>AB025047 CYP51 rice 80% to 51A2 missing Nterm 64 aa
REEYARLGSVFTVPILSRKITFLIGPEVSAHFFKGNEAEMSQQE
VYKFNVPTFGPGVVFDVDYSVRQEQFRFFTEALRANKLRSYVDQMVVEAEEYFSKWGE
SGTVDLKYELEHLIILTASRCLLGREVREKLFDDVSSLFHDLDNGMQPVSVIFPYLPI
PAHRRRDRARQRLKEIFATIIKSRKASGRAEEDMLQCFIDSKYKSGRSTTEGEITGLL
IAALFAGQHTSSITSTWTGAYMLRFKQYFAAAEEEQKEVMKRHGDKIDHDILAEMDVL
YRCIKEALRLHPPLIMLLRQSHNDFSVTTKDGKEFDIPKGHIVATSPAFANRLPHIFK
NPDSYDPDPYAPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEF
ELVSPFPETNWKAMVVGIKDEVMVNFKRRKLVVDN

>AAAA01012243.1 Indica rice genome CYP51 $F New April 24, 2002
5108 MTLADPNHRLIAGAALLVATLAFIKLLLSSAGGGKKRLPPTIPAAPLVGGLLRFMRGPIPM 4926
4925 IREEYARLGSVFTVPILSRKITFLIGPEVSAHFFKGNEAEMSQQEVYKFNVPTFGPGVVF 4746
4745 DVDYSVRQEQFRFFTEALRANKLRSYVDQMVVEAE 4641
2774 EYFSKWGESGTVDLKYELEHLIILTASRCLLGREVREKLFDDVSALFHDLDNGMQPVSV 2598
2597 IFPYLPIPAHRRRDRARQRLKEIFATIIKSRKASGQAEEDMLQCFIDSKYKSGRSTTEGE 2418
2417 ITGLLIAALFAGQHTSSITSTWTGAYMLRFKQYFAAAEEEQKEVMKRHGDKIDHDILAEMDVLYR 2223
2222 CIKEALRLHPPLIMLLRQSHNDFSVTTKDGKEFDIPKGHIVATSPAFANRLPHIFKNPDS 2043
2042 YDPDRYAPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPF 1863
1862 PETNWKAMVVGIKDEVMVNFKRRKLVVDN* 1773

>AP005448.1a (japonica cultivar-group) chromosome 7 21 June 2002
29768 TISDTMWLTTVALLLTTVVIWTALQKRKRGEACPAAVAPPPIVQGTALVRFLRAMARDG 29944
29945 PLEVIREQLAKLGSVFMASAPLGLFKVTFLVGAEL 30049

>AP005448.1b $F (japonica cultivar-group) chromosome 7 21 June 2002
32724 MDHVTSSTIARGAMSWVAATVALLLTTAVILTALQKRKISSPAAAAPPVVRGAGLVRFA 32900
32901 RAMARDGPLEAIREQQAKLGSVFTAIAPFGLFKVTFLIGPEVSSHFYLAPESEMGQGSIY 33080
33081 RFTVPLFGPEVGYAVDPDTRAEQMRLFWDVLKPRSIEARVGAMAEEVQ 33224
35381 NYFSRWGEQGTVDLKKELEQVLMLIASRCLLGREVRESMVDEVYELFRDLDNGLHLIS 35554
35555 TMLPYLPTPAHRRRDRARQRLGEIFTEVIRSRRNSGTADNGDDVLQRLIDGRYKD 35719
35720 ERDLTDVEVVGLLVALVFAGKHSSSSVSTWTGINLLSHPNHLVAVIAEQDRLMASRARTD 35899
35900 DDHDRVNYDTVQEMTTLHRCIKEALRLHPPAVAMFRQARKHFTVQTKEGKEYTIPGGHTV 36079
36080 MSTILVNHHMPNVYKDPHVFDPSRFARGRGEDKAAGPFSFLAFGAGRHSCAGESFAYTQI 36259
36260 KVIWSHLLRNFELKMVSPFPETSWRMVTPEPKGTVMISYRRRNLTCK* 36403

>AC108875.1a $F chromosome 5 53% to 51A2 same as AQ050946 AQ687182 AQ258479
70310 MELTSSSAMWLAMAILAITAALTKIALGGGRRRCLSESSDLTCKTPPPPPVVNCIALLGL 70489
70490 LPALFRGDVPATMQQLYAKFGSVFTVSVAGLLKATFLVGPEVSAHFFQGLESEVSHGDLF 70669
70670 EFTVPMFGKEVGHGVDNATRIEQGRFFAEALKPVRLRIHVDPMVQEVE 70813 (0?)
71263 DYFAKWGQHGTVDLKHELEQLLLLISGRCLLGKEVMGTKFDEVCNLFRDIEGGVNLMSV 71439
71440 FFPYTPLIPSNRRRDMARERLHAIFSDIVRSRKQQQGDQEEVNDKDVLQSFIDSR 71604 (2?)
71910 YKADGRATTEAEVAGLITGVLFAAKHTSTHTSVWTGARLLTHEKFLAAAVDEQDQIVR 72083
72084 KHGIINGRIVTDHYGFLMEMHMLHICIKETLRLHPPAPMIVRTALRQFTVRTREGHEYCV 72263
72264 PAGHTMASPIVISNRVPYIYKDAHLYDPDRFGPRREEDKVGGKFSYTSFGGGRNSCVGEN 72443
72444 YAYMQIKAIWSHLLRNFELKLLSPFPKTDWSKLVPEPQGKVMVSYKRRQL 72593

>AC108875.1b $F chromosome 5 similar to 51A2
80009 MAIILAITAAVTKIARGGRRRSATDPTCKMPPPPPVVNSIALLRLLPTLFRSGLPA 80176
80177 ILHELYTKFGSVFTINLAGLLKMTFLVGPEVSAHFFQGLESEISHGNLLEFTVPMFGKEI 80356
80357 AHGVDSATRNEQARFFVDALKPARLRIHVDPMVQEVE 80467 (0?)
84741 DYFAKWGQHGTVDLRRELEQLLLLISGRCLLGKEVMGTMFDEVCNLFRDIEGGVNLMSV 84917
84918 FFPYTPLIPSNRRRDMARKRLHAIFSDIVRSRKQREGDNVDKDVLQSLIDSRYKADGRAT 85097
85098 TEA*VAALMICLLFAAKHTSAYTSVWTGARLLSHERFLTAAVDEQDKIAREHSNINGGGR 85277
85278 ITDDRYGSLMEMRTLHSCIKETLRLHPPVPMLVRTAHKQFTVRTREGHEYAVPAGHTIAS 85457
85458 PIVISNQVPYIYKDGHLYDPDRFGPAGREEDKVGGKFSYASFGGGRTGCVGEGYAYMQIK 85637
85638 AIWSHLLRNFELRLLSPLPKSDFTKFVPEPHGELMVSYKRRQL 85766

>AC108875.1c $F chromosome 5 similar to 51A2
122577 MDLVSISIYMWAMAALCTIITAMVTTKLARVRRPITLNPKSKRPLPPVVNVIA 122735
122736 LLEHLPRLCTKGVIPVYKGSVFTVSLFGLKATFLVGPEVSAHFYQGMDSEISQGDLYEFT 122915
122916 VPLFGKGVGFDIDNATRTEHLRFFIDAIKTSKLRNHVNSMVQEVE 123050 (0?)
123296 DYFAKWGENGIVDIKHEFEKLLMLISGHCLLGKEVRDNMFDEVFSLF 123436
123437 HELDSGVGLGSVIFPYIPIPSHIRCDKAHAKLAKIFSKIVRSRRDSNRPAEQDVLQYLID 123616
123617 SKHRDGNSTTEQEVTGWIISMVFAGKHTSTNSTTWTGACLLTHDKFLTEALDEQKHMIQK 123796
123797 HGDHIDYNVLLDMDILHCCIKEALRMHPVAPIIYRKAQKSFVVRTREGDAYDIPEGHNLL 123976
123977 SPMIFNNRLPYIYKDPHMYDPDRFAPKREEDKVGGMFSYTSFGGGRHICIGEAYAYMQIK 124156
124157 VIWSHLLRNFELKLESPFPKTNWSKILLEPWGKVMVSYKRRRL 124285

>AP004090.1 $F chromosome 2 clone OJ1399_H05 49% to 51A2
78158 MAVLFVATKMIQQRPRTLCLYEKENKEEELLLPPVMSVVSVLTAYLPTLIAKGLPAVIHDLH
77972 SRLVTLLVTAHFFQASESEIRQSNIYKVTVPVFGRGVLYDVDLATRSRQISFCTDS 77805
77804 IKPINLRGHVDSMVHEVE 77751 (0)
76666 GYFAQWGEDGVVDIKYEMGNLILLIANRCLLGKQFGESKLEQVSTLLHELFDNGFHLISLF 76484
76483 FPYLPTPQHRRRDKARAMLGEMIHEAVRSRRNSGVAEDDVLQKFLDSKYINGRCMTENEI 76304
76303 AGLLICMMFAAQHTSSSTSTWTGACLLSHGHRSYLAAAIQEQKRIIQQHGDRINWGILLQ 76124
76123 MTTLTHCIKEALRLHPPANLLIRHASKSFSVQTRQGHRYQIPKGHTLATCTTVGNRLPYI 75944
75943 YKDPNVYDPSRFGPGREEDKVGGKFSYTPFSAGRHVCLGEDFAYMQIKVIWSHLLRNFDL 75764
75763 ELISPFPEEEWEKFIPGPKGKVMVTYKRRRLL* 75665

>AP003866.1 $F chromosome 7 clone OJ1092_A07 53% to 51A2
50920 MDMAAAAAVWFSAIAAVLLAASTIAVVVVAKMTGKRNGGAAAAAAAAAEAELPL
51082 PPVVSGVSLIIPVITRGPMAVADELYVKLGSVFT (0)
      GGFYSRPE 51261
51262 SEVHQGGTYRMTVPMFGRGVMYDVDVATRSEQIAVCFEALRPTKLRSSTVTMVRETE 51432 (0)
52114 EYFAKWGEQGTVDLKRELDLLILTIASRVLLGKEVRETMFADVVASFHELMDNSMHLI 52299
52300 SLCFPNLPIPRHRRRDTASARLKELFSRAIQLRRGSGRAEDDVLQRFLESRYRDGRAMSD 52479
52480 NEITGMLIALVVAGQHMSSSASTWTGAFLLRDPKHLAAAVDEQRRLIGDDRVDYDALT 52653
52654 TGMSTLHRCIKEALRMHPPAPALVRTVRRGFAVWTREGKEYRMPAGHSVVSYAAFNHRLG 52833
52834 YVYRDPDEYDPERFGPERKEDRVAGKFSFTAFGGGRHACLGEHYAFLKMKVIWSYLLRNF 53013
53014 ELELVSPFPEVELNNIMLGPRGEVMVRYKRRKLTST* 53124

>AP003866.1 $P chromosome 7 clone OJ1092_A07 Pseudogene
54048 VRFLHRKVTFLVGPEESSHFFTGLDSEISQDEVSRFIIPTFGS*VAFD 54191 
54642 AGYATQ*EQFRFFGDTMKPTKLRSYVSHMVYEVE 54743 (0) 
56119 VVTLIATRCLFGEVRSKMLGEVPTLLRELNDSMRLITIVFPYLPIPAHRRRDSARARL 56292
56293 GEIFVEIVRSRRSSPGGGGAGHDDMLQCLIDARYKDGRATTEG 56421 
56424 AEVAGMLVSALFAGQYTSSSTSTWTGAR 56507 
56510 LLTHPEHLRAAVREQEELVLVRHRHGGDVVDHDALQRMGHLHRCVKETLRLHPPSLMLLRHAR 56698
56699 RSFVVRARGSGDAEYEVPAGHTVASPMVIHNALPHVYEDAGSFDPGRFGPAREEYRAYAA 56878
56879 DHAYTVFGGGRHACVGE 56929 
56932 VIKVIWSHLLRNFELELMLPFPETDWNDVMPGPKGKVMVLPPSHNKIISVIVGFSVQL* 57108

>AY022669.1 Oryza sativa microsatellite MRG4994 containing (CCG)X8, Length = 224
222 PRLPIPAHRRRDRARARLGEIFSDIVRSRRGSSGGGGGGGGARHDDMLQCLIDARYKDGRATTETEVAGMLVAA 1

>aaaa01065204.1 (indica cultivargroup) scaffold065204 exon 3 ortholog of AY022669.1 
GYFARWGQSGTVNMKQEFEQLVTLIASRCLLGEEVRDKMFDEV
STLLRELNDGMRLVTILFPRLPIPAHRRRDRARARLGEIFSDIVRSRRGSSVGGGGGAPH
DDMLQCLIDARYKDGRATTETEVAGMLVAALFAGQHT

>AC087599.11 $P chromosome 10 clone OSJNBa0057L21, pseudogene fragment like 71A1
16812 GGGGRWTETLEWIMAELTANTRVMAKLQDEISRAADGK 16925 
16931 PAPILVPRQSTATAVVQG*EILAKTSLFINVWAMGRYPAAWNSSEEFWPEQFLASREAVD 17110
17111 FQGNNYQLILFITDRRIFPDINFAVPVLETALVGLLHPTNELLGGG 17248
17249 GGLMWLQRSCSRARRPRSTAHRRHRSGTHPAAIAAAAAT* 17368

>BI808626.1 (partial) clone D005B07.Length = 538 EST with numerous frameshifts similar to AAAA01035499.1 and 71Bs 
11 LFVHAWAIGRDPXAWXXPEEFRPDRFLXXSVDFRGNDYQLVPFGAAPRICPGISFXX
PVLEMALFALLHHFDWELPAGMXXXXXDMSEAPGLTTPLRVPLRLVPKRKARLPRHIYKRNVIGE*

>AP004684.1a $F chromosome 6 76% to CONTIG OF C72003 (cterm) 59% to AP003623.1 70% to AU173996.1
10968 MQQQVTEFANAGSDTHAERKQSELTAAEMGHELWVLW
11079 ATLAVSLLCYLYLTSHRLGSRRRRWPPGPRPLPLLGNLLDLRGG 11210
11211 NLHHTLARLARAHGAPVMRLQLGLSPAVVISSPGAAREAFTAHDRRLAARAVPDAN 11378
11379 HALGFCDRSMIWLPSADPMWRTLRGVVAAHAFSPRALAAARAVHERKVRDLVA 11537
11538 YLRGRAGREVDVKDAVYGGVLNLVSSALFSADVVDVGGESAQGFRELVEELIESIAKPN 11714
11715 VSDLFPFLRRFDLQGWRRWTSGHLAKIYKVLDDIIDRRSAEDDAAMDKRGDFLDVL 11882
11883 LELMSTGKIAREYLTNILFDVFTAGSDTMSLTVVWAMAELLRNPGVMAKAR 12035
12036 AEIDAALGGREAVEEADVARMPYVQAVLKEAMRLHPVAPVMLPRKAAEDGVEIGG 12200
12201 FEVPRGCAVIFNTWAIMRDPAAWERPDEFVPERFVGRSRATEEMDFRGKDFGFLPFGSG 12377
12378 RRLCPGVPMAERVLPLIMASLLHAF 12452
12453 EWRLPDGMSAEQLDVSEKFTTANVLAVPLKAVPVVIAC* 12569

>aaaa01000831.1 (indica cultivargroup) ortholog of AP004684.1a (1 diff)
check for Nterm 28aa extension 
12835 MGHELWVLWATLAVSLLCYLYLTSHRLGSRRRRWPPGPRPLPLLGNLLDLRGGNLHHTLARLARA 13029
13030 HGAPVMRLQLGLSPAVVISSPGAAREAFTAHDRRLAARAVPDANHALGFCDRSMIWLPSA 13209
13210 DPMWRTLRGVVAAHAFSPRALAAARAVHERKVRDLVAYLRGRAGREVDVKDAVYGGVLNL 13389
13390 VSSALFSADVVDVGGESAQGFRELVEELIESIAKPNVSDLFPFLRPFDLQGWRRWTSGHL 13569
13570 AKIYKVLDDIIDRRSAEDDAAMDKRGDFLDVLLELMSTGKIAREYLTNILFDVFTAGSDT 13749
13750 MSLTVVWAMAELLRNPGVMAKARAEIDAALGGREAVEEADVARMPYVQAVLKEAMRLHPV 13929
13930 APVMLPRKAAEDGVEIGGFEVPRGCAVIFNTWAIMRDPAAWERPDEFVPERFVGRSRATE 14109
14110 EMDFRGKDFGFLPFGSGRRLCPGVPMAERVLPLIMASLLHAFEWRLPDGMSAEQLDVSEK 14289
14290 FTTANVLAVPLKAVPVVIAC* 14352

>AP004684.1b $F chromosome 6 57% to AP003523.1 78% to AP004688.1  
117908 MDAAVFCCLLALLPLLHYLITLFLHGSRDSDLRLPPGPWRLPLIGSLHHLF 118060
118061 FGALPHRALRDLARRHGPLMLLAFGDAPVVVVASTAGAAREILRTHDDNFSSRPLSAV 118234
118235 VKVCTRRGAGITFAPYGEHWRQVRKICRLELLSPRRILAFRAIREEEAARLVRAIGVASP 118414
118415 PLVTNLSELLGNYVTDTTVHIVMGERFRERDALLRYVDEAVRLAGSLTMADLFPSSRLAR 118594
118595 AMSSTTLRRAEAFVESLMEFMDRVIREHLEKKRSCQGGEREEDLIDVLLRLQAEGSLHFE 118774
118775 LTMGIIRAVIF 118807 (0)
118932 DLFSGGSETATTTLQWAMAELMRNPGVMSRAQAEVREAYKDKMEVTEEGLTNLTYLQCII 119111
119112 KETLRLHTPGPLALPRECQEQCQILGYDIPKGATVLVNVWAICTDNEFWDESEKFMPERF 119291
119292 EGSTIEHKGNNFEFIPFGAGRRICPGMQFGIANIELALANLLFHFDWTLPEGTLHSDLDM 119471
119472 TETMGITARRKEDLYVHAIPFVQLP* 119549

>AP003523.1 $F chromosome 6 clone P0416A11 AQ271656 nbxb0026B09r 53% to 71A16 Nterm
112855 MEQYLFLATLLILSLAFVKLRPRNNGENPPPGPWQLPVIGSLHHLAGALPHRALRDLA 113028
113029 TRHGELMLLRLGELPVVVASSPAAAREVMRTHDAAFATRPQTATLRALTRDGLGVAFAPQ 113208
113209 GEHWRCLRKLCVTELLGARRVRCLRRAREAEAAALVASLSTTTPEPVNVS 113358
113359 SLVARYVTDAVVRAVVGDRISDRDAFLERLEEGVKVAAGFTLADVFPSSRLARALSGTAR 113538
113539 RAEAHSREMTRLMDGVIEEHRQRRAATGWRDEEDEDLLDVLLRIQKDGGLQIPLDMGTIRAIII 113730 (0)
113831 DLFSAGSETTGTTLQWAMAELMRNPAALRKAQAEVRGVLAGHSHVTEDALPDLHYLHL 114004
114005 VIKETLRLHVAVPLLLPRECQEPRLRVLGYDVPERAMVLVNAWAICRDTAVWGPDAEEFR 114184
114185 PERFDGGAVDFKGTDFEFVPFGAGRRMCPGVAFAVAIMELGLASLLFHFDWELAGGTAA 114361
114362 GELDMAEGLGITARRKSDLWLHATVSVPVPNTETS* 114469

>AP003523.1 $F chromosome 6 clone P0416A11 six different genes
118132 MDLMKSNPLQGSPWSL
118084 LNLLVLIIVAAMICGELCRRRRRRRGDENGGATRLPPGPWRLPFVGSLHHLAVMRPRGVV 117905
117904 VHRALAELARRHDAPVMYLRLGELPVVVASSPEAAREVLKTHDAAFATRAMSVTVRESIG 117725
117724 DKVGILFSPYGKKWRQLRGICTLELLSVKRVRSFRPIREEQVARLVDAIAAAAASS 117557
117556 TAEAAAVNISRQITGPMTDLALRAIMGECFRWREEFLETLAEALKKTTGLGVADMFPSSR 117377
117376 LLRAVGSTVRDVKLLNAKLFELVECAIEQHREQIRAAHDNGGDDDDAHGHGDKECFLNTL 117197
117196 MRIQKEGDDLDD 117161  LTMATVKAVIL (0)
       DMFAGGSESTSTTLEWALSELVRNPHVMQKAQAEIRHALQGRTRV 115967
115966 TEDDLINLKYPKNIIKETLRLHPVAPLLVPKECQESCKILGYDVPKGTIMFVNAWAIGRD 115787
115786 PRYWNDAEVFMPERFEKVAVDFRGTNFEFKPFGAGRRMCPGITFANATIEMALTALLYH 115610
115609 FDWHLPPGVTPDGLDMEEEFGMSVSRKRDLYLRPTLHMGLETI* 115478

>AP003523.1 $F chromosome 6 clone P0416A11 six different genes
128476 MAAELVHLLRYLFSVPM
128425 LFFIVPLLFLVCSPRRRRGRGSCRLPPSPWALPVVGHLHHLAGALQHRAMRDIARRHGPL 128246
128245 VLLRLGRLPVVVASSADAAREVMRTSDVAFAARPVNRMIRVVFPEGSEGVIFAPYGETWR 128066
128065 QLRKICTAELLSARRVHSFRSVREEEAGRMLRAVASAAAQTTVNLSELMSA 127913
127912 YAADSSARAMIGRRLKDRDTFLAMVERGIKLFGEQSLPNLYPSSRLAVLLSTMPRRMKRH 127733
127732 RERMTAYLDAIIEEHQESRASREDDEDLLDVLLRM 127628 
       QREGDLEVSRESIRSTIG 
126439 DMFIGGSEPPAITLQWIMAELIRNPEVMQKVQDEVRQLLVGQHRVTEESLSKLGY 126275
126274 MNLVIKETLRLHPPGPRLLLRVCRTTCQVLGFDVPKGTMVLVNMWAINRDPKYWSQAEEF 126095
126094 IPERFENAGINFKGTNFEYMPFGAGRRMCPGMAFGLATLELALASLLYHFDWKLPDGV 125921
125920 EIDMKEQSGVTTRRVHDLMLVPIIRVPLPV* 125828

>AP003523.1 $F chromosome 6 clone P0416A11 six different genes
138301 MAEVVQLHHLILLLPLFILPFLLLRSSRRRRGACGRLPPSPWALPVIGHLHHLAGALPHRAMRDIA 138152
138151 RRHGPLVLLRLGELPVVVASSADAARDVMKTHDLAFATRPITRMMRLVFPEGSEGIIFSP 137972
137971 YGETWRQLRKICTVELLSARRVNSFRSVREEEVNRLLRAVAAAAASATSPAKTVNL 137804
137803 SELMSAYAADSSVRAMIGRRCKDRDKFLAMLERGIKLFVTPSLPDLYPSSRLAMVVSRMP 137624
137623 RRMRRHREEVFAFLDAIIAEHQENRASGEDEEDLLDVLLRIQREGCME 137480 
       SPLLSTESIRTTIG 
136562 DLFNGGSETTATTLQWIMAKLMRNPRVMQKAQDEVQRVFIGQHKVTEENLSNLSYMYL 136389
136388 VIKEALRLHPPRPPLLPRECRTTCQVLGFDVPKGTIVLVNMWAINRDPKYWDQSEEFILE 136209
136208 RFEHVDINFKGMNFEYMPFGAGRRMCPGMAFGLVNLELVLASLLYHFDWKL 136056
136039 GDLDMTQERGATTRRLHDLLLVPVIRVPLPLDSRS* 135942

>AP003523.1 $F chromosome 6 clone P0416A11 six different genes AQ331067 AQ364007.2
151229 MAGFPVYLLFLAALIILPMANLIRSARHRRLAGARRPPPGPWALPVIGHLHHLLAGKLPH 151408
151409 HHKLRDLAARHGPLMLLRFGELPVVVASSADAAREIAKAHDLAFATRPVTRTARLTLPEG 151588
151589 GEGVIFAPYGDGWRQLRKICTLELLSARRVLSFRAVREQEVRCLLLAVASPSPEGTTAT 151765
151766 ASVVNLSRMISSCVADSSVRAIIGSGRFKDRETFLRLMERGIKLFSCPSLPDLFPSSR 151939
151940 LAMLVSRVPGRMRRQRKEMMEFMETIIEEHQAARQASMELEKEDLVDVLLRVQRDGSLQF 152119
152120 SLTTDNIKAAIA 152155 (0)
166133 DLFIGGSETAATTLQWAMSELLNNPKVMQKAQDEIRQVLYGQERITEETISSLHYLHL 166306
166307 VIKETLRLHPPTPLLLPRECREPCQILGFDVSKGAMVLINAWSIGRDPSNWHAPEKFMPE 166486
166487 RFEQNNIDFKETSFEYIPFGAGRRICPGMTFRLANIELLLASLLYHFDWELPYGMQAGD 166663
166664 LDMTETLAVTARRKADLLVVPVVRVPIVG* 166753

>AP003523.1 $F chromosome 6 clone P0416A11 six different genes
168538 MAAAASSVLAYLLVVALLAIVPLVYFGWVARRRGEGGRLPPSPWGLPVIGHLHHLAGALPHHAMRDLA 168741
168742 RRHGPLMLLRLGELPVVVASSAEAAREVMRTRDIEFATRPMSRMTRLVFPAGTEGIIFAP 168921
168922 YGDEWRELRKVCTVELLSARRVQSFRAVREEEVGRLLRAVAATSSSPSPAQAAVNL 169089
169090 SALLSAYAADSAVHAIIGSRFKDRDKYLMLLERGLKLFARHTLPDLYPSSRLAMWLSRMP 169269
169270 RRMMQHRREAYAFTDAIIREHQENRAAGAGDGDGDDKEDLLDVLLRIQREGDLQFPLSTE 169449 
169450 RIKTTVG 169470 (0)
169893 DMFAGGSETAGTALQWIMAELIRNPRVMHKVQDEVRQTLAGRDRVTEDAISNLNYMHL 170066
170067 VIKEALRLHPPVPLLLPRECRNTCQVLGFDVPKGAMVLVNAWAISRDPQYWDEPEEFIPE 170246
170247 RFEDSNIDFKGTNFEYTPFGAGRRMCPGIAFGLANVELMLASLLYHFNWQLPDGMDTAD 170423
170424 LDMTEEMVVSARRLHDLLLVPVVHVPLPVASS* 170522

>AL606658.1 $P chromosome 4 clone OSJNBb0016D16 pseudogene fragment 72% to AP003523 
120987 SALNVSWQITGTLTDLTLHAIMGECGFRWHEEFLETLGEAQKKATRFGVADLFPSSRLLPAVGSRSGD 120784

>AP003571.1 $F chromosome 6 clone P0458E02 continuation of contig AP003523.1 AQ258331
145371 MAAFLVYVLVLVPLAVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGALPH 145201
145200 VAMRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPEG 145024
145023 GEGIIFAPYGDRWRELRKICTVELLSGRRVQSFRPVREEEAGRLLRAVAAASPG 144862
144861 QAVNLSELLSAHAADSSVRAIMGDRFRDRDAFLAMLERGLKLFAKPALPDLYPSSRLAM 144685
144684 LLSRMPRRMKQHHRDMVAFLDAIIQEHQENRSAAADDDNDLLDVLLRIQREGDLQFPLS 144508
144507 SESIKATIG 144481 (0)
144297 DMLVGGSETAATTLHWIMAELVRNPKVMQKAQDEVRRELIGHRKVTEDTLCRLNYMHM 144124
144123 VIKEALRLHPPGSLLLPRECRRTCQVLGYDIPKGATVFVNVSAIGRDPKYWDEAEEFIPE 143944
143943 RFEHSDVDFKGTHFEYTPFGAGRRMCPGMAFGLANVELTLASLLYHFNWELPSGIHAENL 143764
143763 DMTEEMRFTTRRLHDLVLIPVVHVPLPTI* 143674

