is not found in version 5 of this accession

no indica ortholog found 9/3/02 41% to 76H10 very decayed hard to place





>aaaa01008113.1 $FI CYP76K1 (indica cultivar-group) orth of APOO5308.1b 99%






7839 ERPLIRALMT (0) 7868






>AP005308.1b $F CYP76K1 (japonica cultivar-group) chr 9 = AP005575.1 74864-72921






146121 PLIRALM 146141







>aaaa01007971.1 CYP76K2P (indica cultivar-group) orth of AP005308.1a

71% to AP005308.1b



>AP005308.1a $P CYP76K2P (japonica cultivar-group) chr 9 = AP005575.1 97551-97718




>aaaa01005655.1 $FI CYP76L1 (indica cultivar-group) orth of AP005308.1c 100%






11259 SADQLSLDTIKTFLG (0) 11215






>AP005308.1c $F CYP76L1 (japonica cultivar-group) chr 9 = AP005575.1 67708-65225






153307 FLG 153315







>aaaa01003137.1 $FI CYP76M1 (indica cultivar-group) ortholog to AU173996.1

44% to 76C4 (C-term does not match cDNA check for fs in cDNA)











>AU173996.1 CYP76M1 (partial) cDNA clone S12633. Length = 451 New seq 66% to AP003623.1 aa 413-458 no larger pieces are known


probable fs here does not match aaaa01003137.1




>aaaa01004597.1b $PI CYP76M2 (indica cultivar-group) missing Nterm 42% to 76C4

89% to Nterm of AU172561.1 6 diffs with BI808700.1

ortholog of AP005254.1a









Inverted orientation


Small deletion




>AP005254.1a $F CYP76M2 (japonica cultivar-group) chromosome 8 = AF488522.1 PM-II

42% to 76C4 = BI808700.1












>aaaa01004597.1a CYP76M3P (indica cultivar-group) 3 diffs with BI808700.1

runs off end of scaffold see aaaa01004597.1b for AP005254.1a seq

same as aaaa01018916.1 and aaaa01004597.1b possibly two similar genes

close together and this one may be the same as aaaa01018916.1





>aaaa01018916.1 $PI CYP76M3P (indica cultivar-group) missing Nterm, inverted seq at end

85% to Nterm of AU172561.1 4 diffs with BI808700.1 96% to AP005254.1a $F chr 8









Inverted sequence orientation





may not have a complete ortholog



>aaaa01013893.1 $PI CYP76M4P (indica cultivar-group) pseudogene (gap in sequence)

3 diffs with Nterm of AU172561.1 93% to Cterm of AU172561.1

ortholog of AP005254.1b (5 diffs)




4141 LNL 44 amino acid gap








>AP005254.1b $P CYP76M4P (japonica cultivar-group) chromosome 8




      QVVYGGVLN 44 amino acids missing

81582 LRRLDLQGWRRWA (fs) 81544








>aaaa01093009.1 CYP76M4P (indica cultivar-group) orth AP005254.1b $P chr 8 100%

see aaaa01013893.1 for ortholog







>aaaa01076605.1 CYP76M4P (indica cultivar-group) ortholog of AP005254.1b 100%

AU172561.1 (1 diff) see aaaa01013893.1 for ortholog





>aaaa01011645.1 $FI CYP76M5 (indica cultivar-group) one frameshift no introns (partialI)

runs off end 66% to AP005254.1a continues on AAAA01039014.1











No japonica ortholog found 9/10/02



>aaaa01008405.1 CYP76M6 (indica cultivar-group) top part of ortholog to BI813130.1

AAAA01075650.1 (indica cultivar-group) ortholog of BI813130.1 (4 diffs)