>AP003571.1 $F chromosome 6 clone P0458E02 
128926 MADDYFYLGLALASLLVVLFARRRRSAAHGDGGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLA 129120
129121 RRHGPVMMLRLGEVPTLVVSSRDAAREVMRAHDAAFASRPLSATVRVLTSGGRGIIFAP 129297
129298 YGGSWRQLRKIAVTELLTARRVASFRAIREEEVAAMLRAVAAAAAAGRAVELRAA 129462
129463 LSALVAETTVRAVIGDRCKDRDVFLRKLQRTIELSAGFNPADLWPSSRLAGRLGGA 129630
129631 VREAEECHDTVYGILDGIIQEHMERTSSGSCGAGDGDGDGEDLLDVLLRIQKEGGLEFPV 129810
129811 DMLAIKQVIF 129837 (0)
132964 DIFGAGSETSATTLEWVMAELIRNPKAMRKATAEVRRAFAADGVVLESALGKLHYMHLVI 133143
133144 RETFRLHTPLPLLLPRECREPCRVLGYDVPRGTQVLVNVWAIGRDERYWPGGSPEEFRPE 133323
133324 RFEDGEAAAAVDFRGADFELLPFGAGRRMCPGLAFGLANVELALASLLFHFDWEAPDVAD 133503
133504 PAEFDMTEGFGITARRKADLPLRPTLRVPVLVSVG* 133611

>AP003571.1 $P chromosome 6 clone P0458E02 pseudogene fragment
136961 VSEDALGELRYLQLVIRETLRLHPPLPLLLPRECTIGR 137074
137075 DERYWPGGSPEEFRPERFDDGEATAAVDFRGADFELLPFGGGRRMCPGMAFGLANVELPL 137254
137255 SSLLFHFDWEVPGMADPTKLDMTEAFGITSRRKENLHLRPLLRVSVPG 137398

>AP003571.1 $F chromosome 6 clone P0458E02
139036 MEDATHGYVYVGLALVSLFVVLLARRRRSPPPAAHGDGGLRLPPGPWTLPIIGSLHHLVGQIP 139224
139225 HRAMRDLARRHGPVMLLRIGEVPTLVVSSRDAAREVTKTHDTAFAMRPLSATLRVLTN 139398
139399 GGRDLVFAPYGDYWRQVRKIAVTELLTARRVHSFRSIREEEVAALLRAVAVA 139554
139555 AGTVEMRAALSALVSDITARTVFDNRCKDRGEF
       LVLLERTIEFAGGFNPADLWPS 139719 
140222 SRLAGRLSSVVRRAEECRNSVYKILDGIIQEHQERTSAGGEDLVDVLLRIQKEGG 140386
140387 LQFPLAMDDIKSIIF 140428 (0)
       DIFSAGSETSATTLAWAMAELIRNPTAMHKVMAEVRRAFAAAGAVSEDALGE 140655
140656 LRYLQLVIRETLRLHPPLPLLLPRECREPCRVLGYDVTRGTQVLVNAWAIGLDERYWPGG 140835
140836 SPEEFRPERFEDGEATAAVDFRGTDFEFLPFGAGRRMCPGMAFGLANVELPLASLLFHFD 141015
141016 WEVPGLADPAKLDMTEAFGITARRKADLHLRPCLLVSVPGV* 141141

>AP003571.1 $F chromosome 6 clone P0458E02 56% to 71B3
106935 MADLHTYLYLGLALVSLLAVQLARRRRSSAAHGSGALRLPPGPWQLPVIGSLHHLVGKL 107111
107112 PHQAMRDLARRHGPVMMLRLGEVPTLVVSSPEAAREVTKTHDVSFATRPLSSTTRVFS 107285
107286 NGGRDIVFAPYGDYWRQLRKITVTELLSARRVASFRAIREEEVAAMLRAVGGYAA 107450
107451 AGCAVEIRPLLAALVSDSTVRAVMGDRFPHRDVFLRELDRSIELTAGFNPADLWPSSRL 107627
107628 AGCLTGTIRQAKKCWDTMSSVLESTIQEHLQKNGSSGGGAGATDEDLIDVLLRIQKEGGL 107807
107808 QFPFDMDVIKSVIH 107846 (0)
110756 NVFGAGSETSATTLGWAIAELIRNPMAMKKATAEVRQAFAAAGVVSEAALSELRYLHLVI 110935
110936 KETLRLHPPGPLLLPRECREQCKVLGYDVPRGTQVLVNVWAIGRDPRYWPGGSPEEFRPE 111115
111116 RFGDGEPAAALDFKGTDYELLPFGAGRRMCPGLAFGLANVELPLASLLFHFDWEVPGMAD 111295
111296 PTKLDMTEAFGIGVRRKADLIIRPILRVPVPGV* 111397

>AP003571.1 $F chromosome 6 clone P0458E02
118418 MADGYFYLGLALVSLLVVLFARRRRSAAAAHGDAGLRLPPGPWQLPVIGSLHHLAGKLPHRAMRDLA 118618
118619 RRHGPVMMLRLGEVPTLVVSSRDAAREVMRTHDAAFASRPLSASVRAATKGGRDIAFAP 118795
118796 YGDYWRQLRKIAVTELLSARRVLSFRPIREEEVAATLRAVAAAAADGRTVELRAA 118960
118961 LCALVADSTVRAVVGERCAGLDVFLRQLDRAIELAAGLNVADLWPSSRLAGRLSGAVRQ 119137
119138 AERCRDTMFGVLDGIIQAHLEKTGGAGEDILDVLLRIHKEGGLEFPLDMDA 119290
119291 VKCVVV 119308 (0)
119451 DVISGGCETSATTLGWAFAELIRNPAAMKKATAEVRRDFEAAGAVSESALAVGELPYLRL 119630
119631 VVRETLRLHPPLPLLLPRECREPCRVLGYDVPRGAQVLVNAWAIGRDERYWPGGSPEEFR 119810
119811 PERFGDGEAAAAVDFKGADFELLPFGGGRRMCPGMAFGFANVELPLASLLFHIDWEASGV 119990
119991 ADPTEFDMTEAFGITARRKANLLLRPILRVPVPGV* 120098

>AP003571.1 $F chromosome 6 clone P0458E02
67847 MADVLSQGYVYLAMALVALLGVLLTKCSRTATAQRRLPPGPWQLPVIGSLHHLIGKLPHHAMRDLTRRHG 68056
68057 PVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAGTMGGRDIAFAPYGDY 68233
68234 WRQLRKIAATELLSAPRVASFRAIREEEVAATLRTVAAAAADGRAVELRAALCAL 68398
68399 VTDSTSRAVVGDRCKESDALIRAFDRSMELASGFNPAADLWPSSRLAGLLSGGVREIEA 68575
68576 NLHTVFGILDRLIEKRLQQKKTAPSSAAGEDILDALLRIHKEGGGLQFPLDMDSIKLIIA 68755 (0)
73915 DLFSGGGETVATLLVWAMAELIRNPMAMQKATTEVRRAFALAGAVSEGKGALGELRYLHL 74094
74095 VIKEASRLHPPAPLLLPRECSEPCQVLGYDVPRGTQVLVNAWAIGRDERCWTGGSGDGSS 74274
74275 PEEFRPERFEDGAEAVDLRGNNFELLPFGAGRRMCPGMAFALANIELTLASLLFHFDWEV 74454
74455 PDMADPAKLDMTETLGITARRKGDLLLRPVLRMPVPGVY* 74574

>AP003571.1 $F chromosome 6 clone P0458E02
80945 MEDASHGYVYLAMAVVALLGVLLTKRSRKATAQRLPPGPWQLPVIGSLHHLAGKLPHHAMRDLARRHG 81148
81149 PVMMLRLGEVPTLVVSSPEAAQEVMRTHDAVFATRALSATVRAATMGGRDIAFAPYGDR 81325
81326 WRQLRKIAATQLLSARRVASFRAIREEEVATMLRAVAAAAADGRAVEMRAALCVV 81490
81491 VADSTARAMVGESCQERDAFLREIDRSMELVSGFNPEDLWPSSRLAGRLSGAVRKIEAS 81667
81668 LHTVLGILDRIIQKRLQEKIGGAGAAAASEDILDVLLRIHKDGGAGGLQVPLDMDDITLV 81847
81848 IT 81853 (0)
83437 SMQLQNAHACALFLTIVSSTYSYSLFNDPPSLHMQDLFSGGGETVATLLVWAMAELIRN 83613
83614 PMAMQKATAEVRRAFALPGVVSEGEGALGELRYLHLVIRETFRLHPPGPLLLPRECSEPC 83793
83794 QVLGYDVPRGTQVLVNVWAIGRDERCWPAAAGGGSPEEFWPERFEDGAEAVDLRGNNFEL 83973
83974 LPFGAGRRMCPGVAFALANIELTLASLLFHFDWEVPGMADPAKLDMAEALGITARRKGDL 84153
84154 LLRPVLRMPVPGV* 84195

>AC091302.3 $F chromosome 3 clone OSJNBb0015I21 69% to 79F2
122145 MAVTMPPMRAPALVA
122100 MLVVVLVALVRRRRHRSKGAGGRLESLPPGPVGLPVIGNMHQMLVNKPVFRWVHRLLADA 121921
121920 GGEIVCVRLGPVHVVAVTSPEMAREVLRKNDAVFADRPTTFAAESFSVGYRSASISPHGD 121741
121740 QWRKMRRVLTAEILSPATEHRLRGARGEEADHLVRYVLVRCGRDGAAVDVRHVARHFCGN 121561
121560 VIRRLTLGRRHFREPRADDEDAAAPGRDEAEHVDALFATLNYLDAFCVSDYFPALVGLD 121384
121383 LDGQEKVIKKVMRTLNRLHDPVVEERVEEWRLLRKAGERRDVADFLDVLASLDDAAGRPL 121204
121203 LTVEEIKAQTI 121171 (0)
       DIMIATVDNPSNAVEWALAEMMNKPEVMRKAMDELDTVVGRDRLVQESD 118113
118112 VRDLNYLKACIREAFRLHPYHPFNPPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVW 117933
117932 DDPLEFRPERHLSPYPAGGRGDAGVVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFA 117753
117752 RLLQGFEWSKPAGVERVELREEAASLVLAQPLVLQATPRLAAHLYGAGL* 117603

>AP003544.1 $P chromosome 6 clone P0599C12 same as AP003686.1 86688037 pseudogene
107880 GSMPAVVISKPNLARPALTTNDAVLASRQHLLNG*FLSF 107764 
107762 GCSDVTFAPAGPYHRM 107715 
107713 QMARGVEVSELLSAHHVAMYGVVRVKELQRLLAHLTKNTSSAKPIDLSECFLNLANDVLCRVAF 107521
107520 GRRFPRDEGDKLSAVLANAQDLL 107452 
107452 AGFTISDFFLELEPVASTVTGLCHRLKKCLADLCEACDVIVDVHISGNRQRIPSDREEDFVDVLLRVQ 107249

>AL606614.1 $F chromosome 4 clone OSJNBb0011N17
23233 MSMASLQAPEFLASCLLLATILFFKQLLAPSSKQRAASPSLPRPRGLPLIGNLHQVGALPHRSLAALAAR 23096
23095 HAAPLMLLRLGSVPTLVVSTADAARALFRDNDRALSGRPALYAATRLSYGQKSISFAPD 22919
22918 GAYWRAARRACMSELLGPPRVRGLRDAREREAAALVAAVAAAGASPVNLSDMVAATSSR 22742
22741 IVRRVAFGDGDGDESMDVKAVLNETQALLGGLWVADYVPWLRWVDTLSGKRWRLERRFRQ 22562
22561 LDALYERVIDDHLNKRKHASDEEDDLVDVLLRLHGDPAHRSTFGSRSHIKGILT 22400 (0)
22059 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVVAAGDKVREADLPELHYLR 21889
21888 LVIKETLRLHPAAPLLVPRETTEPFRTAHGVEIPARTRVVVNAMAIHTDPGVWGPDAERF 21709
21708 VPERHRDDADGCAQQHDGFALVPFGIGRRRCPGVHFAAAAVELLLANLLFCFDWRAP 21538
21537 PGREVDVEEENGLAVHKKNPLVLIATKSKRNTGGH* 21427

>AL606614.1 $F chromosome 4 clone OSJNBb0011N17
19270 MASLQAPEFLASCLLLLATILLFKQLLAPSSKKRAASPSLPRPKGLPLIGNLHQVGALPHRSLAAL 19073
19072 AARHAAPLMLLRLGSVPTLVVSTADAARALFRNNDRALSGRPALYAATRLSYGQKNISF 18896
18895 APDGAYWRAARRACMSALLGAPRVCELRDAREREAAALIAAVAAAGASPVNLSDMVAAT 18719
18718 SSRIVRRVAFGDGDGDESMDVKAVLDETQSLLGGLWVADYVPWLRWVDTLSGMRRRLERR 18539
18538 FRQLDAFYERVIDDHINKRKHASDEEDDLVDVLLRLHGDPAHRSMFGSRTHIKGILT (0)18368
17337 DMFIAGSDTSAVTVQWAMTELVRNPDVLAKAQHEVRRVIAGGGGGDKDGAMVREADL 17149
17148 PELHYLRLVIKETLRLHPASPLVQRETTEPFRTAHGVEIPARTRVVINAMAIHTDPGVWG 16969
16968 PNAERFLPERHRAHDADGEQQHEHDGFALVPFGIGRRSCPGVHFAAAAAELLLANLLFCF 16789
16788 DWRALPGREVDVEEENGLAVRKKNPLVLIATKSKSNRDAH* 16666

>AP003522.1 $F chromosome 6 clone P0036B02, similar to 76C2
129851 MAASSFLVECLSWLVVVLFSLYIFQLLRDARRRLPPGPWPPKPLVGDLLDLGEDGKQHRTFLRLAGR 130051
130052 YGGLMCLRFGMVPHVIVSTPDALRAVFAAAGAGGGGGGEGKKVDGIAGLPSLDVLSAMGH 130231
130232 RAHTIFALPSQDGKWRALRKFAAAEMLAPRRISSAAAGAQLQTKIVEALRREVSGHAARG 130411
130412 AAVVFRHAVLDSILSLLLGVLYSTDLEREERAMFRDLIEEIVGMLGTANVSDVFP 130576
130577 PVAALDLQGLRRRMTDLLTIMYRHFDDQVALRRRSRDAGEARKNDVLDTVLDKEES 130744
130745 EWKQEGSLLSHDVMRVLLS 130801 (0)
131025 DLYGAGASTTAALIEWGMVDLIQNPEVMTKVREELTNVLGDKLVMDESDIARLPYLQ 131195
131196 AVVKETLRLRTVVPLVPRKAEVDIEVNGYRIPKGTNVILNAWAINRSADAWSEPDKFIP 131372
131373 ERFLGGETRGYLGQDFEMIPFGLGRRICPGMPLAQKLIPLIIGTLLHRFEWELPADAK 131546
131547 EGGIDMTEKCGVVLSLVNPLKAIPKEI* 131630

>AP003990.1 $F chromosome 2 clone OJ1073_F05 55% to 71B4
7359 MADLELEKVASFLLAALLPLVLFKLAAAKRGGGDGGMRLPPGPWRLPVIGNLHQIMAGGQ 7538
7539 LVHRTMAGLARGLGDAPLLSLRLGEVPIVVASSADAAREIMSRHDAKFATRPWSPTVRVQ 7718
7719 MVDGEGLAFAPYGALWRQLRKITMVELLSPRRVRSFRRVREEEVGRLVVAVATAA 7883
7884 TRRPGEAAVNVGERLTVLITDIAVRTIIGDRFERREDFLDAAAEWVKIMSGFSLGDLFPS 8063
8064 SRLASFVSGTVRRAEANHRKNFELMDYALKQHEEKRAAAAAAGAGAVEDDEDIVDVLLRI 8243
8244 QKEGGLEVPLTMGVIKGVIR 8303 (0)
8551 DLFGAGSETSANTLQWTMSELVRNPRVMQKAQTELRDCLRGKQSVSEDDLIGLKY 8715
8716 LKLVIKETLRLHPVVPLLLPRECQETCNIMGYDVPKGTNVLVNVWAICRDPRHWENAETF 8895
8896 IPERFEDSTVDFKGTDFEFIPFGAGRRMCPGLAFAQVSMELALASLLYHFDWELPSGVA 9072
9073 PSNLDMEEEMGITIRRKNDLYLVPKVRVPL* 9165

>AP003990.1 $P chromosome 2 clone OJ1073_F05 
11020 MEKVAWCACFLFLALMVVRLRTKRRGDNNGGVKLPPGPWRLPLVGNLHQVMARGPLVHRTMADLA 11214
11215 RRLDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTIRVMMSDGVGLVFAP 11394
11395 YGALWRQLRKIAMVELLSARRVQSFRRIREDEVGRLVAAVAAAQPGEAVNV 11547
11548 SERIAALVSDAAVRTIIGDRFERRDEFLEGLAEGIKITSGFSLGDLFPSSRLASFIGGTT 11727
11728 RRAEANHRKNFELMECALKQHEEKRAAAAAAAAGAVEDDEDIVDVLLRIQKEGSLQVPLT 11907
11908 MGNIKAVVL 11934 (0)
12556 DLFGAGSETSANTLQ*AMAELIMNPRTMLKAQAELRDALQGKQIVSEYDLVKLKYLKL 12729
12730 IIKETLRLHPVVPLLLPRE 12786 
      CQETCKVMDYDVPIGTIVLVNMWVIGRDPKYWEDAKTFRPERFEDGHIDFKGMNF 12955
12956 EYLPFGAGRRMCPGVAFAEAIMELALASLLYHFDWEFPDGISPAKMDMMEVMGSTVRKKN 13135
13136 DLYLVPNAHVPVAP* 13180

>AP003990.1 $F chromosome 2 clone OJ1073_F05 one in frame stop at W 
16507 MEKVAWCACFLLLALMVVRLTAKRRGDNGAERLPPGPWRLPLVGNLHQVMARGPLVHRTMADLARRLD 16710
16711 APLMSLRLGEVPVVVASSADAAREIMRTHDVAFATRPWNPTTRRLRCDGEGVVFATYGAL 16890
16891 WRQLRKLCVVELLGARRVRSFRRVREEEARRLVAAVAASPRGEAVNVSERI 17043
17044 TAVITDATMRAMIGDRFGRRDEFLELLADIVKIGSGFSLDDLFPSWRLAGAIGGMARRAE 17223
17224 ANHRRTYELMDSVFQQHEQRRVHVAAPADGAMDDAEEDLVDVLFRIQKDGGLEVPLTIGN 17403
17404 IKAIIL 17421 (0)
17795 DLFNAGSETSANTLQWVMSELMRNPKVMRKAQAELRNNLQGKTTVTEDDLTNLKYLKL 17968
17969 VIKETLRLHPVLPLLLPRECREACNVIGYDVPKYTTVFINV*AINRDPKYWDMAEMFKPE 18148
18149 RFDNSMIDFKGTDFEFVPFGAGRRICPGIAFAQSNMELVLATLLYYFDWELPSGMSPEE 18325
18326 LDMTEDMGLSVRRKNDLYLHPTVCVPL* 18409

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
27391 MEQVSCFAAAAAVVVVVLLLARMLLAPRGEWDGLNLPPSPPRLPFIGSFHLLRRSPLVHRALADVARQL 27597
27598 GSPPLMYMRIGELPAIVVSSADAAREVMKTHDIKFASRPWPPTIRKLRAQGKGIFFEPYG 27777
27778 ALWRQLRKICIVKLLSVRRVSSFHGVREEEAGRLVAAVAATPPGQAVNLTE 27930
27931 RIEVVIADTTMRPMIGERFERREDFLELLPEIVKIASGFSLDDLFPSSWLACAIGGSQRR 28110
28111 GEASHRTSYELVDSAFRQRQQQREAMAASPPDIAKEEEDDLMDELIRIHKEGSLEVPLTA 28290
28291 GNLKAVIL 28314 (0)
28577 DLFGAGSETSSDALQWAMSELMRNPRVMEKAQNEVQSILKGKPSVTEADVANLKY 28741
28742 LKMIVKETHRLHPVLPLLIPRECQQTCQIMGYDVPQGSVIFINSWAIMRDPKHWDDAETF 28921
28922 KPERFEDGEIDLKGTNYEFTPFGAGRRICPGLALAQASIEFMLATLLYHFDWELPNRAA 29098
29099 PEELDMTEEMGITIRRKKDLYLLPTLRVPLTA* 29197

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
33613 MEQVSCFAAAAAAVLVVLSLARMLLAPRREWD
33709 GLNLPPSPSRLPFIGSFHLLRRSPLVHRALADVVRQLGAPPLMYMEIGEVPAIVVSCADA 33888
33889 AREIMKTHDINFASRPWPPTVQKLRAQGKGIFFEPYGALWRQLRKICIVKLLSVRRVSSF 34068
34069 HGVREEEAGRLVAAVAATPPGQAVNLTERIKVAIADTTMRPMIGERFERRE 34221
34222 DFLEVLPEIVKLASGFSLDDLFPSS 34296
      GSPAPSAARGEAVNRASYELVDSAFRQRQQQKEAMAAPPPDIAKEE
      EDDLMDELIRIHKEGSLEVPLTAGNLKAVIL 34528 (0)
34777 ELFCAGSETSSNAIQWAMSELVRNPKVMEKAQNEVRSILKGKPTVTEADMVDLTY 34941
34942 VKMIVKETHRLHPVLPLLTPRVCQQTCQIMGYDVPQGSVIFIKSWAIMRDPKHWDDAETF 35121
35122 KPERFEDSEIDLKGTNYEFTPYGAGRRICPGLALAQVSIEFILTMLLYHFNWELPNGAA 35298
35299 PEELDMTEDMGLTIRRKNDLYLLPTLRVPLTA* 35397

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
38238 MYDAVACVVAVVVVVVFAMLWVKLARSGDGGGGGSGGVRLPPGPWRLPVIGSLHHVVGDRLLHRSMA 38438
38439 RIARRLGDAPLVYLQLGEVPVVVASSPGAAREVTRTHDLAFADRALNPTARRLRPGGAGV 38618
38619 ALAPYGALWRQLRKICVVELLSARRVRSFRRVREEEAGRLVGALAAAAASPGEEA 38783
38784 AVNFTERIAEAVSDAALRAMIGDRFERRDEFLQELTEQMKLLGGFSLDDLFPSSWLASAI 38963
38964 GGRARRAEANSRKLYELMDCAIRQHQQQRAEAAVVDGGAGVEDDKNQDLIDVLLNIQKQG 39143
39144 ELETPLTMEQIKAVIL 39191 (0)
39428 DLFSGGSETSATTLQWAMSELIKNPMVMQKTQAELRDKLRRKPTVTEDDLSGLKYVKL 39601
39602 IIKETLRLHPVVPLLVARECRESCKVMGYDVPKGTTVFVNAWAIGRDPKYWDDAEEFRPE 39781
39782 RFEHSTVDFKGIDLEFIPFGAGRRICPGMAFAEAIMELLLAALLYHFDWELPNGMAASE 39958
39959 LDMTEEMGITVRRKNDLHLRPHPPCVVRSNFRSFVERERERHFV* 40093

>AP003990.1 $P chromosome 2 clone OJ1073_F05 pseudogene
42530 MDHVLACVGILVAFTPLFLLAVLPLKLTNGGDGVKLPPGPWRLPVIGSMHHLMGESLVHRAMAD 42721
42722 LARRLDAPLMYLKLGEVPVVLASSPCAAREIMRAHDVAFASRPLSPTVRRMR 42877
42878 PPPPRRRQLRKICVVELLSARRVRTFRRVREEEVARLVGALVCLAHVA 43021 
      AMIGARFERRDEFLE
43862 DLFSGGSETSATVIQWAMSELMKNPRVMRKVQAELRDKLAGKPRVTEDDLSDLKYLKL 44035
44036 VIKETLRLHPAAPLLVPRQCREPCKIMGYDIPKGTTVFVNAW 44161 
44161 AIGRDPNYWDDAEVFRLERFANSTIDFKGMDMEFIPFGAGRRMCSGLAFAEAIIDLLFS 44337
44338 TLLFHFDWELPCGMTASELDMIEEMALTVRRKNDLHLRPILRVPQTQTSSALLF* 44502

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
66403 MATELTEYLLLLPLLVVPLLYLAASSSRRSGRLRLPPGPWALPVIGHLHHLALAGAPTHR 66582
66583 AMRDMARRHGPLMLLRFCELPVVVASSPDAAREIMRTHDVAFASRPIGPMLRLVFQGAEG 66762
66763 VIFAPYGDGWRQLRKICTVELLSHRRVHSFRPVRADELGRLLRAVADQAASSSS 66924
66925 SPVNLTGMISAFVADSTVRAIIGSRSRHRDTFLRLVEDGLKIMPGMSLPDLFPSSRLAML 67104
67105 LSRVPAKIERRRRGMMGFIDTIIQEHQESRAAAEDEDLLDVLLRLQKDMDSQYPLTTMN 67281
67282 IKSILI 67299 (0)
67380 DMFGAGSETSATTLQWAMAELMRNPAVMRRAQDEVRRELAVAGNDRVTEDTLPSLHYL 67553
67554 RLVIKETLRLHPPAPLLLPRECGGACKVFGYDVPAGTMVLVNAWAIGRDAAAWGAAAEEF 67733
67734 SPERFERCERDFRGADFELIPFGAGRRICPGMAFGLAHVELALAALLFHFDWRLPGGMA 67910
67911 AGEMDMTEAAGITVRRRSDLLVFAVPRVPVPAQ* 68012

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
68586 MPLVVLLLATIPLLFFTIKRSAQRRGGGGGGEGRLPPGPWALPVIGHLHHLAGDLPHRA 68762
68763 LSALARRHGALMLLRLGEVQAVVASSPDAARDIMRTHDAAFASRPLSPMQQLAYGRDAEG 68942
68943 VIFAPYGDGWRHLRKICTAELLSARRVQSFRPVREAELGRLLRSVAEATSSSSSA 69107
69108 SLVNLTELISAFVADSTVRAIIGSRFEHRDAYLRMLQDGLKIVPGMTLPDLFPSSRLALF 69287
69288 LSRVPGRIEHHRQGMQRFIDAIIVEHQEKRAAAAANDDDDEDEDFLDVLLKLQKEMGSQH 69467
69468 PLTTANIKTVML (0) 
      DMFGAGSESSATVLQWT 69647
69648 MAELMRNPRVMQKAQDEVRRALAGHDKVTEPNLTNLPYLRLVIKETLRLHPPAPLLLP 69821
69822 RKCGSTCKILGFDVPEGVMVIVNAWAIGRDLTYWDKPEEFVPERFEHNGRDFKGMDFEF 69998
69999 IPFGAGRRICPGITFGMAHVELVLSALLYHFDWELPQGMAAKDLDMTEDFGVTTQRRSNL 70178
70179 LVRPIHRVSVPVE* 70220

>AP003990.1 $F chromosome 2 clone OJ1073_F05 
70828 MAGELAFYLLLVGLVAVPLLILLGSERRTAARTRLPPGPWALPVVGHLHHLAGGLPPHRA 71007
71008 MRDLARRHGPLMLLRLGEVEAVVASSPDAAREIMRTHDVAFASRPVGPMSRLWFQGADGL 71187
71188 VFAPYGEAWRRLRRVCTQELLSHRRVQSFRPVREDELGRLLRAVDAAAAAGT 71343
71344 AVNLTAMMSTYVADSTVRAIIGSRRLKDRDAFLRMLDELFTIMPGMSLPDLFPSSRLAML 71523
71524 VSRAPGRIMRYRRRMRRIMDSIIHEHQERRAAADAAGDDDDDDDEDLVDVLLRLQKEVGA 71703
71704 QYPLTTENIKTVMM 71745 (0)
71837 DIFGAASETSSTTLEWVMAELMRSPSAMRKAQDEVRRALAAGAAGHDTVTEDILPNLSYL 72016
72017 KLVVKETLRLHPPAPLLAPRRCDSPREVLVLGHDVPAGATVLVNAWAIGRDTAAWGGAA 72193
72194 EEFSPERFERCERDFRGADFELIPFGAGRRMCPGMAFGLVHVELALAALLFHFDWSLPG 72370
72371 GMAADELDMAESSGLTTRRRLPLLVVARPHAALPTKYCN* 72490

>AP004000.1 $F chromosome 2 clone OJ1115_B01
95316 MAMVQDITGYLCLSLALLLLTLVLHKVARKATGNGAGKPRLPPGPWRLPVIGNLHQVAMGGPLVHRTMADLA 95101
95100 RRLDAPLMSLRLGELRVVVASSANAAREITKTHDVAFATRPWTSTIRVLMSDGVGLVFAP 94921
94920 YGALWRQLRKIAVVELLSARRVQSFRRIREDEVGRLVAAVAAAPAAQPVNV 94768
94767 SERIAALISDSAVRTIIGDRFERRDEFLEGLAEAIKITSGFSLGDLFPSSRLASFVGGTT 94588
94587 RRAEANHRKNFELIECALRQHEERRAAGAVDDDEDLVDVLLRVQKDGSLQMPLTMGNIKA 94408
94407 VVL 94399 (0)
93945 ELFGAGSETSANTLQWAMTELIMNPRVMLKAQAELSNVIKGKQTISEDDLVELKYLKL 93772
93771 IIKETLRLHPVVPLLLPRECRETCEVMGYDIPIGTTVLVNVWAIGRDPKYWEDAETFIPE 93592
93591 RFEDGHIDFKGTNFEFIPFGAGRRMCPGMAFAEVIMELALASLLYHFDWELPDGISPTK 93415
93414 VDMMEELGATIRRKNDLYLIPTVRVPLSTVL* 93319 

>AP004000.1 $P chromosome 2 clone OJ1115_B01 pseudogene fragment
101503 RVVASSTDAACREFTKTHDVKFATRPWSSTVRVLMADGLG 101393

>AP004000.1 $F chromosome 2 clone OJ1115_B01
109813 MAMVQYVTGYLCLLSLALLLLTLVLHKVARKATGNGAGKPRLPPGPWRL
       PVIGNLHQVAMGGPLVHRTMADLA 109595
109594 RRHDAPLMSLRLGELRVVVASSADAAREITKTHDVAFATRPWSSTIRVMMSDGVGLVFAP 109415
109414 YGALWRQLRKIAVVELLSARRVQSFRRIREDEVCRLVAAVAAAQPGEAVNV 109262
109261 SERITALISDSAVRTIMGDRFEKRDEFLEGLAEGDRIASGFSLGDLFPSSRLASFVGGTT 109082
109081 RRAEANHRKNFGLIECALRQHEERRAAGAVDDDEDLVDVLLRVQKEGSLQVPLTMGNIKAVIL 108893 (0)
107479 ELFGAGSETSASTLHWAMTELIMNPKVMLKAQDELSNVIKGKQTISEDDLVELRYLKL 107306
107305 VIKETLRLHPVVPLLLPRECRETCEVMGYDIPIGTTMLVNVWAIGRDPKYWEDAETFRPE 107126
107125 RFEDGHIDFKGTDFEFIPFGAGRRMCPGMAFAEAIMELVLASLLYHFDWELPDGISPTK 106949
106948 VDMMEELGATIRKKNDLYLVPTVRVPMSTAL* 106853 

>AP004000.1 $F chromosome 2 clone OJ1115_B01
123850 MEEPTSCYGYYHYLALAVAVLVLVRVTRTRGGGSDGVRLPPGPWRLPVIGSLHHLAGKPLVHRALAD 124050
124051 LARRMDAPLMYLRLGEVPVVVATSPGAAREVMRTHDVAFATRPVSPTVRIMTADGEGLVF 124230
124231 APYGALWRQLRRIAILELLSARRVQSFRRVREEEAARLAAAVAAAAPHGEAAV 124389
124390 NVSERIAVLIADSAVRAMIGDRFKKRDEFLEALAEGLKLVSGFSLADLFPSSWLASFVTG 124569
124570 AARRAQENHRKNFELMDRAIEQHQERRAAAAAASGDVVEDDDLVDVLLRIQKGGGLDVPL 124749
124750 TMGIIKAVIL 124779 (0)
124917 DLFSAGSETSATTIQWAMSELMRNPRVMKRAQAELRDNLQGKPKVTEEDLTDLNYLKL 125090
125091 IIKETLRLHLPAPLLLPRESRESCKIFGYDVPKGTTVLVNAWAIGRDPKYWDDPEEFKPE 125270
125271 RFEDSKIDFKGLDFEFLPFGSGRRMCPGIMFAQPNIELALATLLYHFDWSLPAGVKPSE 125447
125448 LDMTEEMGITVRRKNDLYLHAVVRVPLHATTP* 125546

>AP004000.1 $F chromosome 2 clone OJ1115_B01
127153 MAQDVAEYLSIFLALVVAPLLLLRVARRARGNGAGRPRLPPGPWRLPVIGSLHHLMGKPHVHRAMA 127350
127351 DLARRHGAPLMYLRLGEVPFVVASSPDAAREVLRAQDANFASRPWSPTLRVMMADGEGLA 127530
127531 FARHGAHWRLRKICVLELLGPRRVRSFRRVREEEVARLLAAVAAAAAAGADAV 127689
127690 VNVSERAAVLVTDTX 127731 
127734 VRAMIGDRFEMRDEYLEGVAEVGKLLLGLSLGDLFPSSRLASLVSGTARRAAASHRKMFE 127913
127914 LMDCAIRHHQERKAAMDADEDILDVLLRIQKEGGHDAPLTMGDVKDTIL 128060 (0)
128189 DLFAAGTETSTATLQWAMSEVVRNPRIMQKAQAELRNKLQGKPSVTEDDLVGLTYLKL 128362
128363 VIKETLRLHPAAPMLVPRECGESCKVLGYDVPRGTNVLINAWAIGRDPNYWDDTETFKPD 128542
128543 RCENNKYNFRGTDFEYIPFGSRRKICPGPAFTHAILELALAALLYHFDWELPCGVAPGE 128719
128720 VDMAEETGVVVRPKNDLYLRPVVRVPPGAASSGNGGT* 128833

>AP004688.1 $F chromosome 6 clone P0036C11 52% to AP003523.1 78% to AP004684.1b  
57304 METAELCCLLALLPLVYCLLTLFHGSRESDLRLPPGPWRLPLIGSLHHLFGRTLPHRA 57477
57478 LRDLARLHGPLMLLSFGQAAPVVIASTAIAAREIMRTHDDNFSTRPLSTVLKVCTRYGA 57654
57655 GMTFVPYGEHWLQVRKICSLELLSPRRILKFRSIREEEVARLVLAIASSSTPTPTPPAPV 57834
57835 NLSKLLSNYMTDATVHIIMGQCFRDRDTLVRYVDEAVRLASSLTMADLFPSWRLPRVMCA 58014
58015 TTLHRAEVFVESVMEFMDRVISEHLEKRSCQGGDREEDLIDVLLRLQAEGNLEFELSTSI 58194
58195 IKAIIF 58209 (0)
58290 ELLAGGSEAPITTLQWAMAELMRNPDVMSRAQAEVREAYKEKMKVTEEGLTNLPY 58469
58470 LHCIIKETLRLHTPGPFVLPRKCQEQCQILSYDVPKRATVVVNIWAICRDAEIWDEPEKF 58649
58650 MPDRFEGSAIEHKGNHFEFIPFGAGRRICPGMNFALANMELALASLLFYFDWSLPEDVLP 58829
58830 GDLDMTETMGLTARRKEDLYVCAIPFVQLP* 58919

>AC092559.2 $F chromosome 3 clone OSJNBb0096M04, similar to 71B3
96529 MATLLSKLLALPQQWQLLLLLLLLPIASLLLVIGRNTGGRRRRRHLR
96388 LPPGPARLPVLGNLLQLGALPHRSLRDLARRHGPVMMLRLGAVPAVVVSSPEAAQEVLR 96212
96211 THDADCCSRPSSPGPMRLSYGYKDVAFAPYDAYGRAARRLFVAELFSAPRVQAAWRARQDQ 96017 (0)
94678 VEKLIGKLTRPEPEPVELNDHIFALTDGIIGAVAFGSIYGTERFAGGGRKRFHHLLDDVMDMLASFSAEDFFPNA 
94454
94453 AAARLFDHLTGLVAHRERVFQQLDAFFEMVIEQHLDSDSSNAGGGGGNLVGALIGL 94286
94285 WKQGKQYGDRRFTRENVKAIIF 94220 (0)
94119 DAFIGGIGTSSVTILWAMAELMRSPRVMRKVQAEIRATVGDRDGGGMVQPDDLPRLAY 93946
93945 LKMVVKETLRLHPPATLLMPRETMRDVRIGGYEVAARTRVMVNAWAIGRDAARWEEAEVF 93766
93765 DPDRFEAKRVEFNGGHFELLPFGSGRRICPGIAMGAANVEFTLANLLHCFDWALPVGMAP 93586
93585 EELSMEESGGLVLHRKAPLVLVPTRYIQL* 93496 

>AP004346.1a two genes and a pseudogene 71B like 47% to AC092559.2 75% to AP004346.1b
22020 MADDFLSSQPQPW 22058
22059 PPLLQLSAAVLFFLLPLLYLLFLRGSNGEVRGRQGNSASAPSLPGPCRQLPVLGNLLQIG 22238
22239 SRPHRYFQAVSRRYGPVVQVQLGGVRTVVVHSPEAAEDVLRTNDVHCCSRPPSPG 22405 (2)
26427 SYNYLDVAFAPYSDYWREMRKLFVVELTSVSRVRSFAYARAAEVARLVDTL 26577
26578 AASPPGVPVDLSCALYQLLDGIIGTVAFGKGYGAAQWSTERAVFQDVLSELLLVLG 26745
26746 SFSFEDFFPSSALARWADALAGVERRRRRIFRQVDGFLDSVIDKHLEPERLSAGVQED 26919
26920 MVDALVKMWREQQDRPSGVLTREHIKAILM 27009 (0)
28586 NTFAGGIDTTAITAIWIMSEIMRNPRVMQKARAEVRNTVKNKPLVDEEDSQNLKYLEMIIKEN 28774
28775 FRLHPPGNLLVPRQTMQPCLIGGYNVPSGTRVFINIWAMGRGPMIWDNPEEFYPERFE 28948
28949 DRNMDFRGSNFELVPFGSGRRICPGVAMAVTSLELVVANLLYCFDWKLPKGMKEEDIDM 29125
29126 EEIGQISFISFRRKVELFIVPVKHEQYQLMGHIN* 29221

>AP004346.1b two genes and a pseudogene 48% to AC092559.2 75% to AP004346.1a
69192 MATELLASQLLPWQPLVQLLAAGLFLLPLVYLLFFKGDGNGG 69317
69318 VMDSASAPSPPGPPRQLPVLGNLLQIGSRPHRYFQAVARRYVPVVQVQLGSIRTVVVHS 69494
69495 PEAAKDVLRTNDLQCCSRPSSPG 69565 (2) 
72047 NYNYLDVAVSPYS 72083 (frameshift)
72085 YWREMRKLLVIELTSIRRVQSFAYARAAEVARLVDTLAASPAGVPVDLSSALYTF 72249
72250 SDGVIGTVAFGKVYGSAAWSSWEWGASFQEAMDETMQVLGSFSFEDFFPSSALARWADALTGA 72438
72421 AGRRRRVFHRIDGFFDAVIDKHLEPERLSAGVQEDMVDAMVMVWREQKDEAFGLTRDHIKAILL 72630 (0)
84351 DAFVGGIDTTAVTVTWIMSELMRNPRVMQKAQAEVHNIVKNKSKVCEEDIQNMKYLKM 84524
84525 IIKENFRLHPPGTLLIPRQTMKTCTIGGYSVPSETRIYVNVWAMGRDPNIWDNPEQFY 84698
84699 PERFEDKGIDFRGSHFELLPFGSGRRICPGIAMGVANVELVVANLLYCFNWQLPKGMKEE 84878
84879 DIDMDEIGQLAFRKNFLF* 84935

>AP004346.1c two genes and a pseudogene probable pseudogene 89% to AP004346.1b
92865 DAFAGGIDTTVVTTTWIMSELMRNPRVMQK 92954 (frameshift)
92956 AQAEVHNIVKNKSKVYEENIQNMKYLKMIIKENCRLHPPGTLLIPRHTMKTCTIGGYSV 93132
93133 PSKRRIYVNVWAMWRDPNIWDNLEQFYLERFEDKGIDFRGSHFELLT 93273 (insertion)
93561 FGSGQRICPGIAMGVANVELVVANLLYCFDWQLPKGMKEEDTDMDEIG*LAFRKKLPLFI 93740
93741 VPMKH* 93758

>AL606625.1 $F chromosome 4 clone OSJNBa0032I19 similar to 71B28 = AQ858445.1
82576 MGASILLVVVVSKLMISFAAKPRLNLPPGPWTLPLIGSIHHVVSSRESVHSAMRRLARRHGAPLM 82770
82771 QLWFGEVGTVVASSPEAAREVLRSHDLAFADRHLTAAAAAFSFGGRDVVLSPYGERWRQL 82950
82951 RKLLTQELLTASRVRSFRRVREEEVARLMRDLSAAATAGAAVNLSEMVTRMVNDTVLRCS 83130
83131 VGSRCEHSGEYLAALHAVVRLTSGLSVADLFP 83226
83227 SSRLAAMVSAAPRAAIANRDKMVRIIEQIIRERKAQIEADDRAADSKSC 83373
83374 ACSLDDLLRLQKEGGSPIPITNEVIVVLLM 83463 (0)
84970 DMFAGGTDTSSTTLIWAMAELIRSPRVMAKVQSEMRQIFDGKNTITEDDLVQLSY 85134
85135 LKMVIKETLRLHCPLPLLAPRKCRETCKIMGYDVPKGTSAFVNVWAICRDSKYWEDAEEF 85314
85315 KPERFENNDIEFKGSNFEFLPFGSGRRVCPGINLGLANMEFALANLLYHFDWKLPNGMLH 85494
85495 KDLDMREAPGLLVYKHTSLNVCPVTHIASSCA* 85593

>AP003909.1 $F chromosome 8 clone OJ1300_E01 55% to 71C4
50394 MAQMLDGLRHDEQASLHAPQEASTMPTMSCSD
50298 LLLAMMCPLILLLIIFRCYAYATRSGGMLSRVPSPPGRLPVIGHMH 50161
50160 LISSLPHKSLRDLATKHGPDLMLLHLGAVPTLVVSSARTAQAILRTHDRVFASRPYNTIA 49981
49980 DILLYGATDVAFSPYGDYWRQIKKIVTMNLLTIKKVHSYGQTRQQEVRLVMAKIVEEAAT 49801
49800 HMAIDLTELLSCYSNNMVCHAVSGKFFREEGRNQLFKELIEINSSLLGGFNLEDYFPSLA 49621
49620 RLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLSIQQEY 49441
49440 GLTKDNIKANLVVMFEAGTDTSYIELEYAMAELIQKPQLMAKLQAEVRGVVPKGQEIVTE 49261
49260 EQLGRMPYLKAVIKETLRLHPAAPLLVPHVSMVDCNVEGYTIPSGTRVIVNAWAIARDPS 49081
49080 YWENAEEFMPERFLSNTMAGYNGNNFNFLPFGTGRRICPGMNFAIAAIEVMLASLVY 48910
48909 RFNWKLPIDQAANGGIDMTETFGITIHLKEKLLLVPHLP* 48790

>AP003909.1 $P chromosome 8 clone OJ1300_E01, 4 in frame stops pseudogene 
54948 MAQMLGALLLFQDSLMSTMTRMSY
54876 SLLLPILCPLILLLLFRCYAYATRSGGMLDKLPSPPGRLPLIGHM 54742
54741 HLIGFFPHMSLRDLATDLMLLHLGTVPTLVVSSSRMAQVILRTHDRVFASR*QSAI 54574
54573 TDILF*GATDVAFSPYGDYWRQIKKIVTTNLLTIKKIRSYSQTRQQEVRLVMAKIVEEAA 54394
54393 THMAIDLTELLSCYSNNMVCHAVSGMFFCEEGRNQLFKELI*INSSLLGGFNIEDYFPSL 54214
54213 ARLPVRRLLYAKAYDVKKRWDQLLDKLIDDHSSKHRSSLLDNNDVESDFIDVLLSIQQE 54037
54036 YGLTKDNIKANLAIMFEAGTDTSFIELEYSMAELM*KPQMIAKLQAEVRGVVSKGQDIVT 53857
53856 EEHLGRMPYLKAVIKETLRLHPAAPLLAPHVSVVDCNVEGYTIPSGTRVIVNAWAIARDP 53677
53676 SYWENAEEFMPERFLSNTMADYNGNNFNFLPFRTGRRICPGINFAITTIEIMLASLV 53506
53505 YRFDWKLFTSRIDMTETFGATIHLKEKLFLVPHLPQDN* 53389

>AP003909.1 $F chromosome 8 clone OJ1300_E01 5831656692
58316 MAVMLVPIPLLLLHQHHNHEHEHPSPVAPQPTM
58217 ASYYTLLLALLCPLLLLLIKLCRAKTRDDELFDKLPSPPGRLPV 58086
58085 IGHLHLIGSLPYVSFRELAIKHGPDLMLLRLGTVPTLVVSSARAAQAILRTNDHVFASRT 57906
57905 YSAVTDILFYGSSDVAFSPYGEYWRQVKKIATTHLLTNKKVRSYSRARQQEVRLVMARIN 57726
57725 EAAVARTTVDLSELLNWFTNDIVCHAVSGKFFREEGQNQMFWELIQANSLLLGGFNLEDY 57546
57545 FPNLARVTTVRRLLCAKAHNVNKRWDQLLDKLIDDHATKRSSSVLDLDNEESDFIDVLLS 57366
57365 IQHEYGLTRDNVKAILVIMFEGGTDTAYIELEYAMAELIRKPQLMAKLQAEVRSVVPRGQ 57186
57185 EIVTEEQLGRMPY 57153 
57147 LKAVIKEMLRLHLAGPLLVPYLSIAECDIEGYTIPSGTRVFVNAWALSRDPSFWENAEEF 56968
56967 IPERFLNSIAPDYNGNNFHFLPFGSGRRICPGINFAIATIEIMLANLVYRFDWEIPA 56797
56796 DQAAKGGIDMTEAFGLTVHRRRSSSLFLGSHKIK* 56692

>AP003909.1 $F chromosome 8 clone OJ1300_E01 6822369939
68223 MELNNTEPLTASRAQAAAVFLLLPVALLLLLLRFARATTMAGDRNSELLLSKLPS 68387
68388 PPLRLPVIGHMHLVGSLPHVSLRDLAAKHGRDGLMLVHLGSVPTLVVSSPRAAEAVLRTH 68567
68568 DLAFASRPRAMVPDIITYGATDSCYGPYGDHFRKVRKAVTVHLLNSHKVQAYRPAREEEV 68747
68748 RLVIAKLRGAAAMAGAPVDMTELLHSFANDLICRAVSGKFFREEGRNKLFRELIDTNASL 68927
68928 LGGFNLEDYFPSLARTKLLSKVICVRAMRVRRRWDQLLDKLIDDHATRLVRRHDHDQQQD 69107
69108 SDFIDILLYHQEEYGFTRDNIKAILV 69185 (0)
69331 DMFEAGTDTSYLVLESAMVELMRKPHLLAKLKDEVRRVIPKGQEVVNEDNIVDMVYLKAV 69510
69511 IKETLRLHPPAPLYIPHLSREDCSISGYMIPTGIRVFVNAWALGRDAKFWDMPDEFLPER 69690
69691 FMDSNIDFKGHDFHYLPFGSGRRMCPGIHSATVTLEIMLANLMYCFNWKLPAGVKE 69858
69859 EDIDMTEVFGLTVHRKEKLFLVPQAA* 69939

>AP003909.1 $F chromosome 8 clone OJ1300_E01 7893580982
78935 MELILQLEAKTAAQAVVTVFFFFLLPLALLFYFARAAISSRDSKTRELILSKLPSPPFK 79111
79112 LPVIGHMHLIGPLPYVSLRDLAAKHGRDGLMLVRLGSVPTLVVSSPRAAEAVLRTHDLAF 79291
79292 ASRPRSMVTDIIMYGALDSCFAPYSDHFRSVKKVVTVHLLNSKRVQAYRHVREEEVRLVM 79471
79472 ARLRGAAAAAAAVDLSQTLQFFANDLICRAVSGKFLCEQGRNKVFRDLMEANSNLLGGFN 79651
79652 LEAYFPGLARMPLISKLICARAIRIRRRWDQLLDMLIDDHVASARDRAKNDDDDFIHVL 79828
79829 LSLQDEYGFTRDHIKAISI 79885 (0)
80359 DMFEAGTDTSHLVLEYAMVELTRKPHILTKLQDEVRRITPKGQHMVTEDDIVGMVYLKAV 80538
80539 IKETLRLHAPGGFTIPHLAREDCNVDGYMIPAGTRVLINLWALSRDANYWDKPDEFLPER 80718
80719 FMDGSNKNTDFKGQDFQFLPFGSGRRMCPGIHSGKVTLEIMLANLVYCFNWKLPSGMKK 80895
80896 EDIDMTDVFGLAIHRKEKLFLVPQIANY* 80982

>AP003909.1 $F chromosome 8 clone OJ1300_E01 6382661994
63826 MVVQLMLFFHDKFMAPMAEEPLPFVLIMIII
63733 LLLLVLLHYYLSASTRRSSAASKSNDDVLPPSPPRLPVIGHMHLVGSNPHV 63581
63580 SLRDLAEKHAADGFMLLQLGQVRNLVVSSPRAAEAVLRAHDHVFASRPRSAIADILAYGS 63401
63400 SNISFSPYGDYWRKARKLVAAHLLSPKKVQSLRRGREEEVGIAVAKLHEAAAAGAAVDMR 63221
63220 ELLGSFTNDVLCRAVCGKSSFRREGRNKLFMELAAGNADQYAGFNLEDYFPSLAKVDLLR 63041
63040 RVVSADTKKLKEKWDSVLGDIVSEHEKKSSLRRDDQVQMDDDRDDDQEEQESDFVDILLD 62861
62860 RQQEYNLTRHNIHAILM 62810 (0)
62626 DMFAAGTDTSYIALEFAMSELIRKPHLMTKLQDEVRKNTTTQMVSEDDLNNMPYLKAV 62453
62452 VKETLRLHPPVPLLLPRLSMAQCNANGYTIPANTRVIINVWALGRDAKCWENSEEFMPER 62273
62272 FMDSGDTIDNVDFKGTDFQFLPFGAGRRICPGMNFGMASVELMLSNLMYCFDWELPVGMD 62093
62092 KDDVDMTDQFALTMARKEKLYLIPRSHVIKIT* 61994

>AP003909.1 $P chromosome 8 clone OJ1300_E01 lone pseudogene fragment
61469 EQESDFVDILLDHQQEYNLTRHNIHAILM 61383

>AP004757.1 $F chr 6 52% to AF321858 Lolium rigidum 70% to AP003909
      MAQMLAAFLLDGLISHEHGHESLGAPPQAGTMAWYSLVLMTS
79980 LLFPLLVLLVMRCYVTRSGAKLLDKLPSVPGRLPVIGHLHLIGSLPHISLRDLATKH 79810
79809 SPDMMLLHLGAVPTLVVSSSRVAQSILHTHDDIFASRPYSPIANILFYGATDVGFSPYNE 79630
79629 YWRQIKKITTTHLLTMKKVRSYVSARQREVRIVMARITEAASKHVVVDLTEMLSCYSNN 79453
79452 IVCHAVCGKFSLKEGWNQLLRELVKVNTSLLGGFNIEDYFPSFTRLAAVRRLLLSCAKA 79276
79275 HNINKRWDQLLEKLIDDHTTKHIRSSSMLNHYDEEAGFIDVLLSIQHEYGLTK 79117
79116 DNIKANLAAMLMAGMDTSFIELEYAMAELMQKPHVMGKLQAEVRRVMPKGQDIVTEEQLG 78937
78936 CMPYLKAVIKETLRLHPPAPLLMPHLSISDCNINGYTIPSGTRVIVNVWALARDSN 78769
78768 YWENADEFIPERFIVNTLGDYNGNNFHFLPFGSGRRICPGINFAIATIEIMLANLV 78601
78600 YRFDWELPADQAAKGGIDMTETFGVAVHRKEKLLLIPHLHLR* 78472

>AP004757.1 $P chr 6 Pseudogene fragment last exon similar to AP003909
103765 FAIATIEIMLANLVYRFDWEILVDQAAKGGIDMTEAFGLAVHRKEKLLLVSWLPQD* 103595

>AP005285.1 gene 1 $F  43% to 81D2 (one frameshift)
MVDAMSGGVLVALMVLLLVAAPALLSQLERRRRSPSGPVALPVV (1?)
GPRGSPQNREPHPAPLP
98846 AQRPGAPVICRRFGSPPLAVVSSAPAAEECLGPHDLAFADKPRLPSGEILSYEWSTMGTA 98667
98666 RYGPYWRHIRRITVTELLSAHRVQHFAGVNAREVRAMARRLYRRAAAAAAS 98514 (fs)
98512 RVELKSRLFELFMNIMMAMICDRTFYGDGDDEVSEEARWFRSVVKETMELSGASTAWDF 
      LPAAARWLFARRLTRRMRELSDSRTRFYQRLITDHRTKEKTDDDNAAAGDHSPAPRRRTM 
      IGVLLSLQSKDPDACPDQLIRALCI (0) 98081 
97990 GSLQAGTETSAAVVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCVVMETL 97793
97792 RLYPPVPLLAHESSADCDVAGFHVRKGTMLLVNTFAIHRDPQVWDEPESFFPDR (2) 97631
94075 FADGQNEAKMVIPFGMGRRGCPGENLAMQMVGLTLGTLIQCFDWERVGEELEDMGESSG 93899
93898 ITMPKKLPLEAFYQPRACMVHLLSS* 93821

>aaaa01004834.1c (indica cultivargroup) ortholog of BI806420.1
16396 SLEAGTGTSTDTIEWAMSLLLNNPDVMRKARDEIDAFIGQPVRLLEADDLPKLQYLRCI 16220
16219 IMETLRLYPPAPLLVPHESSSDCTVAGFHIPRGTMLLVNTFDIHRDPHIWDEPTSFIPER (2?) 16040
15947 FEDGRSEGKMAIPFGMGRRKCPAENLGMQMVGLGLGTMIQCFEWERVGEELVDMTEGSG 15771
15770 LTMPKKVPLEAFYQPRASVMHLLS* 15696

>aaaa01048292.1 (indica cultivargroup) ortholog to AP005285.1 gene 1
1   AFADKPRLPSGEILSYEWSTMGTASYGPYWRHIRRITVTELLSAHRVQHFAGVNAREVRA 180
181 MARRLYRRAAAAAASAGGRARVELKSRLFELFMNIMMAMICDRIFYGDGDDEVSEEARWF 360
361 RSVVKETMELSGASTAWDFLPAAARWLFARRLTRRMRELSDSRTRFYQRLITDHRTKEKT 540
541 DDDNSAAGDHSPAPRRRTMIGVLLS
617 LQSKDPDACPDQLIRALCI (0)
    GSLQAGTETSA 796
797 AVVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCVVMETLRLYPP 976
977 VPLLAHESSADCDVAGFHVRKGTMLLVN 1060