Orth to AP005114.1a








186 QSSHTSYIYSLRPKI* 139 check end vs AP005114.1a


>AP005114.1a $F CYP76M6 (japonica cultivar-group) chromosome 2 clone P0689H05

BI813130.1 cDNA clone J002D01.Length = 497 75% to BI808700.1 68% to AP003623

BI813468.1 K008G06 Oryza sativa mature leaf library induced by M.grisea Oryza

sativa cDNA clone K008G06.Length = 474

best rice match AP003623.1 chromosome 6 63% clone P0642B07 41% to 76C4 = AU095771












>aaaa01004667.1b $FI CYP76M7 (indica cultivar-group) ortholog of AP003623.1 











>AP003623.1 $F CYP76M7 chromosome 6 clone P0642B07 41% to 76C4 = AU095771

89% to CONTIG OF C72003, C99202

D46292        42% to 71B6 and 71B8   3/95   8/95 17-91 REGION

AU032289 29% to 76C3, 30% to 71B4












>aaaa01008385.1 CYP76M8 (indica cultivar-group) missing the Nterminal

ortholog of C72003 contig










>CONTIG OF C72003, C99202 CYP76M8 (partial) 34% to 76C4 some identical runs with AU032289

34% TO 76C4 same clone = C19444

90% to AP003623.1 opposite end of AU176462

AU176462.1 clone E10426.Length = 475 90% to AP003623.1 also AU182232.1

opposite end of C19444 CONTIG OF C72003, C99202 lower case from AP003623.1

There are two closely related genes

This part 97% to AAAA01008385.1 93% to AAAA01004667.1






This part 98% to AAAA01008385.1 90% to AAAA01004667.1 from opposite end of C19444





>aaaa01000831.1 $FI CYP76M9 extra Nterm seq orth of AP004684.1a











>AP004684.1a $F CYP76M9 chromosome 6 clone P0012H03, Length = 163117 41% to

76C2 New seq 76% to CONTIG OF C72003 (c-term) 59% to AP003623.1 70% to AU173996.1














>aaaa01000493.1a CYP76M10 (indica cultivar-group) 3 pseudogene fragments

100% to AP005254.1c with a deletion in the Ihelix





4046 AIPILAS 4066


>AP005254.1c $F CYP76M10 (japonica cultivar-group) chromosome 8 = AF488521.1 PM-I

1 diff with BM038607.1 = AP005245.1 15190-16707 41% to 76C2












>aaaa01069756.1 CYP76M10 (indica cultivar-group) orth AP005254.1c $F chr 8 100%

see aaaa01000493.1a for ortholog



724 GVRERK 741



>aaaa01000493.1b CYP76M11P (indica cultivar-group) 3 pseudogene fragments

1 aa diff with AP005254.1d but shorter








>aaaa01000493.1c CYP76M11P (indica cultivar-group) 3 pseudogene fragments

100% to AP005254.1d but shorter





>AP005254.1d CYP76M11P (japonica cultivargroup) chromosome 8 aa 227-504

same as AP005245.1 21717-20866 ortholog of AAAA01000493.1 99% partial

upstream seq missing in both accession numbers and in AAAA01000493.1

probable pseudogene

AAAA01000493.1 has two copies of this and a third sequence









>aaaa01004667.1a $PI CYP76M12P (indica cultivar-group)

Cterm pseudogene fragment





>AL713947.1 $F CYP76M13 chromosome 12 clone Monsanto-OJ1003_A04,

AQ259099 41-60 N-term similar to 71B7 no ortholog found in indica 9/3/03

39% to 76C2 57% to 76M2












>AP003267.1 $F CYP76M14 chromosome 1 clone P0496H05 38% to 76C4

no indica ortholog found 9/3/02 64% to 76M7












>aaaa01014464.1 $FI CYP76N1 (indica cultivar-group) 92% to AP005069.1a












no japonica ortholog found 9/11/02


>AP005069.1a CYP76N1 (japonica cultivar-group) chr 2 no indica ortholog found 9/11/02