>AP005285.1 gene 2 (partial)   sequence gap with C-helix from ortholog aaaa01004834.1a
108306 MAVDAMFGSVAVALLAVVVAAAALRRWRRRRRRGGGRPLPGPVALPVVGHLHLFRRPLHRT 108124
108123 LARLAARHGAAVMGLRFGSRRVAVVSSAPAAEECLGPHDLAFANR (?) 107989
prlpsgeilayewstmgtasygpywrhirriavtellsahrvqhfad 
107525 VNVREVRALARRLYRRAAAAAAAGARTRVELKSRLFELLMNTMMSMICERTFYGA (2) 107361
       DDDEVSEEARWFRSVVKETMELSGASTVWDFLPAPARWL 107169
107168 DAGRMTRRMRELSDSRTRFLQRLIDDQRKDMDADSDDHAPAKRRTMIGVLLSLQRKD 106998
106997 PDSCPDQLIRSLCI (0) 106956
106869 GSLQAGTDTSAATVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRCV 106687
106686 VMETLRLYPPVPLLAPHESSADCVVAGFHVPQGTMLLVNTFAIHRDPQVWDEPEAFIPDR (2) 106507
106178 FADGKNEGKMVIPFGMGRRRCPGENLGMQMVGLALGTLIQCFDWERVGEELVDMRECSG 106002
106001 LTMPKELPLEALYQPRASMVDLLTKI* 105922

>aaaa01004834.1a (indica cultivar-group) ortholog of AP005285.1 gene 2
8825 MAVDAMFGSVAVALLAVVVAAAALR 8751
rwrrrrrrgggrplpgpvalpvvghlhlfrrplhrtlarlaarhgaav
7227 MGLRFGSRRVAVVSSAPAAEECLGPHDLAFANRPRLPSGEILAYEWSTMGTASYGPYWRH 7048
7047 IRRIAVTELLSAHRVQHFADVNVREVRALARRLYRRAAAAAAAGARTRVELKSRLF 6880
6879 ELLMNTMMSMICERTFYGA (2)
     DDDEVSEEARWFRSVV 6700
6699 KETMELSGASTVWDFLPAPARWLDAGRMTRRMRELSDSRTRFLQRLIDDQRKDMDADSDE 6520
6519 HAPAKRRTMIGVLLSLQSKDPDSCPDQLIRSLCI (0) 6418
6331 GSLQAGTDTSAATVEWAMSLLLNNPGAMARARGEIDACVGQPAARLLEAADLPKLHYLRC 6152
6151 VVMETLRLYPPVPLLAPHESSADCVVAGFHVPQGTMLLVNTFAIHRDPQVWDEPEAFIPDR (2) 5969
5398 FADGKNEGKMVIPFGMGRRRCPGENLGMQMVGLALGTLIQCFDWERVGEELVDMRECS 5225
5224 GLTMPKELPLEALYQPRASMVDLLTKI* 5141

>AP005285.1 gene 3 one frameshift 43% to 81H1 very similar to BI806420.1 15 diffs
114128 MDALLIALFLLLLIALMETARVRRSGTQRRAGNVPPPPPEPAG
       LPLVGHLHLFRKPLHRTLARLAARHGGAVFGLRLGSRRVA 
       VVSSAPAAEECLGAHDVAFADRPRLPSGRILSYDWSTMGTASYGPYWRHVRRVAVTEILS
       ARRVQHFADVHVREARAMARHLHRAAVRHGVGGAARVRVELKSRLFELLMNTMMAMICDKTYYGD (2) 113505
113412 DDDGKVSKEARWFREMVEETMALSGASTVWDFLPAALRWVDVGGVGRRLWRLRESRTRF
       LQGLINDERKEMEQEQGGDRAQPAARRRTMIGVLLSVQRQDPDACPDQLIRSLC 113074
111518 AGTDTSADTIEWAMSLLLNNPNVMRKARDEIDAFIGQP  111405
111405 SRLLEASDLTKLQYLQCIIMETLRLYPPAPLLVPHEASTDCSIAGFHITRGTMLLVNTFA
       IHRDPQVWNEPTSFIPER (2)
       FENGRSEGKMAIPFGMGRCKCPAENLGMQMVGLALGTMIQCFEWERVGEELVDMTEGSG
       LTMPKEVPLQAFYQPRASLMHLLY* 110842

>aaaa01004834.1b (indica cultivargroup) ortholog of AP005285.1 gene 3
14689 MDALLIALFLLLLIALMETARVRRSGTQRRAGNVPPPPPEPAGLPLVGHLHLFRKPLHRT 14510
14509 LARLAARHGGAVFGLRLGSRRVAVVSSAPAAEECLGAHDVAFADRPRLPSGRILSYDWST 14330
14329 MGTASYGPYWRHVRRVAVTEILSARRVQHFADVHVREARAMARHLHRAAVRHGVGGAARV 14150
14149 RVELKSRLFELLMNTMMAMICDKTYYGD (2) 14066
13973 DDDGEVSKEARWFREMVEETMALSGASTVWNFLPAALRWVDVGGVGRRLWRLRESRTRFL 13794
13793 QGLINDERKEMEQEQGGDRAQPAARRRTMIGVLLSVQRQDPDACPDQLIRSLCI (0) 13632
12083 SSLEAGTDTSADTIEWAMSLLLNNPNVMRKARDEIDAFIGQPVRLLEASDLTKLQYLQCII 11901
11900 METLRLYPPAPLLVPHEASTDCSIAGFHITRGTMLLVNTFAIHRDPQVWNEPTSFIPER (2) 11721
      FENGRSEGKMAIPFGMGRRKCPAENLGMQMVGLAL 11541
11540 GTMIQCFEWERVGEELVDMTEGSGLTMPKEVPLQAFYQPRASLMHLLY 11397

>AP005285.1 gene 4 one frameshift, runs off end of clone missing last two exons
142199 MDTSTLLIALTLVLLLLLLTARRRRSGRLRLRLPPEPPGLPLVGHLHLFRKPLHRTLAR 142375
142376 LAARHGAVFRLRLGSRRVAVVVSSAPAAEECLGAHDVAFAGRPRLPSAGILSYGWSTMG 142552
142553 TAAYGPYWRHVRRVAVAEILSAHRVRQFAGAHAREARATARRLCRAASRQRHGAGAAAGR 142732
142733 VRVELKSRLFELLMNTMMAMICDKTYYGA (2) 142816
142893 DDDGEVSEEARWFREMVEETMALSGASTVWDFLPAALRWVDVGGVGRRLWRLRESR 143060
143061 TRFLQGLIDDQRKEMEHDGDGRELPAAAARPRSMIGVLLSVQR 143189 (fs)
143191 QDPEECPDQLISSLCI (0) 143238 end of clone

>aaaa01003554.1 (indica cultivargroup) scaffold003554, ortholog to AP005285.1 gene 4
3364 MDTSTLLIALTLVLLLLLLLLLTARRRRSGRPRLRLPPEPAGLPLVGHLHLFRKPLHRTL 3543
3544 ARLAARHGAVFRLRLGSRRVAVVVSSAPAAEECLGAHDVAFAGRPRLPSAGILSYGWSTM 3723
3724 GTAAYGPYWRHVRRVAVAEILSAHRVRQFAGAHDREARATARRLCRAASRQRHHGAGAAA 3903
3904 GRVRVELKSRLFELLMNTMMAMICDKTYYGA (2) 3996
4070 DDDGEVSEEARWFREMVEETMALSGASTVWDFLPAVLRWVDVGGVGRRLWRLRESRTRF 4246
4247 LQGLIDDQRKEMEHDGDGRELPAAAARPRSMIGVLLSVQRQ 4369 

>AP004022.1 $F chromosome 2 clone OJ1126_B06, CYP92A like
59881 MEVQELVPSPWSSSSSFLVLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDL 59669
59668 SRRYGPLMSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSH 59489
59488 YGEYWRQARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVT 59309
59308 LNVISRMVFGKKYIVEEGEGSSPTTAEEFR 59219 (2)
59007 WMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGRMKRLGGMFDRFLEHILDEHVERRRR 58834
58833 EGDGFAARDMVDLLLQFADDPSLKVPIQRDGVKAFIL 58729 (0)
57247 ELITGSTDTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYLDA 57074
57073 VVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVWGD 56894
56893 DAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHGFA 56714
56713 WRLPGGAAAEELSMEEKFGISVSRLVQLKAIPEPKLPAHLYDE* 56582

>AQ573853 nbxb0085A03r 50% to 71A24 AQ691042 nbxb0086M20r
MAARTWLWLLLSPLILLLLHYALALLTARRARKNPLPPSPPALPFIGHLHLIGALPHVSLCCLAT 
KHAPDLMFLRLGTSLPVLVASSPCAAEAILRTHDDVFASRPRTVLADIIFYGSRDIGFAPYGEDWRQAR

>AC113337.1 $F (japonica cultivargroup) cultivar Nipponbare clone OSJNBa0061H20, 
23542 MANLIYYSLLIILPFLLLINFYKAMFSSRKQAGRLPPCPWQLPIMGSIHHLIGDLPHRSL 23721
23722 HDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFAMRPQSEIMKIITKRGQGLV 23901
23902 FAPYDDQWRQLRKICIRELLCAKRVQSFCAIREEEAARLVKSISSDQAHLVNLSKKLADY 24081
24082 ATDAAIRIITGTRFENQEVRDKFQYYQDEGVHLAASFCTANLCPSLQLGNTLSRTARKAE 24261
24262 IYREGMFAFIGGIIDEHQERRAQDMYHKEDLIDVLLRIQQEGSLESPVSMETIKFLIF (0)
      DILAGGSETVTTVLQWAMTELMRNPTVMSKAQ 24621
24622 DEVREVFKWKKMVSNDDINKLTYLQFVIKETVRLHTPGPLFMRECQEQCQVMGYDVPKGT 24801
24802 KFLLNLWSISRDPKYWDDPETFKPERFENDARDFKGNDFEFIPFGAGRRMCPGMLFGLAN 24981
24982 IELALANLLFYFDWSLPDGVLPSELDMTENFGVTVRKKEDLLLHASLYAQLSC* 25143

>aaaa01010273.1 $F (indica cultivargroup) ortholog of AC113337.1
6315 MANLIYYSLLIILPFLFLIKFYKAMFSSRKQARRLPPCPWQLPIMGSIHHLIGDLPHRAL 6494
6495 RDLSRRYGPVMLLKFGQVPFIIVSSPEAAKDIMKTHDSIFATRPQSEIMKIITKRGQGLV 6674
6675 FAPYDDQWRQLRKICIRELLCAKRVQSFCAIREEEAARLVKSISSDQAHLVNLSKKLADY 6854
6855 ATDAAIRIITGTRFENQE VRDKFQYYQDEGVHLAASFCPANLCPSLQLGNTLSRTAHKA 7031
7032 EIYREGMFAFIGGIIDEHQERRAQDMSHKEDLIDVLLRIQQEGSLESPVSMETIKFLIF (0) 7208
7297 DILAGGSETVTTVLQWAMAELMRNPTVMSKVQDEVREVFKWKEMVSNDDINKLTYLQFVI 7476
7477 KETLRLHTPGPLFMRECQEQCQVMGYDMPKGTKFLLNLWSISRDPKYWDDPETFKPERF 7653
7654 EDDARDFKGNDF EFISFGAGRRMCPGMLFGLANIELALANLLFYFDWSLPDGVLPSELDM 7833
7834 TENFGVTVRKKEDLLLHASLYAQLSC* 7914

>AC078894.1 $P chromosome 10 clone OSJNBa0096G08 12 unordered pieces starts 123
51119 LRRICVLELFSAHRV*SLHHVREEEAAPLVRVVADIRSPLGP 50994

>AP004175.1 $P chromosome 2 clone OJ1006_B12 pseudogene fragment 
64520 LRRICMLELFSAHRV*SLHHVREEEAARLVRVVA 64419

>AC118346.1 Gene 1, 9444896200, 3 exons 97% identical to gene 2 (12 diffs)
94448 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSMRRRDGGSVRLPPSPWALPVIGHLHHLMGA 94627
94628 LPPHHAMRDIALRHGPLVRLRLGGLQVI 94711
94712 LASSVDAAREVMRTHDLAFATRPSTRVMQLVFPEGSQ (0)
      GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLL 95071
95072 RAVAAASPARRAVNLSELISAYSADSTMRALIGSRFKDRDRFLMLLERGVKLFATPSLPD 95251
95252 LYPSSRLAELISRRPRQMRRHRDEVYAFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQR 95431
95432 KGDFPLSTDNIKTTIG (0) 95479
95574 DLFNGGSETTATTLKWIMAELVRNPRVMQKAQDEVRRALGKHHKVTEEALKNLSYLHL 95747
95748 VIKEGLRLHPPGLPLLLRESRTTSQVLGFDVPQGTMILVNMWAISRDPMYWDQAEEFIPE 95927
95928 RFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFDWELPDGTELGNL 96107
96108 DMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 96200

>AC118346.1 (japonica cultivargroup) Gene 2 = AU096586.1 D48250 
113634 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSIRRRDGGSVRLPPSPWALPVIGHLHHLMGA 113813
113814 LPPQHAMRNIALRHGPLVRLRLGGLQVI 113897
113898 LASSVDAAREVMRTHDLAFATRPSTRVMQLVFPEGSQ (0) 114008
114127 GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNL 114300
114301 SELISAYSADSTMRALIGSRFKDRDKFLMLLERGVKLFATPSLPDLYPSSRLAELISRRP 114480
114481 RQMRRHRDEVYEFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG (0) 114663
       DLFNGGSETTATTLKWIMAELIRNPRVM 114840
114841 QKAQDEVRQVLGKHHKVTEEALRNLSYLHLVIKEGLRLHPPGLPLLLRESRTTSQVLGFH 115020
115021 VPQGTMILVNMWAISRDPMYWDQAEEFIPERFEHVNIDYYGTDVKYMPFGVGRRICPGIA 115200
115201 FGLVNLELVLASLLYHFNWELPDETELGNLDMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 115383

>AC118346.1 Gene 3 possible pseudogene
DAAREVMRTHDLAFATRPSTRVMQLVFLEGSQ
FTPYGDIWRNLRRSAPLAVSAKRVQFFRPIHQEEVCRLLQAVAVASPARGPPETLTS
SFRPTWATLQCAP**GARLRDRDKSLMLLYRGVKPIRHARACQIFTQSIALADLIIKSLS
PMRRASYPMSNLLDIIFK

>aaaa01011410.1 $F (indica cultivargroup) Ortholog to AC118346.1 gene 2
4935 MADQLVHLPQQLLVL 
     LLFIAPFFFFFLIRSIRRRDGGSVRLPPSPWALPVIGHLHHLMGALPPQHAMRNIALRH 5156
5157 GPLVRLRLGGLQVILASSVDAAREVMRRHDLAFATRPSTRVMQLVFPEGSQ (0) 5309
5428 GIVFTPYGDSWRNLRKICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNLSE 5607
5608 LISAYSADSTMRALIGSRFKDRDKFLMLLERGVKLFATPSLPDLYPSSRLAELISRRPR 5784
5785 QMRRHRDEVYEFLDIIIKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG (0) 5964
6058 DLFNGGSETTATTLKWIMAELIRNPRVMQKAQDEVRQVLGKHHKVTEEALR 6210
6211 NLSYLHLVIKEGLRLHPPGLPLLLRESRTTSQVLGFHVPQGTMILVNMWAISRDPMYWD 6387
6388 QAEEFIPERFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFNWELP 6567
6568 DETELGNLDMKEEMGAIARRLHDLSLVPVIRHPLPVDM* 6684

>aaaa01008885.1 $F (indica cultivargroup) almost same as AAAA01011410.1
6884 MADQLVHLPQQLLVLLLFIAPFFFFFLIRSMRRRDGGSVRLPPSPWALPVIGHLHHLMGA 6705
6704 LPPHHAMRDIALRHGPLVRLRLGGLQVILASSVDAAREVMRTHDLAFATRPSTRVMQLVF 6525
6524 PEGSQ (0)
     GIVFTPYGDSWRNLR 6345
6344 KICTVELLSAKRVQSFRPIREEEVGRLLRAVAAASPARRAVNLSELISAYSADSTMRALI 6165
6164 GSRFKDRDRFLMLLERGVKLFATPSLPDLYPSSRLAELISRRPRQMRRHRDEVYAFLDII 5985
5984 IKEHQENRSSSDDQEDLDLVDVLLRIQRKGDFPLSTDNIKTTIG 5853
5758 DLFNGGSETTATTLKWIMAELVRNPRVMQKAQDEVRRALGKHHKVTEEALKNLSYLHL 5585
5584 VIKEGLRLHPPGLPLLLRESRTTSQVLGFDVPQGTMILVNMWAISRDPMYWDQAEEFIPE 5405
5404 RFEHVNIDYYGTDVKYMPFGVGRRICPGIAFGLVNLELVLASLLYHFDWELPDGTELGNL 5225
5224 DMKEEMGAIARRLHDLSLVPVIRHPLPVDM 5135

>AP004233.1 $F chromosome 1 clone OSJNBa0065J17 50% to CYP71C4
21862 MEQAAGLVYQLFQHEMFPWTFSVLALFPFLLLVLHYLATNHRTPTTCKETKNHHPP 
21694 PPSPPRLPIIGHLHLIGGLLHVSLRELAHRYGPDLMLLHLGQVPNLIVSSPRAAEAVLR 21518
21517 THDLVFASRPYSLIADILLYGPSDVGLSPYGE*WRRRIITTHLLTNKKVRSYRVAREE 21344
21343 E 21335 (0)
VHKVMAKVHELSTKGMAVDMTELFSTFSNDLICRLVSGKNFQGEGRNKLFRQLFKAN
SVLLAGFNLKDYYPGLARLKAVSMVMCAKARNTRKLWDELLDEIIDERMS
KQQCEHDEGNDQDEMNFVNVLLLQEQGITREHLKAILV (0)
20004 DMYQAGTETSSVVLVFAMAELMQKPHLMAKLQAELRTTIPKQGHELITERDLTDMTYLKA 19825
19824 VIKETLRLHPPTPLLLPHLAMADCNIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLPE 19645
19644 RFVDDGSAANVDFIGTDFQFLPFGAGRRICPGINFASASMEIILANLLYHFDWDVSAEAA 19465
19464 IDKDGIDMAEAFGLSVQLKEKLLLVPVDYKDGMQDSAVILL* 19339

>AC109595.1 $F chr 5 39% to 71As 40% to 71Bs new 71 subfam? 44% to 71Cs
72095 MEIELSPVLLLLPFLLLGFLYLTGGVLRSGGNARRRLAPAPRGLPVIGNLHQVGALP 71925
71924 HRALRALAAATGAPHLLRLRLGHVTALVASSPAAAAAVMREHDHVFATRPYFRTAEILTY 71745
71744 GFKDLVFAPYGEHWRHARRLCSEHVLSAARSHRYGPMREQEVALLVNAIRTEAAAAAV 71571
71570 DVSKALYAFTNAVICRAVSGRLSREDEGRSELFRELIEENATLLGGFCVGDYFPALAWA 71394
71393 DAFLSGFAARACRNLRRWDELLEEVIAEHEARLRGGDDGGGEEHREEDFVDVLLALQE 71220
71219 ESQRHDGSFKLTRDIIKSLLQDMFAAGTDTSFITLEWAMSELVKNPAAMRKLQDEVRRGG 71040
71039 GATTAATPYLKAVVKETLRLHPPVPLLVPRECARDTDDDATVLGYHVAGGTRV 70881
70880 FVNAWAIHRDAGAWSSPEEFRPERFLPGGGEAEAMDLRGGHFQLVPFGAGRRVCPGMQFA 70701
70700 LATVELALASLVRLFDWEIPPPGELDMSDDPGFTVRRRIPLRLVAKPVGSEDDK* 70536

>AP004232.1 $F chromosome 1 clone OSJNBa0051H17 like CYP71C4
56483 MEQAAGLVYQLFQNEMFPWILALFPFLLLALHYLATNHRTPTTCKETRNHLSPPSP 56650
56651 PRLPIIGHLHLIGDLPHVSLRELAHRYGPNLMLLHLGQVQNLVVSSPHAAEAVLR 56815
56816 THDHVFASRPHSLIGDILLYGPSDVGLSPYGEQWRRSRRIVTTHLLTNKKVRSYHVAREE 56995
56996 E 56998 (0)
57929 VHKVMTKVHELSTKGMGVDMFELFSTYSNDLICRLVSGKNFQGDKGRNKMFRQLFKANY 58105
58106 VLLAGFNLEDYYPGLARLKAVSWVMCAKARNTRKLWDELLDEIINDRMSKQPCEHDRGND 58285
58286 DQDEMDFVDVLLLQERGITRDHLKAIL 58366 (0)
58462 DMFQAGTETTSVVLVFAMAELMQKPHLMAKLQAELRTNIPK*GRELITECDQTNMTYLKA 58641
58642 VIKETLRLHPPSPLLVPHLAMADCDIDGYTVRSGTRVIVNAWAIGRNSESWEAAEEFLPE 58821
58822 RFVDGGSAANVDFIGTDFQFLPFGAX 58896 
58899 RRICPGINFASASMEIILANLLYHFDWDVSAEAAIDKDGIDMAEAFGLSVQLKEKLLLVP 59078
59079 VEYKGSVQDSAVIL* 59123

>AC120537.1c $F chromosome 3 clone OSJNBb0042N11
103769 MEMTLPLLGAAVVLAAFLLFFLVKNNRCCWSPAAERR
103880 LRLPPGPWRLPLVGSLHHVLLSRHGDLPHRALRELAGRYGALMLLRFGAVPTLVVSSAE 104056
104057 AAREVLKTHDACFASRHMTPTLAVFTRGGRDILFSPYGDLWRQLRRICVLELFSARRVQS 104236
104237 LRHVREDEAARLVRAVAEECAIGGGGGAVVPIGDMMSRMVNDSVVRSAIGGRCARRDEFL 104416
104417 RELEVSVRLTGGFNLADLYPSSSLARWLSGALRETEQCNRRVRAIMDDIIRERAAGKDDG 104596
104597 DGEDDLLGVLLRLQKNGGVQCPLTTDMIATVIM (0) 104695
105190 EIFSAGSETASTTLEWAISELVRNPKVMDKAQSEVRKLFEGQDNLTEDDMSRLS 105351
105352 YLHLVIRETLRLHAPAPFLLPRECREQCNVMGYDITEGTRVLVNAWAIARDTRYWEDPEI 105531
105532 FKPERFNANLVDFKGNDFEYIPFGSGRRVCPGITLGLTSMELVLASLLYHFDWELPGGKR 105711
105712 CEEIDMSEAFGITVRRKSKLVLHATPRVPCLH* 105810

>aaaa01021177.1 $F (indica cultivargroup) ortholog to AC120537.1c
396 MEMTLPLLGAAVVLAAFLLFFLVKNNRCCWSPAAERRLRLPPGPWRLPLVGSLHHVLLSR 217
216 HGDLPHRALRELAGRYGALMLLRFGAVPTLVVSSAEAAREVLKTHDACFASRHMTPTLAV 37
36  FTRGGRDILF 7
3930 SPYGDLWRQLRRICVLELFSARRVQSLRHVREDEAARLVRAVAEECAIGGGGGAVVPIGD 3751
3750 MMSRMVNDSVVRSAIGGRCARRDEFLRELEVSVRLTGGFNLADLYPSSSLARWLSGALRE 3571
3570 TEQCNRRVRAIMDDIIRERAAGKDDGDGEDDLLGVLLRLQKNGGVQCPLTTDM 3412
3411 IATVIM (0) 3394
2892 EIFSAGSETASTTLEWAISELVRNPKVMDKAQSEVRKLFEGQDNLTEDDMSRLSYLHLVI 2713
2712 RETLRLHAPAPFLLPRECREQCNVMGYDITEGTRVLVNAWAIARDTRYWEDPEIFKPERF 2533
2532 NANLVDFKGNYFEYIPFGSGRRVCPGITLGLTSMELVLASLLYYFDWELPGGKRCEEIDM 2353
2352 SEAFGITVRRKSKLVLHATPRVPCLH* 2272

>AC120537.1b chromosome 3 clone 
AQ869247.1 nbeb0034D08r CUGI Rice BAC genomic Length = 447 53% to 99A1
AZ130570.1 OSJNBb0104D19r CUGI Rice BAC genomic Length = 327
80150 MEVSLPLLIGVVLAFLLLFVLVNIKNSCRSWWPPPEKEKKKLRLPPGPWQLPLVGSLHHV 80329
80330 LLSRHADLPHRALRELAGKYGPLMMLRFGAVPTLVVSSAEAAREVLKTYDAAFASRYL 80503
80504 TPTLAVLSRGGRDILFSPYCDLWRQLRRICVHELLSARRVQSLRHGREDEAARLVRSVAA 80683
80684 ECAARGGAAVVNVGELISRAVNDSVVRSAVGARSARRDEFVRELDESVRLSGGFNLADLY 80863
80864 PSSWLARRLSGAMRETERCNRSLMAIMDDIIREHGDGEEDLLGVLLRLQRNGDVQCPLTT 81043
81044 DLITNVVL (0) 81067
81865 DMFAAGSETSSTTLEWALTELVRNPHIMEKAQSEVREIFRGENKLTEEMMDKLSYLRLVI 82044
82045 RETLRLHLPVPFLLPRQCREPCSVMGYDIPVGTKVLVNAWAIARDNQYWDDPEVFKPERF 82224
82225 ENNRVDFKGIDFEFIPFGAGRRICPGIALGLANIELMLASLLYHFDWEFLDRDRNDEIDL 82404
82405 SETFGITAKRKSKLMVYATQRIPCLG 82482

>aaaa01013880.1 (indica cultivargroup) ortholog of AC120537.1b AQ869247.1
 801 MEVSLPLLIGVVLAFLLLFVLVNVKNSCRSWWPPPEKEKKKLRLPPGPWRLPLVGSLHHVLLS (fs) 989
 991 RHADLPHRALRELAGKYGPLMMLRFGAVPTLVVSSAEAAREVLKTYDAAFASRYLTPTLA 1170
1171 VLSRGGRDILFSPYCDLWRQLRRICVHELLSARRVQSLRHVREDEAARLVRSVAAECAG 1347
1348 RGGAAVVSVGELISRAVNDSVVRSAVGARSARRDEFVRELDESVRLSGGFNLADLYPSSW 1527
1528 LARRLSCAMRETERCNRSLMAIMDDIIREHGDGEEDLLGVLLRLQRNGDVQCPL 1689
1690 TTDLITNVVL (0)
2513 DMFAAGSETSSTTLEWALTELVRNPHIMEKAQSEVREIFRGENKLTEEVMDKL 2671
2672 SYLRLVIRETLRLHLPVPFLLPRQCREPCSVMGYDIPVGTKVLVNAWAIARDNQYWDDPE 2851
2852 VFKPERFENNRVDFKGIDFEFIPFGAGRRICPGIALGLANIELMLASLLYHFDWEFLDRD 3031
3032 RNDEIDLSETFGITAKRKSKLMVYATQRIPCLG* 3133

>AC120537.1a chromosome 3 clone pseudogene fragment
2543 ARRVQSPRHVR*D*QAGYLVHAVVGECAPGGAGAVVPISEKISRMVNDSVVRPAIGSRCA 2364
2363 RRDEFLHVQARGLRQARGRVQLGRPVPIVVASELAQRRAAVGRPSVAAGAFARCGRPAET 2184
2183 FFNMDNLRTHDTYRKKNHSGNSQHCTAFSALSFSELQLKMTIWQSHHYKLPINLREIFS   
2006 SAGSETLNDTLVGNI*ANEKYPQVMQKAQTEVREKFRG*DKLIKDDMNRLSYLHL 1846
1845 VIQETLRLH 

>AL662933.1 $F OSJN00145 chromosome 4 63% to 99A1 sorghum 
86110 MEINSEATVTLVSVVTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSQPQVALRDLAGKYGP 85907
85906 VMFLRTGQVDTVVISSPAAAQEVLRDKDVTFASRPSLLVSEIFCYGNLDIGFAPYGAYWR 85727
85726 MLRKLCTVELLSTKMVRQLAPIRDGETLALVRNIEAAAGGKKPFTLATLL 85577
85576 ISCTNTFTAKAAFGQACGGELQEQFLTALDEALKFSNGFCFGDLFPSLRFIDAMTGLRSR 85397
85396 LERLRLQLDTVFDKIVAQCESNPGDSLVNVLLRIKDQGELDFPFSSTHVK 85247
85246 AIIL (0?)
84901 DMFTGGTETTSSTTEWLMSELMRNPEVMAKVQAEVRGVFDNKSPQDHEGLLENLSYMKLV 84722
84721 IKETLRLNPVLPLLLPHLCRETCEIGGYEIVEGTRVLINSWAMARSPEYWDDAEKFIPER 84542
84541 FEDGTADFKGSRFEYLPFGTGRRRCPGDIFAMATLELIVARLLYYFDWSLPDG 84383
84382 MQPGDIDMELVVGATARRKNHLQLVASPYKPISMQS* 84272