17003 FEAFLGILSCTAFSADLVDP 16944 frameshift



16509 RNNIKGLIA 16483







>aaaa01007897.1 $FI CYP76N2 (indica cultivar-group)












aaaa01007897.1 has no japonica ortholog in nr or HTGS on 9/7/02



>aaaa01010283.1 CYP76N3 (indica cultivar-group) orth AC074054.1a $F chr 10 97% 2 aa diffs




>AC074054.1a $F CYP76N3 chromosome 10 clone OSJNBa0090A14 gene 1

AC074355.2 23873-18195 clone OSJNBa0071I20, gene 2 39% to 76C2



21574 MRMLCTEELL 21545










>aaaa01049788.1 CYP76N3 (indica cultivar-group) orth AC074054.1a $F chr 10 98%

see aaaa01010283.1 for ortholog






>aaaa01082499.1 CYP76N4P (indica cultivar-group) 52% to aaaa01007897.1 76N2 $FI





no japonica ortholog found 9/12/02



>aaaa01014488.1 CYP76P1 (indica cultivar-group) orth AC074105.1 $F chr 10 99%




545 ATPLHAI 565


>AC074105.1 $F CYP76P1 chr 10 clone OSJNBa0030B02 19 unordered pieces 39% to 76F2

40% to 76C2







59237 SSLTMN 59220







>aaaa01014797.1 CYP76P1 (indica cultivar-group) orth AC074105.1 $F chr 10 99%

see aaaa01014488.1 above









>aaaa01010028.1 CYP76P2 (indica cultivar-group) ortholog to AL831811.1 99%











>AL831811.1 $F CYP76P2 chr 12













>aaaa01001621.1a $FI CYP76P3 (indica cultivar-group) ortholog of AC092749.1b >99%






10037RDLIRTFLT 10063 (0?)






>AC092749.1b $F CYP76P3 clone OSJNBb0023M11, from chromosome 10, complete sequence

35% to 76C3 53% to AC074105.1













>aaaa01001621.1b $PI CYP76P4P (indica cultivar-group) ortholog of AC092749.1a $P 1 aa diff





>AC092749.1a $P CYP76P4P clone OSJNBb0023M11, from chromosome 10, complete sequence

probable pseudogene fragments aa 66-198 upstream of complete gene






>aaaa01005754.1 CYP76P5 (indica cultivar-group) orth AC074054.1b $P chr 10 99%










>AC074054.1b $P CYP76P5 chromosome 10 clone OSJNBa0090A14 gene 2 41% to 76F2

42% to 76C4

same sequence as AC074355 33336 34721-32944 gene 3








      (16 aa deletion and frameshift missing the K-helix)






>aaaa01007399.1 CYP76P6 (indica cultivar-group) orth AC105746.1 $F chr 10 >99%









8548 LDMAE 8562


>AC105746.1 $F CYP76P6 chromosome 10 clone OSJNBb0086I08, Length = 123484

55% to AC074105.1 chr 10 40% to 76C2


















>aaaa01002827.1 $FI CYP76Q1 (indica cultivar-group) one frameshift




12355 RRVALDMALSLI (fs) 12320








aaaa01002827.1 no ortholog in nr or HTGS on 9/5/02



>aaaa01011593.1 CYP76Q2 (indica cultivar-group) orth AP003522.1 $F chr 6 100%






>AP003522.1 $F CYP76Q2 chromosome 6 clone P0036B02, 37% to 76C2

AP004726.1 chromosome 6 clone P0486G02

AU096446.1 Rice green shoot cDNA clone S13713.Length = 477 49% to 76C2













>aaaa01063083.1 CYP76Q2 (indica cultivar-group) orth AP003522.1 $F chr 6 96%

see aaaa01011593.1 for ortholog





>aaaa01021406.1 CYP77A9 (indica cultivar-group) ortholog of AL731641.1 AU070007

(1 diff) runs off end 53% to 77A4

AAAA01011465.1 (indica cultivar-group) Cterm of CYP77A






aa 294-338 missing




8368 AMVTPRKLSF* 8336


>AL731641.1 $F CYP77A9 chromosome 4 clone OSJNBa0042I15 = AU070007

C19435 same clone as C99199 60% with 77A4 297-428 region

C-term of wheat  = NQPLLATVKPRKISL* from BE518078.1 this seq not found yet in rice

C-term of barley = NQPLLATVKPRKISL* from BG416410.1 this seq not found yet in rice












>aaaa01003438.1 $FI CYP77B2 (indica cultivar-group) ortholog to AP003723.1 100% Cterminal part

AAAA01022256.1 (indica cultivar-group) 100% Nterminal part







2543 ADVEAMPYLQ 2572





>AP003723.1 $F CYP77B2 chromosome 6 clone P0003H08 60% to CYP77B1

AU068699.1 Rice callus cDNA clone C50079_1A.Length = 330 64% to 77B1

AA753883, D41585 AA753996 64% to 77B1 11/94 268-350 region













>aaaa01092197.1 CYP77B2 (indica cultivar-group) orth AP003723.1 $F chr 6 100%

see aaaa01003438.1 for ortholog





>aaaa01014577.1 CYP78A11 (indica cultivar-group) orth AC083943.6 $F 100%






>AC083943.6 $F CYP78A11 clone OSJNBa0044A10, 61% to 78A7

orth of aaaa01014577.1













>aaaa01004390.1 $PI CYP78B4 (indica cultivar-group) Nterm missing and one frameshift

abrupt break in seq compared to 78B5, possible pseudogene, no ortholog





13224 TESDMVAVLW (0?)



      SWARLAVRDAHVGGHA frameshift




aaaa01004390.1 no ortholog found in japonica 9/6/02



>aaaa01003568.1 $FI CYP78B5 (indica cultivar-group) orth of AP005175.1












>AP005175.1 $F CYP78B5 (japonica cultivar-group) chr 7













>aaaa01022265.1 CYP78B6 (indica cultivar-group) orth AC097276.6 chr 3 99%

see aaaa01023161.1 for ortholog







>aaaa01023161.1 CYP78B6 (indica cultivar-group) ortholog of AC097276.6

AAAA01022265.1 (indica cultivar-group Cterminal missing 5 aa












>AC097276.6 CYP78B6 chr 3 clone OJ1519_A12 38% to AC073867 57% to 78A2

C-terminal from version 1 of accession (absent in version 6)

Gap not filled in any section of GenBank

Ortholog of aaaa01023161.1 98% (6 diffs) lower case



45207 RPVNEA (32 aa gap in seq aaelmfhramgfaphggywrrlrrlasahala)  PG 45386










>aaaa01000394.1 CYP78C5 (indica cultivar-group) >99% to AP004704.1a






14014 DEHRARLSLAVDA 14052 small 16aa seq gap







>AP004704.1a $F CYP78C5 chromosome 8 clone P0544G09, Length = 137478

New 61% to 78A9













>aaaa01017257.1 CYP78C6 (indica cultivar-group) small seq gap of about 3 aa

might be a frameshifted region before that just after VIARQMV (partialI)

connot complete in indica or japonica seq.













No japonica ortholog found 9/11/02



>aaaa01008990.1 CYP78C7 (indica cultivar-group) orth AC099399.1 $F chr 3 100%










>AC099399.1 $F CYP78C7 chromosome 3 clone OJ1006_F06, Length = 122577

56% to 78A9













>aaaa01012488.1 $FI CYP78D1 (indica cultivar-group) 47% to CYP78A5 orth AA751892












>AA751892 CYP78D1 (partial)  52% to 78A5     1/98 469-519 REGION

Ortholog to aaaa01012488.1 complete 3 diffs no nr or HTGS match on 9/10/02




>aaaa01016663.1 CYP79A7 (indica cultivar-group) orth AC091302.4 AC084319.5b

chr 3 99%






>AC091302.4 CYP79A7 chr 3 = AC084319.5b 50% to 79B3












>AC084319.5b $F CYP79A7 chr 3 one diff with indica seq aaaa01016663.1 = AC091302.4

start met not identified at least 5 to pick from













>aaaa01007189.1 $FI CYP79A9 (indica cultivar-group) ortholog of AL662990.1













>AL662990.1 CYP79A9 chr 4 clone OSJNBb0015C06, 58% to 79A2 67% to CYP79 sorghum

C98773  146-257 REGION C-HELIX AND ON 46% to 79B2 opp end = C98774 (probably 3

prime untranslated) = AA752332.1 cannot complete from GenBank use the indica seq.