>AL713947.1 $F chromosome 12 clone MonsantoOJ1003_A04, 
MASGLWFLGISLAVLLLCYVGTNRRGDGQRPPGPRTLPIVGNLLDLRGGNLHHKL 
ASLAHAHGPVMTLKLGLVTTVFISSRDAAWEAFAKHDRRLAARTVPDTRRALAHAERSM 
VWLPSYDPLWKTLRSIAA (fs) 45837
45835 THVFSPRSLGVARSARERKVHDMVDSFRRRAGQEVDIGQVLYHGMFDLLANVLLSVD
AHPNLRDLMEDIVAILAKPNASDFFPLLRPLDLQGIRHWTAIHMSRVLHILDSIIDC 
RLAQGTDDQCKDVLDSLLVLMSTGKLSRRDVKILLFDILAAGTETTKITVEWAMAELL 
RNPNVMATTRAEMKAALGGNGTITEADVVNLPYLQAAVKESMRLHPVAPLLLPHLVVEDG 
VRIGGYAVSKGTTVIFNSWAIMRDSTAWERPDDFLPDRFLGKTELDLWGKQAKFIP 
LGSGRRLCPALPMVELVVPFTVASLLHAFEWHLPKGMSAEEVDVTERYTSNDILVMATPLKAVPLIVT* 

>AL713951.1 $F chromosome 12 clone Monsanto 
44616 MSLALLVLSAAYVLVALRRSRSSSSKPRRLPPSPPGWPVIGHLHLMSGMPHHALAELART 44437
44436 MRAPLFRMRLGSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCSDVTFAPAG 44257
44256 PYHRMARRVVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSECFLNLAND 44077
44076 VLCRVAFGRRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGLRRRLKKCL 43897
43896 ADLREACDVIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNLKALVL (0)
      DMFVAGTDTTFATLEWVMTELVRHPRILKKA 43537
43536 QEEVRRVVGDSGRVEESHLGELHYMRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPA 43357
43356 RTRVFINTFAMGRDPEIWDNPLEYSPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGY 43177
43176 TFALATVQVSLASLLYHFEWALPAGVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFK 42997
42996 GEELSEV* 42973

>aaaa01005413.1 $F (indica cultivargroup) ortholog to AL713951.1
5862 MSLALLVLSAAYVLVALRRSRSSSLKPRRLPPSPPGWPVIGHLHLMSGMPHHALAELARTMRAPLFRMRL
     GSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCSDVTFAPAGPYHRMARR
     VVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSECFLNLANDVLCRVAFG
     RRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGLRRRLKKCLADLREACD
     VIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNLKALVL (0) 4972
4875 DMFVAGTDTTFATLEWVMTELVRHPRILKKAQEE
4773 VRRVVGDSGRVEESHLGELHYMRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPARTR 4594
4593 VFINTFAMGRDPEIWDNPLEYSPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGYTFA 4414
4413 LATVQVSLASLLYHFEWALPAGVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFKGEE 4234
4233 LSEV* 4219

>AC105746.1 $F chromosome 10 55% to AC074105.1 chr 10 40% to 76C2
1115
      MSAFCWSATRSPSRQRLIENGFLFACKHHALTPARPLLPPLQ
31481 RIAAARRRLPPGPCPLPLIGNLLDIGXLPH
      RSFARLAERYGPLMTVRLGAATCVVASSPATARAV 31288
31287 LQTHNASLAGRGRQDAWHAGG
116306
102155 HAENSVFVLPPGRKWRLLRKLGAAHLFSRRKLAELAPLRDEIVGGLLRRVAERADHRGG 101979
101978 APVNVGRLALAANVELLWRSVFSTRLDAATLDVLCDVAREAAVLLGTPNVSDFFPA 101811
101810 VAALDLQGLRRRLAELMKNTYRLVDAQIDHRMRCRELRGGRGGEAMDLLDVLLDMSE 101640
101639 QEREDGDDEVINR
307504
101097 DLFVGGSDSTATTVEWAMAELLQNPEIMKTLQQEIKMVLGTRSQVEESDIGQL 100939
100938 PYLQAIVKETLRLHPIVPLRLYEAERTVEIEGHTIPKGSKVIVNAWAIHQSVKVWIQP 100765
100764 EKFLPKRFITKDIDFAGRHFEFIPFGSGRHICIGLPLANRMLHMILGSLMHQF 100606
100605 KWTMPQMVNRNGLDMAEKFGLAVSMATRPNIIA 100507

>AC078944.1 clone OSJNBa0089D15,9 unordered pieces STARTS 347 51% to 71C4
140438 PFQGLCS KGTFRLPAPVPRLLPGRACPSSDVAGYTLPSGARVLVYVWA WADSCVRGLVRE 140259
140258 NLCQCVFRVRSAFRGVRLELFHWGQVPVWPGIAPAA*LVH*GLGS 140124

>AQ256364.1 nbxb0016O01r BAC clone nbxb0016O01r 84% to 73A5 AU058037.1 
RRVMEQTGEIRCAMDHILEAERKGEINHDNVLYIVENINVA

>aaaa01002376.1 (indica cultivargroup) ortholog to AQ256364.1
899  MDALLVEKVLLGLFVAAVLALVVAKLTGKRLRLPPGPAGAPIVGNWLQVGDDLN 1060
1061 HRNLMALARRFGDILLLRMGVRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGKG 1240
1241 QDMVFTVYGDHWRKMRRIMTVPFFTNKVVAQNRAGWEEEARLVVEDVRRDPTAATSGVVI 1420
1421 RRRLQLMMYNDMFRIMFDRRFDSVDDPLFNKLKAFNAERSRLSQSFEYNYGDFIPVLRPF 1600
1601 LRRYLARCHQLKSQRMKLFEDHFVQERK 1684 (2)
3697 RVMEQTGEIRCAMDHILEAERKGEINHDNVLYIVENINVA 3816 (1)
4917 AIETTLWSIEWGIAELVNHPSIQSKVREEMASVLGGAAVTEPDLERLPYLQAVVKETLRLRMAIP 5093
5094 LLVPHMNLADGKLAGYDIPAESKILVNAWFLANDPKRWVRPDEFRPERFLEEEKAVE 5264
5265 AHGNDFRFVPFGVGRRSCPGIILALPIIGITLGRLVQSFDLLPPPGMDKVDTT 5423 
EKPGQFSTQILKHATVVCQ 
PIDA*

>AP004850.1a (japonica cultivargroup) chromosome 2 clone OJ1342_D02
32815 MAASVVRVAIATGASLAVHLFVKSFLQAQHPALTLLLPVAVFAGIAVGAKGGNGGDGKAP 32636
32635 PGPAAVPVFGNWLHVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ 32456
32455 GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM 32276
32275 DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS 32096
32095 RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRR 31952
31800 RNKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSK 31621
31620 VRAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIP 31441
31440 KGSKVVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCP 31261
31260 GIILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA 31090

>AP004850.1b (japonica cultivargroup) chromosome 2 clone OJ1342_D02
48977 MAASAMRVAIATGASLAVHLFVKSFVQAQHPALTLLLPVAVFVGIAVGAKGGSGGDGKAP 49156
49157 PGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLRLGVRNLVVVSDPKLATEVLHTQ 49336
49337 GVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRVMTLPFFTARVVQQYKAMWEAEM 49516
49517 DAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFDARFESVDDPMFIEATRFNSERS 49696
49697 RLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAFFNNNYVEKRR 49840
      NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAI 50094
50095 ETTLWSIEWALAEVVNHPAVQSKVRAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLH 50274
50275 SPIPLLVPHMNLEEAKLGGYTIPKGSKVVVNAWWLANNPALWENPEEFRPERFLEKESGV 50454
50455 DATVAGKVDFRFLPFGVGRRSCPGIILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKG 50634
50635 GQFSLHIAKHSVVAFHPISA 50694

>aaaa01006093.1a CYP73 (indica cultivargroup) 99% to AP004850.1b
6441 MAASAMRVAIATGASLAVHLFVKSFVQAQHPALTLLLP
6327 VAVFVGIAVGAKGGSGGDGKAPPGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLR 6148
6147 LGVRNLVVVSDPKLATEVLHTQGVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRV 5968
5967 MTLPFFTARVVQQYKAMWEAEMDAVVDDVRGDAVAQGAGFVVRRRLQLMLYNIMYRMMFD 5788
5787 ARFESVDDPMFIEATRFNSERSRLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAF 5608
5607 FNNNYVEKRR (2) 5578
5431 NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKV 5252
5251 RAEINDVLGDDEPITESNIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPK 5072
5071 GSKVVVNAWWLANNPALWENPEEFRPERFLEKESGVDATVAGKVDFRFLPFGVGRRSCPG 4892
4891 IILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA* 4721

>aaaa01006093.1b CYP73 (indica cultivargroup) 99% to AP004850.1a
11410 MAASVVRVAIATGASLAVHLFVKSFLQAQHPALTLLLP
11524 VAVFAGIAVGAKGGNGGDGKAPPGPAAVPVFGNWLQVGNDLNHRFLAAMSARYGPVFRLR 11703
11704 LGVRNLVVVSDPKLATEVLHTQGVEFGSRPRNVVFDIFTANGADMVFTEYGDHWRRMRRV 11883
11884 MTLPFFTARVVQQYKAMWEAEMDAVVDDVRGDAVAQGTGFVVRRRLQLMLYNIMYRMMFD 12063
12064 ARFKSVDDPMFIEATRFNSERSRLAQSFEYNYGDFIPILRPFLRGYLNKCRDLQSRRLAF 12243
12244 FNNNYVEKRR (2) 12273
12431 NKLRCAIDHILEAEKNGELTAENVIYIVENINVAAIETTLWSIEWALAEVVNHPAVQSKV 12610
12611 RAEINDVLGDDEPITESSIHKLTYLQAVIKETLRLHSPIPLLVPHMNLEEAKLGGYTIPK 12790
12791 GSKVVVNAWWLANNPALWENPEEFRPERFLEKESSVDATVAGKVDFRFLPFGVGRRSCPG 12970
12971 IILALPILALIVGKLVRSFEMVPPPGVEKLDVSEKGGQFSLHIAKHSVVAFHPISA* 13141

>CYP73A35P   Oryza sativa (rice) 
MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAA
LARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADPAAA 168 175 RRRLQLMMYSNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF
LRGYLRICEEVKETRLKLFKDFFLEERK (2?)
NGLKCAIDHILEAQQKGEINEDNVLYIVENINVA (1)
AIETTLWSMEWAIAEL 
VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNLRD
AELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNVEANGNDFRYLPSGA
GRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF*

>aaaa01004255.1 (indica cultivargroup) ortholog of 73A35P
16157 MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPV 16038
16037 PVFGNWLQVGDDLNHRNLAALARRFGDIFLLRMGQRNLVVVSSPPLAREVLHTQGVEFGS 15858
15857 RTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMTVPFFTGKVVQRHRAGWEAEAAAVVDG 15678
15677 LRADPA 15660 (fs)
15660 RRRL*LMMYNNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF 15481
15480 LRGCLRICEEVKETRLKLFKDFFLEERK
      KAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVA
15092 AIETTLWSMEWAIAEL 15045
      VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLP 14944
14943 YLQAVVKETLRLRMAIPLLVPHMNLRDAELAGYGIPAESKVLVNAWYLANDPGRWRRPEE 14764
14763 FRPERFLEEERHVEANGNDFRYLPSGAGRRSCPGIVLALPILGVTIGRLVQNFELLP 14593
14592 PPGKDRVDTTEKGGQFSLHILKHSTIVAKPRAF* 14491

>AP003261.1 $P chromosome 1 clone P0471B04, 
132381 MELAALCTDPVVLSAAFLCLLLNLSLCSYRPPSPGGGRRLPLGPPGVPVLGALPLVGPAPHADLASLARK 132172
132171 YGPIMYLKMGTCGVV 132127

>AP003214.3 $P almost identical to AP003227 related to CYP75
165814 MELAVLCTDPVVLSGPFLCLLLHLSLCSYR 165725 (2?)
157244 RPPSPGGGRRLPPD 157203  
157203 PPGVPVLDALPLVGPAPHTDLASLARKYGPIMYLKMGTCGVV 157078 
AASSPCAARAFL 157053

>AC021892.5 $F chromosome 10 clone OSJNBa0053D03 21 unordered pieces
62759 MDVVPLPLLLGSLAVSAAVWYLVYFLRGGSGGHAA
      RKRRPLPPGPRGWAVLGNLPQLGDKPHHTMCALGRQYGPLFRLRFGCAEVVEAATS 62487
62479 AAQFLRGHDANFSNRPPNSGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDL 62300
62299 RAVREGEVALMVRNLARQQAASVALGQEANVCATNTLARATIGHRVFAVDGGEGARE 62129
62128 FKEMVVELMQLAGVFNVGDFVPALRWLDPQGVVAKMKRLHRRYDNMMNGFINER 61967
61966 KAGAQPDGVAAGEHGNDLLSVLLARMQEEQKLDGDGEKITETDIKALLL
61786 NLFTAGTDTTSSTVEWALAELIRHPDVLKEAQHELDTVVG 61607
61606 RGRLVSESDLPRLPYLTAVIKETFRLHPSTPLSLPREAAEECEVDGYRIPKGATLLVNVW 61427
61426 AIARDPTQWPDPLQYQPSRFLPGRMHADVDVKGADFGLIPFGAGRRICAGLSWGLRMVTL 61247
61246 MTATLVHGFDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGV* 61085

>AC119149.2 Nipponbare strain, clone OSJNBb0079E01, from chromosome 10
74682 MEVAAMEISTSLLLTTVALSVIVCYALVFSRAGKARAPLPLPPGPRGWPVLGNLPQLGGK 74503
74502 THQTLHEMTKVYGPLIRLRFGSSDVVVAGSAPVAAQFLRTHDANFSSRPRNSGGEHMAYN 74323
74322 GRDVVFGPYGPRWRAMRKICAVNLFSARALDDLRAFREREAVLMVRSLAEASAAPGSSSP 74143
74142 AAVVLGKEVNVCTTNALSRAAVGRRVFAAGAGEGAREFKEIVLEVMEVGGVLNVGDFVPA 73963
73962 LRWLDPQGVVARMKKLHRRFDDMMNAIIAERRAGSLLKPTDSREEGKDLLGLLLAMVQEQ 73783
73782 EWLAAGEDDRITDTEIKALIL (0) 73720
65761 NLFVAGTDTTSTIVEWTMAELIRHPDILKHAQEELDVVVGRDRLLSESDLSHLTFFHAII 65582
65581 KETFRLHPSTPLSLPRMASEECEIAGYRIPKGAELLVNVWGIARDPAIWPDPLEYKPSRF 65402
65401 LPGGTHTDVDVKGNDFGLIPFGAGRRICAGLSWGLRMVTMTAATLVHAFDWQLPADQTPD 65222
65221 KLNMDEAFTLLLQRAEPLVVHPVPRLLPSAYNIA* 65117

>CONTIG OF C72003, C99202 34% to 76C4 91% to AP003623.1
ATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSSDPQWKA
LRGIHASHVFTPRVLAAVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTGILNMVS
FSYFSVDIVDMGSQMARELREVVDDIILVVGKPNVSDFYPFLRPLDLQGLRRW
TTKRFNRVFSIMGDIIDRRLAHIRDNKPRHDDFLDSILELXAAGKIDRVQVLNMLFEGF
2   FNAWAIMRDAAAWERPDEFVPERFVERTPQLDFRGKDVEFMPFGSGRRLCPGLPLAERVVP 184
185 FILASMLHTFEWELPGGMTAEELDVSEKFKTANVXAVPLKAVPVLIK* 328

>AP003623.1 $F chromosome 6 clone P0642B07 41% to 76C4 = AU095771
84245 MENSQVWLLWGALSVAVLFYLSTLRRRHAGGKPLPPGPTPLPLIGNLHLAGGTSFHHKLRDLAR 84436
84437 VHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSS 84616
84617 DPRWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLMAYLRAHAGEEVLLGQAMHTGLL 84790
84791 NLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWTTKRFNRVFSIMGDI 85006
85007 IDRRLAHIRDNKPSHNDFLDSLLELMAAGKIDRVNVLDMLFEAFVAGADTMALTLEWVMA 85186
85187 ELLKNPGVMAKARAELRDVLGDKEVVEEADAARLPYLQAVLKEAMRLHPVGALLLPH 85357
85358 FAVEDGVEVGGYAVPKGSTVLFNAWAIMRDPAAWERPDEFVPERFVERAPLLDF 85519
85520 RGKDAEFMPFGSGRRLCPGLPLAERVMPFILASMLHTFEWKLPGGMTAEDV 85672
85673 DVSEKFKSANVLAVPLKAVPVLIK* 85747

>aaaa01004667.1b $F (indica cultivargroup) ortholog of AP003623.1  
7298 MENSQVWLLWGALSVAVLFYLSTLRRRYAGGKPLPPGPTPLPLIGNLHLAGGTFHHKLR 7122
7121 DLARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVF 6942
6941 IPSSDPQWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLIAYLRAHAGKEVLLGQAMYTG 6762
6761 LLNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWT 6582
6581 TKRFNRVFSIMGDIIDRRLAHIRDGKPRHDDFLDSLLELMATGKMERVNVVNMLFEAFVA 6402
6401 GVDTMALTLEWVMAELLHNPAIMARVRAELSDVLGGKEAVEEADAARLPYLQAVLKEAMR 6222
6221 LHPVGALLLPHFAAEDGVEIGGYAVPRGSTVLFNAWAIMRDPAAWERPDEFVPERFLGRS 6042
6041 PPLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWKLPGGMTAEDVDVSE 5862
5861 KFKSANVLAVPLKAVPVLIK 5802

>aaaa01004667.1a $P (indica cultivargroup) Cterm 
1103 LHGGTTAEDVDVSEKFKSANVLAVPLQAVPVL 1008

>aaaa01008385.1 (indica cultivargroup) ortholog of C72003 contig
8309 TLKLGLATNVIISSREAAAEAYTKYDRHLAARATPDTFRACGFADRSMVFIPSSDPQW 8136
8135 KALRGIHASHVFTPRVLAAVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTGILNMVSFS 7956
7955 YFSIDIVGMGSRMARELREVVDDIIVVVGKPNVSDFYPFLRPLDLQGLRRWTTKRFNRVF 7776
7775 SIMGDIIDRRLAHIRDNKPRHDDFLDSILELMAAGKIDRVNVLNMLFEAFVAGADTMALT 7596
7595 LEWVMAELLKNPGVMAKARAELRDVLGDKEIVEEADAARLPYLQAVLKEAMRLHPVGALL 7416
7415 LPHFAMEDGVEVGGYAVPKGSTVLFNAWAIMRDPAAWERPDEFVPERFVERTPQLDFRGK 7236
7235 DVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWELPGGMTAEELDVSEKFKTANVL 7056
7055 AVPLKAVPVLIK 7020

>AP005114.1a (japonica cultivargroup) chromosome 2 clone P0689H05
BI813130.1 cDNA clone J002D01.Length = 497 75% to BI808700.1 68% to AP003623
BI813468.1 K008G06 Oryza sativa mature leaf library induced by M.grisea Oryza
sativa cDNA clone K008G06.Length = 474
best rice match AP003623.1 chromosome 6 63% clone P0642B07 41% to 76C4 = AU095771
26813 MEKLKSELWMTAVATCMSLLLYLTILRRRHASGGRSLALPPGPTPLPLIGNLLCLGGIFHQTLA 27004
27005 KLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARPVPDAFRANGFSERSIVF 27184
27185 SPSSDPQWKNLRGIHATHIFSPRALAALRGIRERKVRDIVGYIRTVAGEEMCVREVVHNG 27364
27365 VLNLISTSFFSMDMADVRSESARGLRGLIEDIIATVAGPNVSDFFPFLRQLDLQGLRRQT 27544
27545 GSHLGIVFGLLDDIIDRRMAETRDHPDKQRHGDFLDALISLASAGKIPRYHITYLLFDVF 27724
27725 AAGADTMTTTVEWAMAELLRNPRVMAKVRAEVTDALGGRESFDEGDAASLTYLQCVFKEA 27904
27905 MRLHPVGSILVPHLAVQDGVEIGGYAVPKGTTVIFNAWAIMRDPAAWESPDQFLPERFLH 28084
28085 KEESSSPPLELRGKDYEYIPFGSGRRLCPGLPLAERAVPFILASLLHAFEWRLPDGMSPD 28264
28265 DMDMTEKFATANVLATPLKAVPVASHTS* 28351

>aaaa01008405.1 (indica cultivargroup) top part of ortholog to BI813130.1
AAAA01075650.1 (indica cultivargroup) ortholog of BI813130.1 (4 diffs)
580 MEKLKSELWMTAVATCMSLLLYLTILRRRHASGGRSLSLPPGPTPLPLIGNLFCLGGIFH 401
400 QTLAKLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARPVPDAFRANGFSER 221
220 SIVFSPSSDPQWKNLRGIHATHIFSPRALAALRGIRARKVRDIVGYIRTVAGEEMCVREV 41
40  VHNGVLNLIST 8
ELLRNPRVMAKVRAEVMDALGGKESFDEGDAASLTYLQCVFKEAMRLHPVGSILVPHLAQ
QDGVEIGGYAVPKGTTVIFNAWAIMRDPAAWESPDQFLPERFLHKESSSPPLELRGKDYEYIPF 368
367 GSGRRLCPGLPLAERAVPFILASLLHAFEWRLPDGMSPDDMDMTEKFATANVLATPLKAV 188 (fs)
186 QSSHTSYIYSLRPKI* 139

>AP005114.1b (japonica cultivargroup) chromosome 2 
BI811079.1 clone K015D02.Length = 347 57% to AC087550.2 Chelix
120645 MEDNKLILALGLSVLFVLLSKLVSSAMKPRLNLPPGPWTLPLIGSLHHLVMKSPQIHRSL 120824
120825 RALSEKHGPIMQLWMGEVPAVIVSSPAVAEEVLKHQDLRFADRHLTATIEEVSFGGRDVT 121004
121005 FAPYSERWRHLRKICMQELLTAARVRSFQGVREREVARLVRELAADAGAGGDAGVNLNER 121184
121185 ISKLANDIVMVSSVGGRCSHRDEFLDALEVAKKQITWLSVADLFPSSKLARMVAVAPRKG 121364
121365 LASRKRMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVPVTDE 121544
121545 IIVVLLF (0) 121565
122803 DMFTGASETSPTVLIWILAELMRCPRVMAKAQAEVRQAAVGKTRITENDIVGLSYLKMVI 122982
122983 KEALRLHSPAPLLNPRKCRETTQVMGYDIPKGTSVFVNMWAICRDPNYWEDPEEFKPERF 123162
123163 ENNCVDFKGNNFEFLPFGSGRRICPGINLGLANLELALASLLYHFDWKLPNGMLPKDLDM 123342
123343 QETPGIVAAKLTTLNMCPVTQIAPSSAEDAS* 123438

>aaaa01013736.1 $F (indica cultivargroup) ortholog of BI811079.1 AP005114.1b
6446 MEDNKLILALGLSVLFVLLSKLVSSAMKPRLNLPPGPWTLPLIGSLHHLVMKSPQIHRSLRALSE 6252
6251 KHGPIMQLWMGEVPAVVVSSPAVAEEVLKHQDLRFADRHLTATIEEVSFGGRDVTFAPYS 6072
6071 ERWRHLRKICMQELLTAARVRSFQGVREREVARLVRELAADAGAGGDAGVNLNERISKLA 5892
5891 NDIVMVSSVGGRCSHRDEFLDALEVAKKQITWLSVADLFPSSKLARMVAVAPRKGLASRK 5712
5711 RMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVPVTDEIIVVL 5532
5531 LF (0) 5526
4289 DMFTGASETSPTVLIWILAELMRCPRVMAKAQAEVRQAAVGKTRITENDIVGLSYLKMVI 4110
4109 KEALRLHSPAPLLNPRKCRETTQVIGYDIPKGTSVFVNMWAICRDPNYWEDPEEFKPERF 3930
3929 ENNCVDFKGNNFEFLPFGSGRRICPGINLGLANLELALASLLYHFDWKLPNEMLPKDLDM 3750
3749 QETPGIVAAKLTTLNMCPVTQIAPSSAEDAS* 3654

>aaaa01004597.1a (indica cultivargroup) ortholog to BI808700.1 (3 diffs)
runs off end of scaffold
2   WAIMRDPTAWERPDEFMPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAERVVPFI 178
179 LASLLHAFEWRLPDGMSAEELDVSEKFTTANVLTVPLKAVPILASSASELQAS* 340

>aaaa01004597.1b $P (indica cultivargroup) missing Nterm 42% to 76C4
89% to Nterm of AU172561.1 6 diffs with BI808700.1
RRLPPGPTPLPVIGNVLSLRGNMHHALARLARERYGPVMA
LKLGLVTAVVVSSPDAAREAFTKHDRRLAARAVPDTSRVRGFADRSMIWLPSSDTRWKTL
RGVVATHVFSPRSIAAARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLVSNAFFS
GDVVDVGEESAHGLREAVEDIILAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYDTVFDIL
DNITNSRLADASAGNHAGDFLDSLLGLMSYGKIARDDVTTIMFDVFGAGTDTIAITVQWA
MAELLRNPSIMAKARTEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHQ
AAEDGVEIGGYAVPKGSTVIFNVWAIMRDPTAWERPDEF
MPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAERVVPFIL (2) 14530
Inverted orientation
ASLLHAFEWRLPDGMSAEELD 
Small deletion
14623 VTVPLKAVPILASSASELQAS* 14688

>aaaa01018916.1 $P (indica cultivargroup) missing Nterm, inverted seq at end
85% to Nterm of AU172561.1 4 diffs with BI808700.1
4748 RRLPPGPTPLPVIGDVLGLRGNMHHALARLARERYGPVMTLKLGLVTAVVVSSPGA 4581
4580 AREAFTRHDRRLAARTVPDISRARGLAGRSMIWLPSSDPRWKTLRGVVAAHVFSPRSLAA 4401
4400 ARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLVSNAFFSGDVVDVGEESAHGLRE 4221
4220 AVEDMISAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYDTVFDILDNITNSRLADASAGNH 4041
4040 AGDFLTPSLGLMSYGKIARDDVTTIMFDVFGAGTDTIAITVQWAMAELLRNPSIMAKART 3861
3860 EMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHQAAEDGVEIGGYAVPKG 3681
3680 STVIFNVWAIMRDPTAWERPDEFMPERFLQRAEVDFRGKDFEFMPFGAGRRLCPGLPMAE 3501
3500 RVVPFIL
ASLLHAFEWRLPDGMSAEELD
VSEKFTTANVLTVPLKAVPILASSASELQAS* 3321

>AP005254.1a (japonica cultivargroup) chromosome 8 = AF488522.1 PMII BI808700.1
59535 MERDAWLLCAALAAATVVYYLACTTSRRAQRRRLPPGPTPLPVIGNVLSLRGNMHHALARLARER 59341
59340 YGPVMALKLGLVTAVVVSSPDAAREAFTKHDRRLAARAVPDTSRVRGFADRSMIWLPSSD 59161
59160 TRWKTLRGVVATHVFSPRSIAAARGVRERKVRDIVGYFAAHVGEVVDVGEAVYSGVVNLV 58981
58980 SNAFFSGDVVDVGEESAHGLREAVEDIILAIAKPNVSDLFPFLRPLDLQGWRRWAEKRYD 58801
58800 TVFDILDNITNSRLADASAGNHAGDFLDSLLGLMSYGKIARDDVTTIMFDVFGAGTDTIA 58621
58620 ITVQWAMAELLRNPSIMAKARTEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAP 58441
58440 ILLPHQAAEDGVEIGGYAVPKGSTVIFNVWAIMRDPTAWERPDEFMPERFLQRAEVDFRG 58261
58260 KDFEFMPFGAGRRLCPGLPMAERVVPFILASLLHAFEWRLPDGMSAEELDVSEKFTTANV 58081
58080 LTVPLKAVPILASSASELQAS* 58015