Ortholog to aaaa01007189.1 98% shown in lower case to fill missing seq.


4128 msiamailllvalfyrikkqaaamaakrkqqpklppglatmpvvrnmhqmlmnkpvfrwihr 3943

3942 lldemdteilclrfgrvhviavaspemarellrkkdamlasrh 3814

3814 ssfasrtfsfgykn











>aaaa01014830.1 $FI CYP79A10 similar to AL662990.1 a CYP79







3760 PLLSLDEVKAETL 3722 (0?)






no japonica ortholog found 9/11/02



>aaaa01008340.1 CYP79A11 (indica cultivar-group) 81-84% to aaaa01007189 (partialI)





sequence gap here









missing region resembles this








no japonica ortholog on 9/7/02



>aaaa01013363.1 $FI CYP81A5 (indica cultivar-group) ortholog of AC084282a 100%






4627 NMITALCS (0) 4650






>AC084282a $F CYP81A5 46% to 81D5 CDS join(53081..54004,55290..55904)

AQ160774 nbxb0005P20f 58% identical to AU032242 47% to AA754300

AQ288789 perf to end 59% to 81D2 78% identical to C97610













>aaaa01002164.1a $FI CYP81A6 (indica cultivar-group) ortholog of AC084282b $F 100%






2087 NMITALTA 2110






>AC084282b $F CYP81A6 46% to 81D5 N-term extension or too long

CDS join(57467..57739,58238..58330,59557..59693,60071..61148,


C97610 61% to 81D2 C-terminal 78% identical to AQ288789

C97611.1 Rice callus Oryza sativa cDNA clone C60478_8A.Length = 661 57% to 81D4





Upper part may be error (fusion to another gene?)












>aaaa01002164.1b $FI CYP81A7 (indica cultivar-group) ortholog of AC084282.1c $F 100%












>AC084282c $F CYP81A7 41% to 81H1 CDS join(65367..66332,67175..67792)













>aaaa01002164.1c $FI CYP81A8 (indica cultivar-group) ortholog of AC084282.1d $F 99%












>AC084282d $F CYP81A8 40% to 81H1 join(70282..71220,71398..72015)

EST D46694, D46695 from this gene












Note AC084282 continues this cluster on AC084282a



>aaaa01027888.1 CYP81L2 (indica cultivar-group) orth AP005285.1a gene 1 $F 100%




>AP005285.1a gene 1 $F CYP81L2 43% to 81D2 (one frameshift)














>aaaa01048292.1 CYP81L2 (indica cultivar-group) ortholog to AP005285.1a gene 1

clone is only 1060 bp long missing N and Cterminals

see aaaa01027888.1 for ortholog











>aaaa01050076.1 CYP81L2 (indica cultivar-group) orth AP005285.1a gene 1 $F 96% 2 diffs see aaaa01027888.1 for ortholog




>aaaa01004834.1a CYP81L3 (indica cultivar-group) ortholog of AP005285.1b gene 2


     Missing 48 amino acids shown from ortholog













>AP005285.1b gene 2 CYP81L3 (partial)   sequence gap with C-helix (about 47 amino acids) 81D like



sequence gap with C-helix (about 47 amino acids) lower case sequence shown

from ortholog aaaa01004834.1a







106997 PDSCPDQLIRSLCI (0) 106956







>aaaa01089015.1 CYP81L3 (indica cultivar-group) orth? AP005285.1b gene 2 97%

2 diffs/59 aa see aaaa01004834.1a for ortholog





>aaaa01004834.1b $FI CYP81L4 (indica cultivar-group) ortholog of AP005285.1c gene 3