>AP005254.1b $P (japonica cultivargroup) chromosome 8 
82126 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALARL 81947
81946 AGEHGPVMALKLGLVTTVVVSSAGAAREAFTKHDRRLAARAVPDTTRARGFASRSMIWL  81770
81769 PSSDPRWKTLRGVAATHVFSPRSLAAARGVRERKVRDIVGHLAGHAGEVVDVG (fs)   81611
      QVVYGGVLN 44 amino acids missing
81582 LRRLDLQGWRRWA (fs) 81544 
81542 EKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGTIARDDVTSIMYDL 81363
81362 FGAGTDTIAITVEWAMAELLRNPSVMAKARAEMNHVLAGKVKATEMEENDVEKLPYLQAV 81183
81182 VKEVMRLHPAAPILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPEEFMPE 81003
81002 RFLDMAEEVDFRGKDHKFMPFGTGRRLCPGLSMAKRVVPFILASLLHAFEWRLPAGVTAE 80823
80822 ALDLSEKFTTVNVLVTPIKAIPILASDEI* 80733

>aaaa01013893.1 $P (indica cultivargroup) pseudogene (gap in sequence)
3 diffs with Nterm of AU172561.1 93% to Cterm of AU172561.1
ortholog of AP005254.1b (5 diffs)
3604 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALERL 3783
3784 AGEHGPVMALKLGLVTAVVVSSAGAAREAFTKHDRRLAARAVPDTTRARGFASRSMIWL 3960
3961 PSSDPRWKTLRGVAATHVFSPRSLAAARGVRERKVRDIVGHLAGHAGEVVDVGKVVYGGV 4140
4141 LNL 44 amino acid gap
     RRLDLQGWRRWAE 4188
4189 KRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGTIARDDVTSIMYDLF 4368
4369 GAGTDTIAITVEWAMAELLRNPSVMAKARAEMNHVLAGKVKATEMEENDVEKLPYLQAVV 4548
4549 KEGMRLHPAAPILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPEEFMPER 4728
4729 FLDMAEEVDFRGKDHKFMPFGTGRRLCPGLSMAKRVVPFILASLLHAFEWRLPAGVTAEA 4908
4909 LDLSEKFTTVNVLVTPIKAIPILASDQI* 4995

>AP005254.1c (japonica cultivargroup) chromosome 8 = AF488521.1 PMI
1 diff with BM038607.1 = AP005245.1 1519016707
103909 MEREAWLLCAALAAAMVYYYYYYLACTTRRAQRRLPPGPTPLPVIGNVLSLSGDMHHEL 
104086 ARLAREQYGPVMTLKLGLFTAVVVSSPDAAREAFTKHDRRLAARTVPDISRARGLTGRSM 
104266 IWLPSSDPRWKTLRSAVATHFFSPRSLAAARGVRERKVRDIVNYFAGHAAEVIDVGEAVY 
104446 GGVINIVSNAFFSADVVDVGKESAHGLRETLEDIILAIAKPNVSDLFPFLRRLDLQGWRR 
104626 WAEKRYDKVFGILDDKINSRLADADADASTKKHGDFLDSLLELMSAGKIACDDVTTVMFD 
104806 AFGAGTDTISNTVVWAMAELLRNPSIMAKVRAEMEDVLAGKKTIEENDTEKLPYLRAVIK 
104986 EAMRLHPVAPILLPHRAAEDGVEIGGYAVPKGSTVIFNVWTIMRDPAAWERPEEFMPERF 
105166 LQRAEVDFRGKDFEFIPFGAGRRLCPGLPMTERVVPFILASLLHAFEWRLPVGVAAETLD 
105346 LSEKFTTVNVLVTPLKAIPILASHQI* 105426

>AAAA01000493.1 Ortholog of AP005254.1c with small gap in I helix
3400 ADASTKKHGDFLDSLLELMSAGKIACDDVTTVMFDAFGA 3516
3509 SELLRNPSIMAKVRAEMEDVLAGKKTIEENDTEKLPYLRAVIKEAMRLHPVAPILLPHRA 3688
3689 AEDGVEIGGYAVPKGSTVIFNVWTIMRDPAAWERPEEFMPERFLQRA-EVDFRGKDFEFI 3865
3866 PFGAGRRLCPGLPMTERVVPFILASLLHAFEWRLPVGVAAETLDLSEKFTTVNVLVTPLK 4045
4046 AIPILAS 4066

>AP005254.1d (japonica cultivargroup) chromosome 8 aa 227-504
GGVLN
110436 LRRLDLQGWRRWAEKRYDKVFGIFDSVINSRLADASTGKHADAGAGDFLDSLLDLMSAGK 110257
110256 IARDDVTSIMFDLFGAGTDTIAITVEWAMAELLRNPSVMTKARAEMNHALAGKKTIEEND 110077
110076 VEKLPYLQAVLREAMRLHPAAPILVPHRAEEDGAEIGGYAVPKGSTVIFNVWAIMRDPAA 109897
109896 WERPEEFMPERFMDMAEEVDFRGKDYKFIPFWAGRRLCPGLLMAERVVPFILASLLHSFE 109717
109716 WRLPGGMTAESLDLSEKFTTVNVLVTPLKAIPILASKNENIRE* 109585

>AU172561.1 clone E2548.Length = 362 similar to AC092559.2 opposite end = AU0172562
68 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALARLA
   GEHGPVMALKLGLVTTVVVSSAGAAREAFTKHDRALG 361
MEENDVENLPYLQPVKEVMRLHPA
APILVPHRAEEDDAEIGGYAVPKGSTVIFNVWAIMRDPVAWERPKEFMPKRFLDMAEEVDFRGKDHKFMPFGTGRRLCPGLSMAKR
VVPFILASLLHAFEWRLPAGVTTEALDLNEKFTTVNVLVTPIKAIPILASDQI*

>aaaa01076605.1 (indica cultivargroup) ortholog of AU172561.1 (1 diff)
423 MESEVCWLLCAALAAAMACYYLTGTMRRRSRRLPPGPTPLPVIGNVLSLRGNMHHALARL 602
603 AGEHGPVMALKLGLVTTVVVSSAGAAREAFTKHDRRLAARAVP 731

>AU173996.1 (partial) cDNA clone S12633. Length = 451 New seq 
12  EVDXWGKTFEFIPFGSGRRVCAGLPMAERVVPFMLASLLRAFEWRLPDGVSAEELDM
RXRFTIANFRAIPXKAVPVVVS*

>aaaa01003137.1 $F (indica cultivargroup) ortholog to AU173996.1
2741 MDVNQLWLLWATLAVSLLYYISNRRRRVGGRRRCPPGPMPLPLVGNLLNLRGHLPPALAR 2920
2921 LARTYGPVMMLKMGLTTTVVISSGDAAREAFTKHDRHLAARTVLDVTRSLDFADRSMIWL 3100
3101 PSSDTVWKTLRGVTAASIFSPRGLAALRGVRESKVRDLVGYFRGRAGEVVDVRHAVYGCM 3280
3281 LSLVSSAFFSVDVVDLSAESENEFRQSMTFLMEVVSKTNVSDFFPFLRPLDLQGWRRLTE 3460
3461 RYLGRVTCFLDDVIDRRFAADASANRHGDFLDSLLDLVSTGKIVRENVTTILLDVFIAGS 3640
3641 DTITATVEWAMAELLRNPSEMAKVRAEMDGALGGKKTVDEPDIARLPYLQAVVKEAMRLH 3820
3821 PAAPLLLPHRAVEDGVEVGGYCVPKGSMVIFNVWAIMRDPAAWERPEEFMPERFIRRGDD 4000
4001 DEVDFWGKTFEFIPFGSGRRVCAGLPMAERVVPFMLASLLRAFEWRLPDGVSAEELDMRH 4180
4181 RFTIANFRAIPLKAVPVVVS* 4243

>AP003267.1 $F chromosome 1 clone P0496H05
55979 MEKSSELWLLWAVFSASLVFLYLTIRRRSGAGAGGKPPLPPGPTPLPLIGNLLDLRGGVIHDKLAALARVYG 55764
55763 PVMMIKLGLNDAVIISSRDAAREAFTRYDRHLAARAIPDTFRANGFHERSAVFLPSSDER 55584
55583 WKALRGIQGTHIFTPRGLAAVRPVRERKVRDIIAYFRDHAGEELVIRQAIHTGVLNLVSS 55404
55403 SFFSMDIAGMGSETARELREHVDEIMTVFAQPNVSDYFPFLRRLDLQGLRRSTKRRFDR 55227
55226 IFSILDDIVERRLVDRGERGGEGGASSNSSKSKHQYDGGDFLDALLELMVTGKM 55065
55064 ERDDVTAMLFEAFVAGGDTVAFTLEWVMADLLRNPPVMAKLRAELDDVLGGKDQSAIEEH 54885
54884 DAGRLPYLQAVLKESMRLHSVGPLLHHFAAEDGVVVGGYAVPRGATVLFNTRAIMRDPAA 54705
54704 WERPEEFAPERFLAREGKAPVDFRGKEADFIPFGSGRRLCPGIPLAERVMPYILALMLRE 54525
54524 FEWRLPDGVSPEELDVSEKFMSVNVLAVPLKAVPVKVIN* 54405

>AC078944.5 $P clone OSJNBa0089D15 large insertion probably makes this a pseudogene
92923  MASFLPWLPWLLAALLSVYLLDLLAHSRRLLPPGPRPLPLIGSLHLLGDQPHRSLAGLAK 93102
93103  MYGPLMSLRLGAVTTVVVSSPDVAREFLQRHNAAFASRSVPDATGDHATNSVAWLPNSPR 93282
93283  WRALRRIMAAELFAPHRLDALRRLRREKVQELVDHVARLAEREGGAAAVDVGRVAFATSL 93462
93463  NLLSSTIFSRNLTSLDDHGESMEFKEVVVEIMEAGGCPNVSDFFPAIAAADLQGWRRRMA 93642
93643  GLFARLHRVFDAVVEERLSERDAGEARKGDFLDVLLDVAARDNDSAGLDRDTLRSLFT   93816 (0)
103281 DLFAAGSDTSPSIVEWAIAELMRNPLCMIRAC 103376 
113843 DELSQVIGSGTNIEESDIGQLPYL 113914
113915 QAVVKETFRLHPPVPLLLPRQAETTTNIAGYTIPKGARVFVNVWAIGRHK 114064
114065 DTWSQPEKFMPERFFERNIDFRGVHFELIPFGAGRRICPRMPLANRMVHLVLGSLLNQFK 114244
114245 WNLPVDIERNGIDMSEKFGLTLVKAIPLCALVTPISVESGDH* 114373

>AC078944.5 $F clone OSJNBa0089D15 47% TO AJ237995.1 Vitis vinifera 76F2 45% to 76C3
145298 MATWILGWLLWLPVFLISLYLVDILAHSCRRLPPGPRPLPFIGSLHLLGDQPHRSLAGLAKKYGP 145492
145493 LMSLRLGAVTTVVVSSPEVAREFVQKHDAVFADRSIPDSIGDHTKNSVIWLNPGPRWRAL 145672
145673 RRIMATELFSPHQLDALQQLRQEKVAELVDHVARLAREGAAVDVGRVAFATSLNLLS 145843
145844 RTIFSRDLTSLDDRGASREFKQVITDIMEAAGSPNLSDFYPAIAAVDLQGWRRRCARLFT 146023
146024 QLHRLFDDEMDHRKLHSRHGGPGENGKEKDDFLEVLLRLGARDDDIAGLDGDTLRSLF 146197 (0)
150187 DLFAAGSDTSSSTIEWAMVELLKNTLSMGKACDELAQVVGSRRRIEESEIGQLP 150348
150349 YLQAVIKETLRLHPPVPLLPHRAKMAMQIMGYTIPNGTKILINVWAIGRD 150498
150499 KNIWTEPEKFMPERFLDRTIDFRGGDLELIPFGAGRRICPGMPLAIWMVHVVLASLLIH 150675
150676 FKWRLPVEVERNGIDMTEKFGLTLVKAIPLCALATPT* 150789

>AC116603.1 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10, 
41763 MAALLLWLSWLLLSLLSIYLLDLLAHSRRCLPPGPRPLPLIGSLHLLGDLPHRSL 41605
41604 AGLAKTYGPLMSLRLGAVTTVVASSPEVAREFLQKHDAVFATRSTPDATGDHARNSVAWL 41425
41424 PPGPRWRELRKIMATELFSTRRLDALHELRQEKVAELVDHVAGLARDGTAVDIGRVAFTT 41245
41244 SLNLVARTIFSHDLTSLDDHGASKEFQRLITDVMEAVGSPNLSDFFPALAAVDLQGWRRR 41065
41064 LSGLFARLHRLFDAEMDHRRLHGMKEKDGDFLEVLLRLAARDDDTARLDGDTLRSLFT 40891
39623 DLFTAGSDTSSSTVEWAMAELLQNPISMAKLCDELRRVVGSRRRIEESEIGQLPYLQAVI 39444
39443 KETFRLHSPAPLLLPRQATRTIQIMGYTIPKGTRVLINVWAMGRDEDIWPEAGKFIPERF 39264
39263 LERTIDYKGGDLELIPFGAGRRICPGMPLAVRMVHVLLASLLIHFKWRLPAEVEGNRIDM 39084
39083 TEKFGVTLAKANHLCAMAAPT* 39018

>AC116603.1 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10 
12419 ALFLWLSWLVLSLLSIYLLDLLAHSRRRLPPGPRPLPLIGSLHLLGDQPHRSL 12261
12260 AGLAKTYGPLMSLRLGAVTTVVVSSPDVAREFLQKHDAVFATRSAPDAAGDHTRNSVPWL 12081
12080 PPGPRWRELRKIMATELLATHRLDALHELRQEKVSELVDHVARLARDGAAVDVGRVAFTT 11901
11900 SLNLLSRTIFSRDLTSLDDRGASKEFQQVVTDIMGAAGSPNLSDFFPALAAADLQGWRRR 11721
11720 LAGLFERLHRVFDAEIEHRRRVAGEEHGKVKDDFLRVLLRLAARDDDTAGLDDDTLRS 11547
11546 VFT 11538

>AC116603.1 Nipponbare strain, clone OSJNBb0015J03, from chromosome 10 
9109 MACALSLLSVYLLDLLAQSRRRLPPGPHPLPLIGSLHLLGDQPHRSLAGLAKTYGPLM 8936
8935 SLRLGAVTTVVVSSPDVAREFLQKHDAVFATRSAPDASGDHARNSVALLPNSPRWRELRK 8756
8755 IMATELFSTSRLDALHELRQEKVVELVDHVARLAREGAAVDVGRVAFTTSLNLLSHTIFS 8576
8575 RDLTSLDDHGASKEFQQVVTDIMGAAGSPNLSDFFPALAAADLQGWRRRLAGLFERLRRV 8396
8395 FDAEIEHRRRVVGKEHGKVKDDFLRVLLRLAARDDDTAGLHDDALQSIFT 8246
6711 DLFAAGSDTSSSTVEWAMAELLRNPLPMAKACDELQRVIGSTRRIEESDIGRLPYLQ 6541
6540 AVIKETFRLHPPVPFLLPRQATTTIQILGYTIPKGAKVFINVWAMGRDKDIWPEAEKFMP 6361
6360 ERFLERATDFKGADFELIPFGAGRRICPGLPLAVRMVHVVLASLLINFKWRLPVKVERDG 6181
6180 VNMTEKFGVTLAKAIPLCAMATST* 6106

>aaaa01019517.1 (indica cultivargroup) ortholog to AQ869312.1
4547 ALLPWLPWLLAALLSVYLLDLLAHSRRRLPPGPRPLPLIGSLHLLGDRPHRSL  (fs)
4373 PHHSLAGLAKKYGPLMSLRLGAVTTVVASSPEVAREFLQKHDAVFATRSTPDATGD 4206
4205 HARNSVAWLPPGPRWRELRKIMATELFSTRRLDALHELRQEKVAELVDHVARLARDGTAV 4026
4025 DIGRVAFTTSLNLVARTIFSHDLTSLDDHGASKEFQRLITDVMEAVGSPNLSDFFPALAA 3846
3845 VDLQGWRRRLSGLFARLHRLFDAEMDHRRLHGMKEKDGDFLEVLLRLAARDDDTARLDGD 3666
3665 TLRSLFT (0?) 3645
2339 DLFTAGSDTSSSTVEWAMAELLQNPISMAKLCDELRRVVGSRRRIEESEIGQLPYLQAVI 2160
2159 KETFRLHSPAPLLLPRQATRTIQIMGYTIPKGTRVLINVWAMGRDEDIWPEAGKFMPERF 1980
1979 LERTIDYKGGDLELIPFGAGRRICPGMPLAVRMVHVLLASLLIHFKWRLPAEVEGNRIDM 1800
1799 TEKFGVTLAKANHLCAMAAPT* 1734

>AP004183.1 $P chr 8 clone OJ1221_H04, Pseudogene 74% to AC078944.1 118250117423
51271 MAFLFPSLLLPWLPWLLGSLLSVYLLDLLAHSRRRLPPGPRPLPFIGSLHLLGDQPHRSLAALAMAYG 51068
51067 PLMSLRLGAVTTVVASSPAVA 51005 
51003 REILHRHDAAFASRPRGDSTG 50962 
NHARE PVAWPAHNAPGWGA LR
      RIMATELFAPQPVDSGRPGRLRREKCRSCAHTPKVGARQGGKAAGVD 50738 
50467 GRVAFATSLNLLSRTIFSRDLTSLDDP 50387 
50385 GGSKGFQEAVARIMEAGGRPNVSDFFPVLAAADLQGWRRRLARLFARLHRVFDAEVDAR 50209
50208 LREHDAGEARKGDFLDVLLGIAARRDDAAELDRDTLRSLFT 50086 (0)
45752 DLFCAGSDTSSSTVEWAMAELMQNPKSMSRVCDELSQVIGLGRNIKESEIGQLPYLQ 45582
45581 AVVKETFRLHPPAPLLLPRQAEMTMKIAGYTIPKGTRIFVNVWAMGRDKDIWPEPEKFIP 45402
45401 ERFLGSKIDFKGVHFELIPFGAGRRICPGMPLANRMVHLILGSLLNQFKWNLPVKVERNG 45222
45221 IDMSEKFGLTLAKATPLCALVTPISVKPADHQE* 45120

>AC074105.1 $F chr 10 clone OSJNBa0030B02 39% to 76F2 40% to 76C2
60125 MAIFIGCICS
60095 LALLLLCSHVFQLLSDARRRLPPGPRPLPVIGNLLDVAGELPHRSLACVAERYGPL 59928
59927 VTLRLGTMLAVVASSPATARDVLHRHGASITDRGTPDAWSTDGHDGNSIFAFPTRHHRWR 59748
59747 ALRRLGAEQLFSPRRVEEQRPLRRDAVRGLLRHVAELAAASGGGGAAVVDVGRAAFAAMA 59568
59567 SLLFGALFSAGIDAATSCRFRDAAREFALLTMTPNVSEFFPVVAMADLQGL 59415
59414 RRRTARHITWMYQLIDGHVERRMRGRETAGGCGAAHGEKEKDLLDVMLDMSEKEEQNDD 59238
59237 SSLTMN 59220
57988 DLLMAGSETSSAVIEWAMAELLQNPQTMTKLQEELKKVIGSKTCIDEEDIDQLPY LQAVI 57809
57808 KETHRLHPAIP LLMYKAAVPVEIQGYKIPKETTVIVNTWAIHQNSEVWIEPDKFIPERF 57632
57631 LQKEISLSSGSTNMELIPFSAGRRFCLGYPVANRMLHVMLASLVHQFQWTLPEVVKKN 57458
57457 GGVDMAEKFGITLSMATPLHAIAKNIV* 57374

>AC074054.1 $P chromosome 10 clone OSJNBa0090A14 gene 2 41% to 76F2 42% to 76C4
56068 MAFFLPLAFSLFLAVISAYVLQLLADARRRL 
      PPGPWPLPLIGNLHQLDHLPHRSLARLAARHGPLMSLRLGTVRAVVASSPEMAREVLQRH 55796
55795 NADIAARSFGDSMRAGGHCENSVVCLPPRRRWRALRRLSTVGLFSPRRLDAMRALLEEKV 55616
55615 AELVRRVSGHAARGEAVDVGHAAHVAALGVLSRTMFSVDLDPEAAREVSDIVDEASVL 55442
55441 GTGPNVSDFFPAIAPADLQGVRRRMARLVKRMYAIIDEQIERRMHGRTAGEPRKNDLL 55268
55267 DVMLEEGESKEDSNEINRDAIRGL 55196
54837 DLFTGGETTSHTMECAMAELLQCPNSMRRVHELKSVIGSKQQMDEHDITKLPY 54679
54682 LPPYEAEATIEIQGYTIPKGAKVLINLWAINRCANTWTEPDKFMPERFYDSDITFMGRDF 54503
54502 QLIPFGAGKRICLGLPLAHRMVHLMLGSLLHRFTWTLPAEAGKNGVDMRERFGLTLSFVAPLYVIAQEIQ* 
54290

>AC074054.1 $F chromosome 10 clone OSJNBa0090A14 gene 1
21949 MAFFHLCISSLLLVFIISYIFQPLLDARRRFPPGPHRLPVISNLHNIGKNPHHAFARLADRYGPLM 21752
21751 SIRLGGVRAVVAMSADAAREILQRNNADITGRGGMDSWHACGHHANSSIALWPRWKWCA 21575
21574 MRMLCTEELL 21545
5536 GVTHAMREEVARELAHRVSDGSAGGMPVSVAREAFAAVAGVLWWSMFSEDMDAATTRQLRDVIE 5345
5344 EAVVVAGAPNLSDYFPVIAAADVMGVRRRMDNLVGWVYGIIDVQIDRRRRRRIVCEPRKN 5165
5164 DLLDVAFDMEGEVESEGWVMNQDTMRGM 5081
4770 AIYQDLLVAGSGSTSSTIEWAMAELLQNPKSMIQLPEELKGLMGTKTHVAESDISQLPYL 4591
4590 QAVIKETLRLHPTVPIAFNKAEATVEIQGYKIPQGTTVYVNIWAICRRAKIWDDLDKFM 4414
4413 PYRFLGRDINFLGTNFEFIPFGAGRRICLGMPLAEGML 4300
4291 HLMLASLLHRFEWTIPDEVKGDDLDMAEEFGLVLSMAKPLRAVAKET* 4148

>AC118672.1a $F (japonica cultivargroup) chromosome 3 
20322 MELLLLYAPCVILLVSSLYLLRLFSDARRNLPPGPRPLPLVGNLLELGAKPHRSLARLAE 20501
20502 RHGPLMTLRLGAVTTIVASSPDAARDILQRHDAAFSTRPVPDIVRACGHDRFAMPWLPPS 20681
20682 SPQWRALRKVCSAELFAPRRLDAQQRLRREKARRLVSHVARMAREGAAVDVRRVVFTTLL 20861
20862 NMLSCTLFSADLADLDEGRAGSAGELADTVAEFAGTVGVPNVVDYFPAVAAFDPQRLRR 21038
21039 WLSRVFTRLFAEFDEQIERRMRERDAGEPPKNDFLDVLLDYRTTEDGRQFDRQTLRSRFT 21218
21879 DLFSAGSDTSAVTVEWAMAQLLQSPSSMMKAREELTRVIGSKPEIDESDIDSLEYLQAVV 22058
22059 KETFRLHPPAPLLLSHRAETDTEIGGYTVPKGATVMVNIWAIGRDSKVWFEPDKFIPERF 22238
22239 LQKEVDFRGRDFELIPFGSGRRICPGLPLAVRMVHLMLASLLHRFEWRLLPEVERNGVNM 22418
22419 EEKFGIVMTLATPLQAIATPI* 22484

>AC118672.1b $F (japonica cultivargroup) chromosome 3 (3 frameshifts)
C72289       63% to 76C2 337453 region clone E1370 like AC078944
AU093938.1 Rice panicle cDNA clone E1370. Length = 642 43% to 77A4
BE230674.1 99AS896 Rice Seedling cDNA Library cDNA clone 99AS896.
BI813139 cDNA clone J002F10.Length = 569 = C72289
29723 MELLLLCTPCVILLLSSLYLLRLFVDARRNLPPGPRPQPLIGNILDLGSQPHRSLARLAG 29902
29903 RYGPLMTLRLGTVTTVVASSPGAARDILQRHDA 30001 (fs)
30003 AFSARSVPD 30029 (fs)
30031 AARACGHDGFSMGMLPPTSALWRAL 30105 (fs)
30107 RRVCAAELFAPRSLDAHQRLRRDKVRQLVSHVARLARDGAAVDVGRAAFTA 30259
30260 SLNLLSSTIFSADLADFGDARAESSVGDLRDLISEFTIVVGVPNVSDFFPAVAPLDPQRL 30439
30440 RRRVARVFERLQAVFDGHIERRLRDRAAGEPPKNDFLDALLDYRSPEDGRGFDRPTLQFLFT (0) 30625
      DLFSAGSDTSAVTVE 30799
30800 WAMAQLLQNPPAMAKAREELARVIGSKQEIEESDISQLKYLEAVVKETLRLHPPAPFLLP 30979
30980 HQAETTTQVGGYTVPKGTRVLVNVWAIGRDSKVWSDPDKFMPERFLQSEVDLRGRDFELI 31159
31160 PFGSGRRICPGLPLAVRMVYLMLASLLHRFEWRLLPEVEKNGVDMAEKFGMILELATPLR 31339
31340 AVAIPV* 31360

>aaaa01001667.1a (indica cultivargroup) ortholog of AC118672.1b
3640 MELLLLCTPCVILLLSSLYLLRLFVDARRNLPPGPRPQPLIGNILDLGSQPHRSLARLAGRYGPLMTL 3437
3436 RLGTVTTVVASSPGAARDILQRHDAAFSARSVPDAARACGHDGFSMGMLPPSSALWRALR 3257
3256 RVCAAELFAPRSLDAHQRLRRDKVRQLVSHVARLARDGAAVDVGRAAFTASLNLLSSTIF 3077
3076 SADLADFGDARAESSVGDLRDLISEFTIVVGVPNVSDFFPAVAPLDPQRLRRRVARVFER 2897
2896 LQAVFDGHIERRLRDRAAGEPPNNDFLDALLDYRSPEDGRGFDRPTLQFLFT (0)
     DLFSAGSDTSAVTVEWAMAQLLQNP 2537
2536 PAMAKAREELARVIGSKQEIEESDISQLKYLEAVVKETLRLHPPAPFLLPHQAETT 2369 (fs)
2367 TEIRGYTVPRGARVLVNVWAIGQDPELWPEPEVFTPERFLEKEMDFRGKDFELLP*GSGR 2188
2187 RVCPGLPLAVRMVHLMLASLLHRFEWRLLPEVEKNGVDMAEKFGMILELATPLRAVAIPV* 2005

>aaaa01001667.1b (indica cultivargroup) ortholog of AC118672.1a
11859 MELLLLYAPCVILLVSSLYLLRLFSDARRNLPPGPRPLPLVGNLLELGAKPHRSLARLAERHGPLMTL 11656
11655 RLGAVTTIVASSPDAARDILQRHDAAFSTRPVPDIVRACGHDRFAMPWLPPSSPQCRALR 11476
11475 KVCSAELFAPRRLDAQQRLRREKARRLVSHVARMAREGAAVDVRRVVFTTLLNMLSCTLF 11296
11295 SADLADLDEGRAGSAGELADTVAEFAGTVGVPNVVDYFPAVAAFDPQRLRRRLSRVFTR 11119
11118 LFAEFDEQIERRMRERDAGEPPKNDFLDVLLDYRTTEDGRQFDRQTLRSRFT (0) 10963
10235 DLFSAGSDTSAVTVEWAMAQLLQSPSSMMKAREELTRVIGSKPEIDESDIDSLEYLQAVV 10056
10055 KETFRLHPPAPLLLSHRAETDTEIGGYTVPKGATVMVNIWA 9933