>AP005285.1c $F CYP81L4 gene 3 one frameshift 43% to 81H1 very similar to BI806420.1 15 diffs














>aaaa01004834.1c CYP81L5P = END OF 81L6 (indica cultivar-group) ortholog of AP005285.1d BI806420.1






>AP005285.1d CYP81L5P BI806420.1 (partial) clone S063A11. 57% to AL606630.1 54% to 81D2 many frameshifts ortholog of aaaa01004834.1c = AP005285.1d at 115000 region

This is between gene 3 and gene 4 on AP005285.1 (missed earlier)

There is no N-terminal (gene 4 might be the N-term but it is opposite orientation and 27000 bp away. It might have been split by a rearrangement)

The seq below is 100% identical to aaaa01004834.1c ortholog

Even the pseudogenes are highly conserved







>aaaa01003554.1 CYP81L6 = 81L5 (indica cultivar-group) ortholog to AP005285.1e gene 4







missing Cterminal


>AP005285.1e gene 4 CYP81L6 (partial)   one frameshift, runs off end of clone missing last two exons

38% to 81H1 same as gene a on AP004022.1

AP004022.1a comp(2300-3335) chromosome 2 clone OJ1126_B06, 52% to 705A21

1-321 runs off beginning of contig about 1639 cannot extend 10/11/01








143191 QDPEECPDQLISSLCI (0) 143238 end of clone

AP005285.2 OLD 81L5P







>aaaa01027323.1 CYP81M1 (indica cultivar-group) orth AL606630.1 $F chromosome 4 100%




>AL606630.1 $F CYP81M1 chromosome 4 clone OSJNBb0046P18 45% to 81D3













>aaaa01017554.1 $FI CYP81N1 (indica cultivar-group) added 8 aa to Nterm

orth of AL772426.1a












>AL772426.1a = CYP81N1 ortholog of AAAA01017554.1 $FI 99%












note there are 2426.1b and 2426.1c that are different from this



>aaaa01010047.1a CYP81N2 (indica cultivar-group) join with c and d




5123 VKTVVSDCF* 5094


>aaaa01010047.1d CYP81N2 (indica cultivar-group) (plus strand)

join with a and c






>aaaa01010047.1c CYP81N2 (indica cultivar-group) ortholog of BE039828

join with a and d (minus strand)






these fragments are all pointing in opposite directions and they may be out of order.  One way to assemble an intact gene is to add 1d to 1c to 1a


This gives:

>aaaa01010047.1dca hybrid CYP81N2 (indica cultivar-group) ortholog of AL772426.1b BE039828 46% to 81D3












5123 VKTVVSDCF* 5094


>AL772426.1b $F CYP81N2 = ortholog of aaaa01010047.1dca hybrid 99%

BE039828 (partial) similar to Jerusalem artichoke CYP81B1











note aaaa010047.1b = aaaa01002713.1 #98



>aaaa01002187.1 CYP81N3P (indica cultivar-group) 2 diffs with AL772426.1



>AL772426.1 CYP81N3P P450 fragment





>aaaa01002713.1 $FI CYP81P1 (indica cultivar-group) runs off end of clone

aaaa01010047.1b (indica cultivar-group) ortholog to AL772426.1c AF140486

new 81 subfamily












>AL772426.1c = CYP81P1 ortholog of AAAA01002713.1 and aaaa01010047.1b 99% to these two

AF140486 mRNA 57% to C97610 57% to CYP81G1 56% to 81D2 = AU173235 clone R1815













>aaaa01003110.1 $FI CYP84A5 (indica cultivar-group) ortholog of AC073867.4b $F 99%










21062 PSELDMSDIF 21091


>AC073867.4b $F CYP84A5 chromosome 10 clone OSJNBa0055O03, 1 ordered pieces 63% to CYP84A

BE230538.1 99AS755 Rice Seedling cDNA clone 99AS755.Length = 501







67320 RLTRDNIKAIIM 67285







>aaaa01004359.1 CYP84A6 (indica cultivar-group) ortholog of AC121490.1 AQ577123

deletion of Ihelix to heme






     gap in seq.