>AL731641.1 $F chromosome 4 clone OSJNBa0042I15 CYP77A = AU070007 
42403 MQPTWLATMPAASSLVVGVAFTAAVAVAVAAAVARRAWRHRGLRLPPGPPGWPVVGNLLQ 42582
42583 VVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESP 42762
42763 IRSIFSSGKFTVNSAVYGPEWRSLRRNMVSGMLSAARLREFRPARLRAMERFVARVRAEA 42942
42943 AASRDGASVWVLRNVRFAMFCVLLDMTFGLLDLDEELVVRVDAVMKRVVLAVAARIDDYL 43122
43123 PFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPYSYLDSLL 43302
43303 DLRVEGRDAVPTDEELVTLCAEMINGGTDTTATAIEWAMARVMDNPSIQARLHGEIMQRV 43482
43483 GDARPVDDRDTEGMPYLKAFVKELLRKHPPTYFALSHAAVEPGSKLAGYDVPVDANLDIF 43662
43663 LPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVRMIPFSAGRRICPGVGMGTAHIA 43842
43843 LMVARMVQAFEWRAHPSQPPLDFEDKVEFTVVMKRPLLAMVTPRKLSF* 43989

>aaaa01021406.1 (indica cultivargroup) ortholog of AU070007 (1 diff)
runs off end 53% to 77A4
AAAA01011465.1 (indica cultivargroup) Cterm of CYP77A 
2975 MQPTWLATMPAASSLVVGVAFTAAVAVAVAAAVARRAWRHRGLRLPPGPPSWPVVGNLLQ 3154
3155 VVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESP 3334
3335 IRSIFSSGKFTVNSAVYGPEWRSLRRNMVSGMLSAARLREFRPARLRAMERFVARVRAEA 3514
3515 AASRDGASVWVLRNVRFAMFCVLLDMTFGLLDLDEELVVRVDAVMKRVVLAVAARIDDYL 3694
3695 PFLRPFLWRQHRQAVALRREQIDTVLPLINRRRAIVRGMRAGSPPDPAVAAPY 3853
aa 294338 missing
8908 LARVMDNPSIQARLHGEIMQRVGDARPVDDRDTDGMPYLQAFVKELLRKHPPTYFALSHA 8729
8728 AVEPGSKLAGYDVPVDANLDIFLPTISEDPKLWERPTEFDPDRFLAGGETADITGSAGVR 8549
8548 MIPFSAGRRICPGVGMGTAHIALMVARMVQAFEWRAHPSQPPLDFEDKVEFTVVMKRPLL 8369
8368 AMVTPRKLSF* 8336

>AA751892      52% to 78A5     1/98 469519 REGION
RXVCPGRMMGLSTAYLWFGRMLQEYKWAAAQPVKLTECLRLSMEMXKPLVCHAVPRXKTG*

>aaaa01012488.1 $F (indica cultivargroup) CYP78A ortholog of AA751892
5682 MRNEVLSTIFLLLIFFTTTINPSSSQLPWLFSLLYLSLAMAVVALPPLLAKRHGHARRVN 5503
5502 GGGAAIPGPRGWPLLGSLPAVSGPLMHRRLAALAYAHGGGARRLMSLTLGATPVVVSSHP 5323
5322 DTAREILAGAAFRDRPARAAARELMFLRAVGFAPAAGDDGGAYWRRLRRAAGAGMLSPRR 5143
5142 AAALAALRARVARRTSEAVSRGMAVPPGRVAMRALLHAASLDNMVGSVLGLEHHDHHGGV 4963
4962 ISDMGDMVREGYELVGKFNLGDYYSTTQYQCLWGLLDFHGVGPRCQRLAARVREQFGRVM 4783
4782 EERRKVSDLHKRDDLLSYMLSMPQEERIEDSDVIAVLW (0) 4669
3107 EMIFRGTDVVAILLEWAMARMVLHPDIQSKVQEELDRAVGHRPMTDSDIPSLRFLHCVIK 2928
2927 ETLRMHPPGPLLSWARLAVHDTYVGKHLVPAGTTAMVNMWAISHDETIWGDPWVFRPERF 2748
2747 MEEDINVLGSDLRLAPFGSGRRVCPGRMMGLSTSYLWFGRMLQEYKWSPAQPVKLTECLR 2568
2567 LSMEMKKPLVCHAVPRSKTG* 2505

>AC097276.6 chromosome 3 57% to 78A2 Ortholog of aaaa01023161.1 98% lower case
44847 MVSFYLDSTFLPLLATTMASPLHACLLLALLFLALAFFHPGGVAWALSSSGGHGAAAIPG 45026
45027 PRGVLLAFAGPNPHRALASLAASTRGATRLMAFSVGLTQFVVASHPDTAREILAGAAFAD 45206
45207 RPVNEA aaelmfhramgfaphggywrrlrrlasahala  PG 45386
45387 RLAARRRAIGEEPVRRVAPAMARDGAVGVRRLLHLASLDNVMASVFGVGLGELGAGAVSE 45566
45567 LEEMVGQGYELLGTFNWGDHLPLLRLLDVHGVRRKSRALASRVKVFVSKIIEEHKTRRDA 45746
45747 KYGGCDGDGDFVDVLLGLEGEERLEEEDMVAVLW (0?) 45848
48030 EMIFRGTDTVAILLEWVLARMALHPDVQSKAQAEIDAAAVSGDAAALPYLHCVV 48191
48192 KECLRMHPPGPLLSWARLATRDAHLDLGADAGGRAALVPAGTTAVVNMWAIARDGGLWRD 48371
48372 PGVFRPERFLGDGEAAGVGVAGGAGGYDLRLAPFGAGRRACPGRALAMATVHLWLAQLLR 48551
48552 SFRWVPSGDRGVDMSERLGMSLEMEKPLICLALPRTSST* 48671

>aaaa01023161.1 (indica cultivargroup) ortholog of AC097276.6
2560 MVSFSYLDSTFLPLLATTMASPLHACLLLALLFLALAFFHPGGVAWALSSSGGHGAAAIP 2381
2380 GPRGVLLAFAGPNPHRALASLAASTRGATRLMAFSVGLTQFVVASHPDTAREILAGAAFA 2201
2200 DRPVKEAAAELMFHRAMGFAPHGGYWRRLRRLASAHALAPGRLAARRRAIGEETV 2036
2035 RRVAAAMARDGAVGVSRLLHLASLDNVMASVFGVGLGELGAGAVSELEEMVGQGYELLGT 1856
1855 FNWGDHLPLLRLLDVHGVRRKSRALASRVKVFVSKIIEEHQTRRDAKYGGCDGDGDFVDA 1676
1675 LLGLEGEERLEEEDMVAVLW (0) 1616
3584 XXXXXGTDTVAILLEWVLARMALHPDVQAKAQAEIDAAAVSGDAAALPYLHCVVKECLRMHPPGP 3405
3404 LLSWARLATRDAHLDLGADAGGRAALVPAGTTAVVNMWAIARDGGLWRDPGVFRPERFLG 3225
3224 DGEAAGVGVAGGAGGYDLRLAPFGAGRRACPGRALAMATVHLWLAQLLRSFRWVPSGDRG 3045
3044 VDMSERLGMSLEMEKPLICLALPRTSST* 2958

>AC099399.1 chromosome 3 clone OJ1006_F06, 56% to 78A9
49121 MATSFVYLAIFACLAWAGTALLYWAHPGGPAWGKYRRARGQSPRCSI
48980 PGPKGLPVVGSLGLMSGLAHCSLAAEAARRPGAKRLMALSLGPVRAVVTSHPDVAKEIL 48804
48803 DNPAFADRPLNHAAYGLMFHRSIGFAEHGPYWRALRRVAAGHLFGPRQVDAFAPYRA 48633
48632 RVAGGVVAALRGAGGEAAVQVRGVLRRASLYYIMRFVFGKEYDVSRGAPESGEEVEELL 48456
48455 EMVHEGYDLLGKENWCDYFPGLAAVDPQGVGARCAELMPRVNRFVRGIIQEHRGKAIA 48282
48281 GGEARDFVDILLSLQESEGLADADIAAVLW 48192 (0)
47885 EMIFRGTDAMAVLMEWTLARVVLHPDVQANVHRELDAVVGRSNTVAESAVPSLPYLQALL 47706
47705 KEALRMHPPGPLLSWRHRAISDTYVDGHLVPAGTTAMVNQWAMSRDADVWDAPLEFQPER 47526
47525 FLPGGKAHGVSVLGADGRLVPFGSGRRSCPGKSLAMTTVTAWMATLLHEFEWTPASGA 47352
47351 VDLSEVLRLSCEMAVPLEVRVSARRNV* 472968

>AC083943.6 $F CYP78A11 clone OSJNBa0044A10, 61% to 78A7
40753 MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLAFATAAVLAWAASPGGPAWAHGRGRLGA 40965
40966 TPIEGPRGLPVFGSIFALSRGLPHRALDAMSRDAAAPRARELMAFSVGETPAVVSSCPAT 41145
41146 AREVLAHPSFADRPLKRSARELLFARAIGFAPSGEYWRLLRRIASTHLFSPRRVAAHEPG 41325
41326 RQADATAMLSAMAAEQSATGAVVLRPHLQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQ 41505
41506 LKSMVREGFELLGAFNWSDHLPWLAHLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRD 41685
41686 SSSTAADNADFVDVLLSLEAHENLAEDDMVAVLW 41787 (0)
41874 EMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMP 42035
42036 YLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAITHDGEVWADP 42215
42216 EAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLWVARLVHAFDWF 42395
42396 LPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA* 42506

>AP004704.1 $F chromosome 8 clone P0544G09, Length = 137478 61% to 78A9
42285 MDMDSSPSTQDCGGWLLYVSLAAKCGGDPCRVVGFVAVAVVAFAVTSLLHWLSPGGPAWGRYWWNRRGGLGIAAAI
42057 PGPRGLPVLGSMSLMAGLAHRKLAAAAGGSPARRRLMALSLGETRVVVTADPGVARELLA 41878
41877 SAAFADRPVKESAYGMLFHRAIGFAPYGTYWRALRRVASTHLFSPRQVSASAAQRA 41710
41709 VIARQMVEAMRSAAAAAAGGGVAARPFLKRASLHNVMWSVFGRKYELAAPESEETAEL 41536
41535 RSMVDEGYDLLGQLNWSDHLPWLAPFDLKKTRSRCSSLVPRVNRFVTRIIDEHRARLSLA 41356
41355 VDAAVDFTDVLLSLHGGDKLSDADMVAVLWVCT 41257 (0) 
41183 EMIFRGTDTVAVLIEWVAARLVLHQDVQARVHDELDRVVGSDRAVTESDAS 41010
41009 KLVYLQAVIKEVLRLHPPGPLLSWARLATSDVHVGGFLIPSGTTAMVNMWAITHDPAVWP 40830
40829 DPNEFKPERFVAGPSSDQATEFPIMGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLH 40650
40649 EFDWLPLSDKSRGVDLSEVLKLSCEMATPLEARLRPRRKV* 40527 

>AL662990.1 chromosome 4, 67% to CYP79 sorghum Ortholog to aaaa01007189.1 98% shown in lower case
mpsqliaqndhayvltfl
4128 msiamailllvalfyrikkqaaamaakrkqqpklppglatmpvvrnmhqmlmnkpvfrwihr 3943
3942 lldemdteilclrfgrvhviavaspemarellrkkdamlasrh 3814
3814 ssfasrtfsfgykn
TIMSPAGDQWRKMRQVLTSEILSPAMERRMLGRRVEEADHLVNYVYSHCNDGTVDVR
HVTRHFCGNIIRKLVFGRRHFNSGDGNIGPGRDEEAHIDALFTALDYHGAFSVSDLLP
TLVGLDLDGHEEVVNGLMNTFNRLHDPIIMERIEEW (gap? kslrtkgdkrrevadf)
119313 LDVLISLEDAQGKPFLSVDEIKAETL (0) 119236
118617 EIILATVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGRERLVEESDIHNLTYLKACI 118438
118437 REAFRLHPYHPFNPPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERH 118258
118257 LKNTGTVVLAEPELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIEL 118078
118077 QESATSLQLSKPLFMQAKPRLLLHLYEADVLN* 117979

>aaaa01007189.1 (indica cultivargroup) ortholog of AL662990.1
MPSQLIAQNDHAYVLTFL
4128 MSIAMAILLLVALFYRIKKQAAAMAAKRKQQPKLPPGLATMPVVRNMHQMLMNKPVFRWIHR 3943
3942 LLDEMDTEILCLRFGRVHVIAVASPEMARELLRKKDAMLASRH 3814
3814 SSFASRTFSFGYKNTIMSPGGDQWRKMRRVLTSEILSPAMERRMLGRRVEEADHLVNYVY 3635
3634 GHCNDGTVDVRHVTRHFCGNIIRKLVFGRRHFNSGDGNIGPGRDEEAHIDALFTALDYHG 3455
3454 AFSVSDYFPTLVGLDLDGHEEVVNGLMNTFNRLHDPIIMERIEEWKSLRTKGDKRREVAD 3275
3274 FLDVLISLEDAQGKPFLSVDEIKAETL (0) 3194
2567 EIILATVDNPSNAVEWALAEMVNNPKVMKKAVDELDMVVGRERLVEESDIHNLTYLKACI 2388
2387 REAFRLHPYHPFNPPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERH 2208
2207 LKNTGTVVLAEPELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIEL 2028
2027 QESATSLQLSKPLFMQAKPRLLLHLYEADVLN* 1929

>AC093612.15 $P chromosome 10 Cterminal seq from aa 166 like 98A3 probable pseudogene
39185 GEEGKPMVMRKHLSMVAFNNITRLTFGKRFIDAAGELDEQGSELKAIVNNGIKIGASLTI 39364
39365 AEHIRVLRWLNPVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFVDALFTLRDKY 39544
39545 DLSDDTVIGLLCDMIAAGTDTTVITVEWAMAELVRNPRVQMKAQEELDRVIGRGRVMLE 39721
39722 ADIPNLPYLQAVVKESFRLHPPTPLMLPHKASTSVKIAGYDVPKDASVVVNVWAVARDPG 39901
39902 VWDNPLE*RPERFLEESIDIKGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQF 40075
40076 TWALQDGTRPEDLDMMESPGLVTFMATPLQVVAMPRLDKEELFKRVPVDMS* 40231

>AC105377.3 $P like 98A3 chromosome 10 clone OSJNBa0034E15 probable pseudogene 5 frameshifts
3339 MDTPALLPLALALVAIPITILLDLQSDPPRQAVPRAPGVAGGNLFDITLVRCRCFMEWAG 3160
3159 KYGPIMTVWLGTSPTIVVSTSELAREVFKNV 3067 
3065 NDQQLADRPRNHSAERLSRGGTDLIWADYGPHYVKVRKLCNLELFAPRRMEALRPIS 2895
2894 EDEVNAMVESIYRAVTAP 2841 (1)
969 GEEGKPIGVRKHLSMVAFNNITRLTFGKRFIVAAGELDEQGCEQKAIVKAGIKIGASLPI 790
789 AEHILVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERHGAKQHFV 640 
641 FTLRDQYDLSDDTV 600 
598 VIGLLWDMIAAGSDTAVITAEWAMAELVRNPRVQMKAQEELDRVIGRGRVMLEADIPNLP 419
418 YLQAVVKESFRLHTPTPLMLPHKASA 341
341 RVKIAGYD 318 
317 VPKGANVIVNVWAVGRDLSVWDSPLP 240 
240 PLEYRPERFLEESIDIKGSDYRVLPFGAGRRVCPGAQLGISLVASMIGHLLHQFTWALPD 61
60  GTWPEDLDMMESSGLVTFMA 1
25696 TPLQVVAMPRLDKEELFKRVPVDMS* 25773 

>AP003446.1 $P chromosome 1 clone OJ1529_G03 CYP73A 9aa deletion and two s
84699 MDLLFVERLLVGLLAAAVVAIAVSKLRGRKLRLPPGPTPVPVFGNWLQVGDDLNHRNLAALARRFGDIF 84493
84492 LLRMGQRNLVVVSSPPLAREVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKM 84313
84312 RRIMTVPFFTGKVVQRHRAGWEAEAAAVVDGLRADP 84205 
84202 RRRLQLMMYSNVYRIMFDRRFESADDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPF 84023
84022 LRGYLRICEEVKETRLKLFKDFFLEERK (2)
83842 KLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVA (1)
83634 AIETTLWSMEWAIAEL 83587 
      VNHGEIQEKLRRELDTVLGPGRQITEPDTHRL 83489
83488 PYLQAVVKETLRLRMAIPLLVPHMNLRDAELAGYGIPAESKVLVNAWYLANDPGRWRRPE 83309
83308 EFRPERFLEEERNVEANGNDFRYLPSGAGRRSCPGIVLALPILGVTIGRLVQNFELLPPP 83129
83128 GKDRVDTTEKGGQFSLHILKHSTIVAKPRAF* 83033

>AL606630.1 $F chromosome 4 clone OSJNBb0046P18 45% to 81D3
70830 MANTTLSSLLFLSMASALFLLTLLRILRSKKQQR 70931  
70931 PPPPPAEPAVPPRHRGHLHLFKKPLHRALSGLAATHGPVLLLHFGSRAVLHVTDPAVAE 71107
71108 ECLTDHDVTFANRPRLPSSCHLSNGYTTLGSSSYGPNWRNLRRIATVEVFSAHRLLRSAD 71287
71288 VRGGEVPHMARWLYLAAPAAGPSEPARADVKARAFELVLNVVARMVAGKQYYGGEGDAEA 71467
71468 ETEEAARFREMVREYFAMHGASNLQDFVLLLGLVDIGGAKRRAVKLSRERNTWAQRLID 71644
71645 EHRATATAAAATEARTMVGDLLKMQASEPEAYSDKVITALCL 71770 (0)
73597 SILQTGTDTSSSTIEWGMALLLNHPAAMAKARAEIDRFVGTGRVVEEADLPNLPYL 73764
73765 QCIIRENLRLYPVGPLLAPHESSADCSVSVAGGGRYAVPAGTMLLVNVHAMHRDARFWGP 73944
73945 DPESFSPERFEGGRSEGKWMLPFGMGRRRCPGEGLAVKVVGLALATLVQCFEWRRV 74112
74113 GDEEVDMTEGSGLTMPKAVPLEALYWPRPEMVPALSGIFFIYNFFY* 74253

>BI806420.1 (partial) clone S063A11. ortholog of aaaa01004834.1c = AP005285.1 at 115000 region 
115879 SLEAGTGTSTDTIEWAMSLLLNNPDVMRKARDEIDAFIGQPVRLLEADDLPKLQYLRCII 115700
115699 METLRLYPPAPLLVPHESSSDCTVAGFHIPRGTMLLVNTFDIHRDPHIWDEPTSFIPER 115523
115436 FEDGRSEGKMAIPFGMGRRKCPAENLGMQMVGLGLGTMIQCFEWERVGEELVDMTEGSG 115254
115253 LTMPKKVPLEAFYQPRASVMHLLS 115182

>AC084282a $F 46% to 81D5 CDS join(53081..54004,55290..55904)
MDKAYIAVFSIVILFLLVDYLRRLRGGGTSNGKNKGMRLPPGLP 
AVPIIGHLHLVKKPMHATLSRLAARHGPVFSLRLGSRRAVVVSSPGCARECFTEHDVA
FANRPRFESQLLMSFDGTALAMASYGPHWRNLRRVAAVQLLSARRVGLMSGLIAGEVR
AMVRSLCRRPAAAAPVQLKRRLFELSLSVLMETIAQSKATRPETTDTDTDMSMEAQEY
KQVVEEILERIGTGNLCDYLPALRWFDVFGVRNRILAAVSRRDAFLRRLIYAARWRMD
DGEKKSMIAVLLTLQKTQPEVYTDNMITALCSNLLGAGTETTSTTIEWAMSLLLNHPE
TLKKAQAEIDASVGNSRLITADDVPRITYLQCIVRETLRLYPAAPMLIPHESSADCEV
GGYSVPRGTMLLVNAYAIHRDPAAWEEPERFVPERFEGGGCDGNLSMPFGMGRRRCPG
ETLALHTVGLVLGTLIQCFDWERVDGVEVDMAEGGGLTMPKVVPLEAVCRPRDAMGGV
LREL

>aaaa01013363.1 $FI (indica cultivargroup) ortholog of AC084282a 100%
3727 MDKAYIAVFSIVILFLLVDYLRRLRGGGTSNGKNKGMRLPPGLPAVPIIGHLHLVKKPMH 3906
3907 ATLSRLAARHGPVFSLRLGSRRAVVVSSPGCARECFTEHDVAFANRPRFESQLLMSFDGT 4086
4087 ALAMASYGPHWRNLRRVAAVQLLSARRVGLMSGLIAGEVRAMVRSLCRRPAAAAPVQLKR 4266
4267 RLFELSLSVLMETIAQSKATRPETTDTDTDMSMEAQEYKQVVEEILERIGTGNLCDYLPA 4446
4447 LRWFDVFGVRNRILAAVSRRDAFLRRLIYAARWRMDDGEKKSMIAVLLTLQKTQPEVYTD 4626
4627 NMITALCS (0) 4650
6103 NLLGAGTETTSTTIEWAMSLLLNHPETLKKAQAEIDASVGNSRLITADDVPRITYLQCIV 6282
6283 RETLRLYPAAPMLIPHESSADCEVGGYSVPRGTMLLVNAYAIHRDPAAWEEPERFVPERF 6462
6463 EGGGCDGNLSMPFGMGRRRCPGETLALHTVGLVLGTLIQCFDWERVDGVEVDMAEGGGLT 6642
6643 MPKVVPLEAVCRPRDAMGGVLREL* 6717

>AC084282b $F 46% to 81D5 Nterm extension or too long
MDNAYIIAILSVAILFLLHYYLLGRGNGGAARLPPGPPAVPILGHLHLVKKPMHATM
SRLAERYGPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPRFESQLLVSFNGAA
LATASYGAHWRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRMYRAAAASPAGAAR
IQLKRRLFEVSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQVVDEIIPHIGAANL
WDYLPALRWFDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGDEGEKKSMIAVLLT
LQKTEPEVYTDNMITALTANLFGAGTETTSTTSEWAMSLLLNHPDTLKKAQAEIDASV
GNSRLITADDVTRLGYLQCIVRETLRLYPAAPMLLPHESSADCKVGGYNIPRGSMLLI
NAYAIHRDPAVWEEPEKFMPERFEDGGCDGNLLMPFGMGRRRCPGETLALRTVGLVLG
TLIQCFDWERVDGVEVDMTEGGGLTIPKVVPLEAMCRPRDAMGGVLRELV

>AC084282c $F 41% to 81H1 CDS join(65367..66332,67175..67792)
MDKAYIAVFSIAILFLLVDYFRCRRRRGSGSNNGENKGMLQLPP
SPPAIPFFGHLHLIDKPLHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARECFTDN
DVCFANRPQFPSQMPATFYGAGFGFANYGAHWRNLRRIATVHLLSAHRVRGMAGVVSG
EIRPMVQRMYRAAAAAGVGVARVQLKRRLFELSLSVLMEAIAQTKTTRPEADDADTDM
SVEAQEFKNVLDELNPLLGAANLWDYLPALRVFDVLGVKRKIATLANRRDAFVRRLID
AERQRMDNGVDGGDDGEKKSVISVLLSLQKTEPEVYKDIVIVNLCAALFAAGTETTAM
TIEWAMSLLLNHPKILKKAKAEIDASVGNSRLINGDDMPHLSYLQCIINETLRLYPVA
PLLIPHESSADCKVNGYHIPSGTMLLVNVIAIQRDPMVWKEPNEFKPERFENGESEGL
FMIPFGMGRRKCPGETMALQTIGLVLGALIQCFDWDRVDGAEVDMTQGSGLTNPRAVP
LEAMCKPREAMSDVFRELL

>AC084282d $F 40% to 81H1 join(70282..71220,71398..72015) EST D46694, D46695 
MVKAYIAIFSIAVLLLIHFLFRRRGRSNGMPLPPSPPAIPFFGH
LHLIDKPFHAALSRLAERHGPVFSLRLGSRNAVVVSSPECARECFTDNDVCFANRPRF
PSQMLATFNGTSLGSANYGPHWRNLRRIATVHLLSSHRVSGMSGIISGQARHMVRRMY
RAATASAAGVARVQLNRRLFELSLSVLMEAIAQSKTTRREAPDADTDMSMEAQELRHV
LDELNPLIGAANLWDYLPALRWFDVFGVKRKIVAAVNRRNAFMRRLIDAERQRMDNND
VDGGDDGEKKSMISVLLTLQKTQPEVYTDTLIMTLCAPLFGAGTETTSTTIEWAMSLL
LNHPEILKKAQAEIDMSVGNSRLISVVDVHRLGYLQCIINETLRMYPAAPLLLPHESS
ADCKVGGYHIPSGAMLLVNVAAIQRDPVIWKEPSEFKPERFENGRFEGLFMIPFGMGR
RRCPGEMLALQTIGLVLGTMIQCFDWGRVDDAMVDMTQSNGLTSLKVIPLEAMCKPRE
AMCDVLRKFM

>AL606587.1 $P chromosome 4 clone OSJNBa0011L07, 
29446 MESWWLPTWQPLLVLLPTMLLLYHTVSSWHCGE
29347 RCLPLPPGPRGLPFVGNILHTSDMTHRGLAQLASRYGGLLHLRLGRLRTVVVSTPEMARL 29168
29167 VLHVNDRAFADRPTTAAIDYLTYDRADMVFAPYGP 29063 
28858 YGPLWRQLRKLCINRLFNRRRAASWAAVHDGVDSLLREVTKNSGAVVNVGELVFGMSMK 28682
28681 ITLR 28670 
28642 PGMQLGMLAVELALARLLHGFDWSLPGGTGSAGELDMEETYGLTAPRAVRLSAVPVPRLSHL* 28454

>AC073867.4 $F chromosome 10 clone OSJNBa0055O03, 1 ordered pieces 63% to CYP84A 
68246 MADMVKFTMEWLQDP 
68196 LSLAIVVTVAVLIMRMQRRRAAPFPPGPKPLPIVGNMAMMDQLTHRGLAALAKEYGGLM 68020
68019 HLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATTAIAYLTYDRADMAFAHYGPFWRQM 67840
67839 RKLCVVKLFSRRRAETWLAVRDESAALVRAVAASRGEAAVNLGELIFNLTKNVIFRAA 67666
67665 FGTRDGEGHDEFIAILQEFSKLFGAFNIGDFIPWLSWADTNGINARLVAARTALD 67501
67500 RFIDKIIDEHMERGKNPDDADADMVDDMLAFLAEAKPHAGKAAAAAAGAGDGADDLQNTL 67321
67320 RLTRDNIKAIIM 67285
62628 DVMFGGTETVASAIEWAMAEMMHSPDDLRRVQEELAAVVGLGRDVAESDLDKLPFLRC 62455
62454 VIKETLRLHPPIPILLHETAADCLVAGYSVPRGSRVMVNVWAIARDRAAWGPDADAFRP 62278
62277 SRFAAGAAAEGLDFRGGCFEFLPFGSGRRSCPGMALGLYALELAVARLAHGFNWSLPDGM 62098
62097 KPSELDMSDIFGLTAPRATRLSAVATPRLTCPLY* 61993

>AQ160861 Nterminal to Chelix 59% to 84A1 ortholog of aaaa01015479.1 $FI 94%
MEYYSQDAYFVTASLISIAFFLWYASRLRRTAIL
LPPGPPGLPVLGNLLSVHQFTHRGLAKLSKIHGGFFHLRVGQPNVFVVSSPETVRE 
IIHENDSVFSHCPVTVAMVYVXYDLADMAFAHYGPFWRQMRKLCVFKLLSPR 
RDVLWRCVRGKVDALVRSV