>AC121490.1 $F CYP84A6 (japonica cultivar-group) chromosome 3 clone

AQ577123 nbxb0090O10r 57% to CYP84 C-term













>aaaa01015479.1 $FI CYP84A7 (indica cultivar-group) ortholog of AQ160861






5382 KGLIMARN (0)





6091 SCPLL* 6108


>AQ160861 CYP84A7 (partial) N-terminal to C-helix 59% to 84A1 cannot extend

ortholog of aaaa01015479.1 $FI 94%







>aaaa01007228.1 $PI CYP84A8P (indica cultivar-group) orth of AL606587.1 100%



3938 MVFAPYGP 3961





>AL606587.1 $P CYP84A8P chromosome 4 clone OSJNBa0011L07,

probable pseudogene of AC073867 68246-61993





28681 ITLR 28670 missing internal sequence from aa 191-467




>aaaa01005294.1 CYP85A1 (indica cultivar-group) orth of AC092778.2 $F chr 3 CYP85A like












>AC092778.2 $F CYP85A1 chromosome 3 clone OSJNBa0015G17, 59% to 85A2

AQ271015 nbxb0015G17f 173-222 56% to tomato CYP85

AQ159479 nbxb0014E19f 75% identical to N-term of 85 49-71

AQ795731.1 nbxb0057K13r Rice BAC Length = 728 76% to tomato CYP85

C97147 38% identical to C73729 71% to 85 324-401 region

AU100843.1 Rice callus cDNA clone C52418.Length = 710

BAC45000.1 whole protein seq.




107126 VVDIQAKTKE (0)


108110 NLPGTNYYQGFK (0) 108145 contig ends 108418 rest of gene missing










>aaaa01006154.1 CYP86A9 (indica cultivar-group) orth of AP003442.1 $F chr 1 86A like






>AP003442.1 $F CYP86A9 chromosome 1 clone B1096A10 72% to 86A1

AQ954084.1 nbeb0054A03r CUGI Rice BAC genomicLength = 403 57% to 86A1

D41651  71% to 86A1 almost identical to AP003442













>aaaa01008150.1 CYP86A10 (indica cultivar-group) orth of AP004139.1 $F chr 2,






>AP004139.1 $F CYP86A10 chromosome 2 clone OJ1486_E07 70% to 86A2













>aaaa01000236.1 CYP86A11 (indica cultivar-group) orth of AL606687.1 $F chr 4 100%





35129 ARSVQHVDRW 35158





>AL606687.1 $F CYP86A11 chromosome 4 clone OSJNBa0084K11 similar to AP004139

orth aaaa01000236.1

C91843        72% IDENTICAL TO 86A4    4/98 47 TO 128 REGION

AU093465.1 Rice panicle cDNA clone E31913.Length = 609

BE228888.1 98AS3245 Immature Seed cDNA clone 98AS3245. Length = 483 76% to 86A2













>aaaa01004523.1 CYP86A12P (indica cultivar-group) orth AL606448.1 $P two short pseudogene fragments 1 diff



>AL606448.1 $P CYP86A12P two short pseudogene fragments = D15209 6 diffs with AL606687.1

D15209  69% IDENTICAL TO 86A1 Arabidopsis T04172 EST  5/93  7/98 113-131 REGION

very similar to C91843 identical to AL606448.1




>AP003767.1 $P CYP86A12P two short pseudogene fragments only 4 diffs with AL606448.1





>aaaa01028711 CYP86A12P (indica cultivar-group) orth AL606448.1 $P

two short pseudogene fragments = D15209 see aaaa01004523.1 for ortholog





>aaaa01005521.1 CYP86A13P (indica cultivar-group) orth AP003230.1 $P pseudogene fragment 100%



>AP003230.1 $P CYP86A13P pseudogene fragment at C-helix 2 diffs with AP004139.1




>aaaa01018882.1 CYP86A14P (indica cultivar-group) 91% to AP004139.1 $F



No japonica ortholog found 9/11/02



>aaaa01012078.1 CYP86A15P (indica cultivar-group) 91% AP004139.1 $F

identical to AP005298.1 and AP005389.1



>AP005389.1 CYP86A15P (japonica cultivar-group) chr 8 C-helix region



>AP005298.1 CYP86A15P (japonica cultivar-group) chr 8




>aaaa01098941.1 CYP86A16P (indica cultivar-group)

61% to AP004139.1, 59% to 86As





no japonica ortholog found 9/12/02



>aaaa01024304.1 CYP86A17P (indica cultivar-group) ortholog of AP003242.1 1 diff



>AP003242.1 $P CYP86A17P 38% to perf region of AP004139.1

pseudogene fragment




>aaaa01000147.1 CYP86B3 (indica cultivar-group) orth of AC087182.8 $F chr 10 100%







16504 LTKR 16493


>AC087182.8 $F CYP86B3 chromosome 10 clone OSJNBa0029C15, 66% to 86B1

orth of aaaa01000147.1

D47545, D41610, D47561, D49287, AU032597 AU067853 77% identical to 86B1

AU067852 N-terminal region

AU096913.1 Rice green shoot Oryza sativa cDNA clone S16487

AU032659 66% identical to contig of D47545 63% to 86B1 same clone = D47454










57328 LTKRDKSKL* 57357



>aaaa01002439.1 CYP86E1 (indica cultivar-group) orth AP004092.1 $F chromosome 2










>AP004092.1 $F CYP86E1 chromosome 2 clone OJ1568_B05, similar to 86C3

C99701 43% identical to D39760 60% to 86B1 same clone as C73927













>aaaa01000478.1b CYP87A4 (indica cultivar-group) ortholog of AL607001.1 gene 1











>AL607001.1a $F CYP87A4 chromosome 4 clone OSJNBA0088I22, gene 1 92976-97891

48% to AC083944.6 57% to 87A2





93558 PAVELKEAVST 93590 (0)










#291 combine with #293, #363 reduce gene count by 2

>aaaa01011592.1a CYP87A5 (indica cultivar-group) 85% to AL607001.1c chr 4, gene 3

4th line =






no japonica ortholog found 9/10/02


#293 combine with #292, #363 reduce gene count by 2

>aaaa01011592.1b CYP87A5 (indica cultivar-group) 82% to AL607001.1c chr 4, gene 3

first two lines identical to AAAA01011592.1a

4th line = aaaa01016295.1






no japonica ortholog found 9/10/02


#363 combine with #292, #293 reduce gene count by 2

>aaaa01016295.1 CYP87A5 (indica cultivar-group) 81% to AL607001.1c chr 4,

gene 3 3rd line = aaaa01011592.1a











>aaaa01016295.1 CYP87A5 (indica cultivar-group) 81% to AL607001.1c chr 4,

gene 3 3rd line = aaaa01011592.1a










No japonica ortholog found 9/11/02


Combined parts from #291, #292, #293, #363 CYP87A5 81% to AL607001.1c















>aaaa01002235.1 CYP87A6 (indica cultivar-group) orth to AL607001.1c gene 3 chr 4


6444 RIK













>AL607001.1c $F CYP87A6 chromosome 4 clone OSJNBA0088I22, gene 3 136970-140694 61% to 87A2






137821 LISFPLNIPGTAYHECME 137874 (0)









AUTHORS   Chaban,C.

  TITLE     Phytochrome response in rice coleoptile - just a matter of auxin?

  JOURNAL   Thesis (2002) Department of Botany, University of Freiburg,