>aaaa01015479.1 (indica cultivargroup) ortholog of AQ160861
4482 MEYYSQDAYFVTASLISIAFFLWYASRLRRTAILLPPGPPGLPVLGNLLSVHQFTHRGLA 4661
4662 KLSKIHGGFFHLRVGQVNVFVVSSPETVREIIHENDSVFSHRPVTAAMVYVSYDLADMAF 4841
4842 AHYGPFWRQMRKLCVLKLFSPRRDVSWRVVRGEVDALVRSVAELRRVAGSVGDLVFKFAT 5021
5022 NVTFRAAFGAQSREDEKVFVDIILELSEIFMAFNMGDYIPCLGWLDLNGIGKRMAAARHA 5201
5202 LDVFIDRIIDEHLAKLRNGDVSASDMVDDMIAYLVDAPGGRHKRADGVELGDLHLTRDNI 5381
5382 KGLIMARN (0)
     DIMFGGTKTVASTVEWALSELLRNPDEL 5561
5562 RRAQDELAGVVGLRRRVNQDDLDNLPHLRCVTKEVLRLHPPLPLLLRESLHDCAIG (1?) 5738
5731 GYTVPRGSRIWINNWAMCRDEVLWGTDAAAFRPSRFADESARVEFKGGDFQYLPFGSGRR 5910
5911 SCPGMQLGMFAVELGLAELLHCFDWSLPAGTEPLELDMDDVFGLTAPKAERLCAVPSPRL 6090
6091 SCPLL* 6108

>AC121490.1 $F (japonica cultivargroup) chromosome 3 clone
AQ577123 nbxb0090O10r 57% to CYP84 Cterm
92194 MDPWLVLWLVLASMAFALLHLRRRARRGAPPLPPGPRPLPIIGNMLMMDQLTHRGLAAMA 92015
92014 ARYGGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRPASIAIAYLTYGRADMAFSHY 91835
91834 GHFWRQVRKLSAVRLFSRRRAQSWRAVRDESAKLVGAIARRAGEAVDLGELIFGLTKDVI 91655
91654 FRAAFGTRDGGGHGELEVLLQEFSKLFGAFNVGDFIPWLAWLDPHGINRRLRAARAALDS 91475
91474 VIDRIIDEHVSNPAGDEDADMVDDMLAFLDEAGRDQTGGGGELQGTLRLTRDNIKAIIM (0)
      DFVFGGTE
      TVASAIEWAMAELLHSPGDLRRLQAELADVVGLGRGVEEGDLEKLPFLRCVAMETLRLHP
      PIPLLLHEAAADCVVGGYSVPRGARVVVNVWSVGRDAGAWKGDAGAFRPARFMAGGEAAG
      MDLRGGCFELLPFGSGRRACPAIVLGMYELELVVARLV 90725
90724 HAFGWAPPGGVAPEELDMADGFGLTAPRAARLRAVPTPRLTCPM* 90590

>aaaa01004359.1 (indica cultivargroup) ortholog of AQ577123
deletion of Ihelix to heme
1854 MDPWLVLWLVLASMAFALLHLRRRARRGAPPLPPGPRPLPIIGNMLMMDQLTHRGLAAMAARY 2042
2043 GGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRPASIAIAYLTYGRADMAFSHYGHF 2222
2223 WRQVRKLSALRLFSRRRAQSWRAVRDESAKLVGAIARRAGEAVDLGELIFGLTKDVIFRA 2402
2403 AFGTRDGGGHGELEVLLQEFSKLFGAFNVGDFIPWLAWLDPHGINRRLRAARAALDSVID 2582
2583 RIIDEHVSNPAGDEDADMVDDMLAFLDEAGRDHTGGGGELQGTLRLTR

     GRRACPAIVLGMYELELVVARLVHAFGWAPPGGVAPEE 2942
2943 LDMADGFGLTAPRAARLRAVPTPRLTCPM* 3032

>AA754418 74% to 89A5 423488 region  CTERMINAL 86% to BI797636.1 ortholog to aaaa01016355.1 $FI 95%
IRHEXXXLTGSKEIKXMPFGAGRRVCPGMALALLHLEYFVANLVWEFDWREVAG
DEVDLTEKLEFTVVMKRPLKATAVPLRXTRSAAVE* 

>AP004811.1 $F (japonica cultivargroup) chromosome 6 
BI797636.1 clone H081H03.Length = 636 86% to AA754418 62% to AC068924.9
68% to 89A4, also = BI809563.1, BI809355.1 
(end of this message seems to be vector sequence KRRSRGSKLTYACDVIALL,
this is not the true end.  It is sequencing vector and it appears 
many times in rice ESTs) betagalactosidase alpha peptide part of 
pSPORT2 vector used in cloning this EST
113179 MEDWIFYSLTLLLCLACSLLLRARASAAAVEVAPLPPGPRTVPVLGPLLFLARRD 113015
113014 FDVEPTLRRIAAEHGPVFTFAPLGPSRPTIFVAARGPAHRALVQRGAAFASRPRGVSPA 112838
112837 SVLLTSGGRNVSSAQHGPIWRALRRCISSGVLNPARLRAFSDARRWVLDALVSHIRGEGG 112658
112657 APLTVMEPFQYAMFCLLVYMCFGDRPGDARVREIEALQRELLSNFLSFEVFAFLPPITRL 112478
112477 VFRRRWNKLVSLRRRQEELFAPLIRARREAGAGGDCYVDSLVKLTIPEDGGRGLTDVEIV 112298
112297 SLCSEFMSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGEVREEDLQAMPYL 112121
112120 KAVVLEGLRRHPPDHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGLDSEVWTSPEVFR 111941
111940 PERFLAGGEGEDVDLTGSKEIKMMPFGAGRRICPGMALALLHLEYFVANLVREFEWREVA 111761
111760 GDEVDLTQKLQFTVVMKRPLKATAVPLRGDRSAAAAVTGSA* 111635

>aaaa01004950.1 $F (indica cultivargroup) ortholog to AP004811.1 99%
15700 MEDWIFYSLTLLLCLACSLLLRARASAAAVEVAPLPPGPRTVPVLGPLLFLARRDFDVEP 15521
15520 TLRRIAAEHGPVFTFAPLGPSRPTIFVAARGPAHRALVQRGAAFASRPRGVSPASVLLTS 15341
15340 GGRNVSSAQHGPIWRALRRCISSGVLNPARLRAFSDARRWVLDALVSHIRGEGGAPLTVM 15161
15160 EPFQYAMFCLLVYMCFGDRPGDARVREIEALQRELLSNFLSFEVFAFLPPITRLVFRRRW 14981
14980 NKLVSLRRRQEELFAPLIRARREAGAGGDCYVDSLVKLTIPEDGGRGLTDVEIVSLCSEF 14801
14800 MSAGTDTTATALQWILANLVKNPAMQDKLREEITAAAVDGEVREEDLQAMPYLKAVVLEG 14621
14620 LRRHPPGHFLLPHTVEEETTLDGYRVPANTPVNFAVGEIGLDSEVWTSPEVFRPERFLAG 14441
14440 GEGEDVDLTGSKEIKMMPFGAGRRICPGMALALLHLEYFVANLVREFEWREVAGDEVDLT 14261
14260 QKLQFTVVMKRPLKATAVPLRGDRSAAAAVTGSA* 14156

>aaaa01016355.1 (indica cultivargroup) ortholog of AA754418
90% to AAAA01004950.1
5728 MEDWLFYSLTSLLCLACSLLLRARASAASPKAAEAEAAPLPPGPRTVPVLGPLLFLARRDFDVEPTLRR 5522
5521 IAAEHGPVFTFAPLGPSRPTIFVAARGAAHRALVQRGAAFASRPRGGGGPASALLSSGGR 5342
5341 NVSSAPYGPTWRALRRCISSGVLNPARLRAFSDARRWVLDVLISHVRGEGGAPVTVMEPF 5162
5161 QYAMFCLLVYMCFGDRPGDARVREIEALQRDLLGNFLSFQVFAFLPPITKLVFRERWNKL 4982
4981 VSLRRRQEELFVPLIRARREAGAGGDCYVDSLVNLTIPEDGGRGLTDGEIVSLCSEFMSA 4802
4801 GTDTTATALQWILANLVKNPAMQDRLREEIAAAVGSDGEVREEDLQAMPYLKAVVLEGLR 4622
4621 RHPPGHYVLPHAVEDETTLDGYRVPANTPVNFAVGEIGLDSEVWASPEVFRPERFLPGGE 4442
4441 GEDVDLTGGKEIKMMPFGAGRRVCPGMALALLHLEYFVANLVREFDWREVAGDEVDLTEK 4262
4261 LEFTVVMKRPLKAIAVPLRGDRSAAVE* 4178

>AC090873 $F 60128..61720 47% to 89A4 same as AQ327293 AU090603
MELTWLLLLATLLLSTTLLVFLFHGGSSATGGEKRRRLPPGPAT
VPVLGNLLWATNSGMDIMRAVRRLHARHGPMLGLRMGSRLEVIVADRRLAHAALVESG
AAMADRPEFASRALLGLDTATISNSSYGPLWRLFRRNFVAEVAHP ARLRQFAPARAAV
LEELTDKLRRRQEDAGAGTILETFQYAMFFLLVAMCFGELLDERAVRDIAAAQRDLLL
HSSKKLRVFAFLPAITTRLFAGRMKAMIAMRQRLKGMFMPLIDARRARKNLVDDHGDA
TAPPPPAASATTLPHSYVDTLLNLRINDNGGERALTDDEMVALCSEFLNGGTDTTSTA
LEWIMAELVKNPTIQDKLHGEIKGAITSNSGKVSEEDVQKMPYLKAVVMEGLRRHPPG
HFVLPHAPAEDMELGGYTIPKGTLVNFTVADMGMDGAAWDRPREFLPERFMAGGDGEG
VDITGTREIRMMPFGAGRRICPGLGVATLHLEYFVANMVAAFEWRAAEGEAVDVDGEK
LEFTVVMEKPLRARLLPRAVTV

>AC087192 $F similar to CYP89A4 missing about 97 aa internally not assembled well
MHAELTSTTTMEMGSLLPHAASLFAVSMASLMIAAVLSIVRRP
4971 WPWKTAAISREAVLRLLGVRLGDVPTTVVRDGAVAVDALVRRADAFSDRPAG 5126
5127 GGATSIVSGGRAHNINTVPHGPLWVALRRNLTSEAFHPVHGLARAAPGRSSRTSRPPRR 5303
5304 APPAEGQA 5327
     VRDCLYAALFALNVATCFGDGVDGE 5413
5414 LVGAMRAAQQEFLRFLPRARVFSTFQKAARLVYPDRWKQLLRHRRRQEEMYLPLIRAIN 5590
5591 EQRRTRGTPSPPPPTT
5639 YVDTLLYLEVPADDGRRRRKLSDGEMVGLVSEYLGAATGTVVAQLEWALANLVRRPDIQT 5818
5819 RLCGEVEAAAGGEPCAYLRAVVMECLRRHPPVSSVQRHMVRDVMLGGAHV 5968
5969 ARGNVVSFAIEEIGR 6013
6667 WTSSEEFSPERFMEGGEEGVRLAIGSKQEATTKVKMMPFSAGRRTCPGMGYAILHLEYFL 6846
6847 ANLVTAFEWRRVPWEEEVDLTADYGFITTMQHPLRALVVPLSNDRSTVV* 6996

>AC097280.1 $P chr 3 clone OSJNBb0111B07, like 89As from AC068924 missing Nterm, Khelix region
      PQQQAAVEALVVDIAARVGGG
83429 SGSDGEVLIRDVVHDTLFPVAAWFCFGERDVRDLQRVLREFELDVVVEGFGGSMLANLV 83605
83606 HWWRLRRFVASGRRQAEVFLPLISQQRRTQHRGEHKFCPYVD 83731 this segment 10 aa short vs 89As
83732 SLLDLRVPVGDNAAAGEGKEEHRLSHCALTDDEMVGLVSEFLGSGTEST 83879  Ihelix 
frameshift and 73aa deletion
83878 RVEHLSLPSGGVRVHFILGDIGRDGKAWTDPDEFRPDRFMASGEAEGVSPLP 84033
84034 RPKEVRMMPFGAGRRYCPSMGLGVAHACLLVAALVREFEWAAAATSGVELMEGER* 84201

>AL662964.1a chromosome 4 clone OSJNBa0027H09, 39% to 89A4
91854 MDTSVLLLVLFVFTLLCCLALLRRAARAPAAV
91950 QLPTIEISDAAVARRALVDYADVFANRPFLPFPVALVTGRRRRRSDNLTSVPYGPHWRVL 92129
92130 RRNLTAGIFHPSRLGLLAPLQRDAVDDLVAGISESAAGGAVPVVVRDVAYAAVFRLAARM 92309
92310 CFGDGVGERQVRALRRVIREFVLDVGVANNVFPVSTSTALARLRRWRRIRRLLSSRR 92480
92481 RQAELYLPLIDERRRRMAARRRDRDDDGGTFRPYVDALIELRVPGDGESTPAPLTDDEMV 92660
92661 SLLMEFLAASTETVVSCIEWTLAHLVLNAEAQSKLRREVGDGEHVHGRHRGRTPYM 92828
92829 RAVILESLRLHPPVPFVIREVVGGAAPPVLDELAAMPMPGGGARVHFVIGDIGR 92990
92991 DSKAWRDPKEFRPERFMAGGEAEGVGPVPGPKEVRMMPFGAGRRSCPGMGVAMAHVGLF 93167
93168 VAALVREFEWTPAAGGGVDLTQQDDFFNVMRTPLRARATPRPRAPA* 93308

>AL662964.1b chromosome 4 Almost identical to AC097280.1 $P chr 3
104753 MMLLLTLLLVLTLFLCLAVFRRTTSRARRAPVSLRQPTVEIHDGDVARRALLDHADAFVNRP 104938
104939 AIGAEPRGRRSDNLTTVRYGPQWRVLWRNLTAGFLRPSRVGLLAPLQQKAVDAL 105100
105101 VADIAARGADGGEVGVRDVVHDALFPLAVRFCFGDDIDERHVRDLRRVMQELKLDVVVK 105277
105278 GFSGSMLANLVHWWRLRRFIASGRRRAEIFLPLIAQRRRTQHRDADGGVF 105427
105428 RPYVDSLLDLRVPVGHDADADAAGCEDNEGRNSGRALTDDEMVGLVAEFLSGGTETVVSC 105607
105608 VEWTLAHLVIEPEIQDKLCRQVVAAADHHGGERGTTPAYLRAVILESLRMHPPVPLTMRD 105787
105788 VRSPQAVEHLSLPDGGARVHFILGDIGRDGKAWTDPDEFRPERFMAGGEAEGVG 105949
105950 PLPGPREVRMMPFGAGRRYCPGMGLGVAHACLLVAALVREFEWAPTAVAATGGVDLTEVN 106129
106130 GFFKMMRTPLRARATPRGTSA* 106195

>AC068924.9a $F chromosome 10 clone OSJNBa0026L12 1 ordered pieces
15237 MDNLYLILGAILAAAVVPFILFRGNGGKRGRRLPPGPPAVPLLGSVVLLTKALTDVEPEL 15058
15057 LLQRLIARYGPIVSLRMGTRVSVFVADRRLAHAALVEGGAALADRPGVPASRLLGEND 14884
14883 NIITRAGYGPVWRLLRRNLVSETLHPSRARLFAPARYWVHRVIVDKLAASGQAPHDVVD 14707
14706 TLQYAMFCLLVNMCFGERLDEATVRAVEDAQRDLLIYITSQMAVFAYFPAITKHLFRGRL 14527
14526 EKIYALRRRQRELFMPLINARREYKKHGGETTKTTNKETTLEHSYVDTLLDIKLPEDGNR 14347
14346 ALTDDEIIKLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLHDEIKSKTGDDQPEVTE 14167
14166 EDVHGMPYLRAVVLEGLRKHPPGHFVLPHRAAEDVEVGGYLIPKGATVNFMVAEIGRDER 13987
13986 EWAKPMEFIPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLSFAMHHLEYFVANMV 13807
13806 REFEWKEVAGDEVEFAEKREFTTVMAKPLRARLVPRRTT* 13687

>AC068924.9b $F 49% to 89A2 gene 2
30867 MDAWQLFVPAIAILIPLLRLILFRRGDDGRRGRLPPGPPAVPLLGSTVWLTNSLYDAEPV 31046
31047 VKRLMSRHGPVVSLRFGSQLLVFVADRRLAHAALVESGASLADRPSQAASARLVGEGDTM 31226
31227 ISRASYGPVWRLLRRNLVADTLHPSRAHLFAPVRARVRRLLVDRLREEHGEAEAAPRAVV 31406
31407 ETFQYAMFCLLVLMCFGEQLDEDAVRAIGAAERDTMLYMSSEMGVFNFFPAITRHLFRGR 31586
31587 LQKAHALRRRKEELFVPLINSRREYKKNGGEPKKETTTFTHSYVDNLLDINLPEDG 31754
31755 NRALTDDELVMLCSEFLVAGTDSTSAALQWIMAELVRNPSIQSKLYEEIKSKTGGGGQHE 31934
31935 VSEEDVHDMPYLKAVVLEGLRKHPPAHMLLPHKAAEDMDVGGYLIPKGTIVNFMVAEMGR 32114
32115 DEKEWEKPMEFMPERFLPGGDGEGVDVTSSKGIRMMPFGVGRRICPGLGIAMLHLEYFVA 32294
32295 NMVREFEWKEVAGDEVDFAEKREFNTVMAKPLRVRLVPRSTLE* 32426

>AC068924.9c $F 51% to 89A2 no s gene 3
37901 MDTWHVAVAAILVLIPFLRLILSRRGGRGGGKRGRLPPGPPAVPLLGSTVWLTNSLADAE 37722
37721 PLLRRLIARHGPVVSLRVASRLLVFVADRRLAHAALVEKGASLADRPAMASTRLLGESDN 37542
37541 LISRASYGPVWRLLRRNLVAETLHPSRVRLFAPARAWVRRVLVEKLRDENGDAAAPHAVV 37362
37361 ETFQYAMFCLLVLMCFGERLDEDAVRAIAVAQRDALLYLSSKMPVFAFFPAVTKHLFRGR 37182
37181 LQKAHALRRRQTELFVPLINARREYKKRQGGANGEPKKETTFEHSYVDTLLDIKLPDDGN 37002
37001 RPLTDDEMVNLCSEFLNAGTDTTSTALQWIMAELVKNPSIQSKLHDEIMAKTGGGGGGGQ 36822
36821 REVSEEDIHDMPYLKAVVLEGLRKHPPGHMVLPHRAAEDMEIGGYLIPKGTTVNFMVAEM 36642
36641 GRDEKEWEKPMEFMPERFLAGGDGEGVDVTGSREIRMMPFGVGRRICAGLGVAMLHVEYF 36462
36461 VANMVSEFEWKEVAGDEVDFAEKIEFTTVMAKPLRARLVPRRA* 36330

>AC074105.3 $P chromosome 10 clone OSJNBa0030B02 19 unordered pieces from 87152 
109989 SSFMADCCVAHATLVERGAALANRLEVARSLLGENDYTITRCRCGPVWQILRRNLVAEMLHPSRVRL 110189

>AP002854.1 $P genomic DNA, chromosome 6, BAC clone:OSJNBa0014B15, 89% to AC074105
23716 SSFVADCCVAHATLVERGTTLADRLEVARSLLGENGYTITRCRCGPMWQILRRNLVAETL 23895
23896 HPSRVRL 23916

>AC068924.9d $F 50% to 89A2 gene 4
38532 MDNLVILAGVLLLPLLFLLRNAASSRRRRLPPGPPAVPLFGNLLWLRHSAADVEPLLLTLFKK 38720
38721 YGPVVTLRIGSRLSIFVADRHLAHAALIAAGAKLADRPQAATSTLLGVSDNIITRANYGA 38900
38901 MWRLLRRNLVSQTLQQSRVDQFAPARVWVRRVLMEKLRGSGEEAPNVMEAFQYTMFCLL 39077
39078 VLMCFGERLDEPAVRDVEEAERAWLLYISRRMSVFFFFPWITKHLFRGRLEAAHALRRRQ 39257
39258 KELFVPLIEARREYKRLASQGLPPARETTFQHSYVDTLLDVKIPEEGNRALTDDEI 39425
39426 VTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQEKLYAEINATCGGDDELLERNVRDKD 39602
39603 NKMPYLNAVVKEGLRKHPPGHFVLPHKAAEDMDVGGYLIPKGATVNFMVAEIGRDEREWE 39782
39783 NPMQFMPERFLDGGHGAGVDMHGTKGIKMMPFGVGRRICAGLNIAMLHLEYFVGSMVMEF 39962
39963 EWKEVEGHEVEFAEKREFTTVMAKPLRPRLVPRRS* 40070

>AC068924.9e $F 49% to 89A2 gene 5
49550 MDNLAILTGVLLLPLLVFLRDVTSRRRRRLPPGPPAVPLFGNLLWLRHSAAELEPLLLKLFDK 49362
49361 YGPVVTLRIGWRLSIFVADRHLAHAALVGAGATLADRPRTA 49239 
49240 PPACSSASARIITRSNYGAMWRLLRRNLVSQTLQQSRVDQFTPARVWARRVLMEKLRE 49067
49066 TTSGVSGGGGDAPPNVTEAFQHAVFCLLLLMCFGERLHEHAVRDIEDAERAWLLYISKKT 48887
48886 SVFFFLPWITKHLFRGRLEAGHALLRRQKELFVPLIEARREYKKLASQGLPPARETT 48716
48715 FQHSYVDTLLDVKIPEEGNRSLTDGEIVTLCSEFLNAGTDTTSTGLQWIMAELVKNPAVQ 48536
48535 EKLHAEINATCGDDGELLERSVRDKDNKMPYLNPVVMEGLRKHPPSHTLLPHKAAEDIDV 48356
48355 GGYLIPKGATVNFMVAEIGRDEREWEKPMEFIPERFLAGGDGDGVDVTGSREIRMMPFGA 48176
48175 GRRICAGLNVGVMHLEYFVGSMVMEFEWKEVAGDEVEFAEKLEFTTAMAKPLRPRLVPRRVRH* 47984

>AC068924.9f $F 50% to 89A2 gene 6
58837 MANVDASQWLMLLLAFLVALFILLSLRKCGGRSRVPPGPLAVPVLGNLLWLSHSSADLEPLLRRLIA 58637
58636 VYGPVVSLRVGSHLSIFVADRRVAHAALVERGAALADRPEVTRALLGENGNTISRGNYGP 58457
58456 TWRLLRRNLVAETLHPSRARAAFAPARSWARRALVDGLVGGGAVLADAFRHAMFCL 58289
58288 LVLMCFGEWLDEAAVRAIGDAQHGWLLHYATKMKVFAFCPAVTKHIFRGRIQTSLALRRR 58109
58108 QKELFMPLISARRERKNQLAERAVPEKETTTFEHSYVDTLLDIKLPEDGGDRALTDDEMV 57929
57928 RLCSEFLDAGTDTMSTTLQWIMAELVKNPSIQSKLHDEIKSKTSDDHDEITEEDTQKMPY 57749
57748 LKAVILEGLRKHPPGHFALPHKAAEDMEVGGYLIPKGATVNFMVAEMGRDEKEWENPMEF 57569
57568 MPERFLPGGDGEGVDVTGSKGIRMMPFGVGRRICAGLNTAMLHLEYFVANMVREFEWREI 57389
57388 AGEEVDFAEKLEFTTVMAKPLRAQLVRRRMN* 57293

>AC068924.9g $P Starts at 259 gene 7 pseudogene fragments
64765 KRPATVPENDTTFEHSYVDTLLDLRLPEDGDRALTDKAMVCLCSE 64631
64626 LDSGADTMSTTLPWIMAELVKNPSIQAKLYEEIKATVSDDHDEITEEDTQKMPYLKAVIL 64447
64446 EGLRKHPLGHFALPHKAAEDMDVGGYLIPKGATVNFMVAEMGRDEREWENPMQFMPERFL 64267
64266 PGGDGEGVDMTGSKRIRMMPFGVGRRMCAGINTAMLHLEYFVANMVREFEWKAVVGDKVD 64087
64086 FAEKL 64072 EFTTVMAKPLRAQLVLRSVD 64013

>AC068924.9h $P 47% to 89A2 two stop codons and frame shift gene 8
69888 MTIDASPWLLLLVAFLFPFFVLRSLRSDGKGGGRGGGCRVPPGPLAVPVLGNLLWLWHSPADLE 69691
69690 PLLRRLIARHGPVVSLGVGSRLSIFVADRRVAHAALVERGAALADRPEVTRALLGENGNT 69511
69510 ITRASYGPTWRLLRRGLVSGTLHPSTTRARVFAPARSWARRVLVGKLAAASGQAPHGVMD 69331
69330 TLQYAMFCLLVVMCFGERLDEADVRAIATAQHDWIVYFATKMRVFAFCSTITKHLFRGRI 69151
69150 KMALALRRRQKELFVPLINARRERKTRTQPTLPENGTTFEHSYVDTLLDLRLPEDGNRAL 68971
68970 TDKEMVSLCSEFLDAGTDTMSTALQWIMAELVKNPSI*SKLYDEIKATVSDDHDEITEDD 68791
68790 TQKMPYLKAVILEGLRKHPPGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAEMGRDEREW 68611
68610 ENPMQFMPERFLPGGDGEGVDMTGSKRIRMMPFGVGRRMCAGLNTAMLHL*YFVANMVRE 68431
68430 FEWKAVVGDKVDFAEKL 68380 EFTTVMAKPLRAQLVLRSVD* 68318

>AC068924.9i $F 51% to 89A2 no s gene 9
86433 MATDTSWLLLLVALVLPLVVLLARRRRSGGGSRRIPPGPLAVPVLGSLLWLRHSSANLEPLLQRLI 86236
86235 ARYGPVVSLRVGSRLSIFVADRRVAHAALVERGAALADRPDVTRSLLGETGNTITRSS 86062
86061 YGPVWRVLRRNLVAETLHPSRVRLFAPARSWVRRVLVDKLADGARPESEPPRPRVVVETF 85882
85881 RYAMFCLLVLMCFGERLDEAAVRAIGAAQRDWLLYVARKTSVFAFYPAVTKHIFRRRLQI 85702
85701 GLALRRQQKELFVPLIDARRARKNHIQQAGGPPVPEKETTFEHSYVDTLLDVSLPDTDGD 85522
85521 SALTEDELVMLCSEFLNAGTDTTATALQWIMAELVKNPSIQSKLHDEIKSKTSDDEIT 85348
85347 EEDTHDMPYLKAVILEGLRKHPPAHFVLPHKAAEDVEVGGYLIPKGATVNFMVAEMGRDE 85168
85167 REWEKPMEFIPERFLAGGDGEGVDVTGSREVRMMPFGVGRRICAGLGVAMLHLEYFVANL 84988
84987 VKEFEWKEVAGDEVDLTEKNEFTTVMAKPLRAQLVKRA* 84871

>AC068924.9j $F 48% to 89A2 gene 10
92213 MAIDATQWLLLLVVFLVAFLFTLLAKHGAVKRKHGVRVPPGPLAVPVLGSLVWLTHSSSANLEPLLR 92013
92012 RLIARHGPVVSLRVGSRLSIFVADRRVAHAALVGRGAALADRPPDVTHSLLGESRNTITR 91833
91832 SGYGPVWRLLRRNLVVETTHPSRVRLFAPARSWVRRVLVDKLADAGAHPASPPRVLEVFR 91653
91652 YAMFSLLVLMCFGERLDEAAVRAIGAAQHDFLLYLGRKTSVFMFYPAITKHLFRGRVHLG 91473
91472 LAVRRRQKELFMPLIDARRERKKQIQQSGDSAASEKKKDDNTTFNHSYVDTLLTIRLQDV 91293
91292 DGDGDRALTDDEMVSLCSEFLSAGTDTTATALQWIMAELVKNPSIQSKLYEEIKATMSGD 91113
91112 NDDEINEDDARNNLPYLKAVILEGLRKHPPMHLLLPHKAAEDVEVGGYLIPKGATVNFMV 90933
90932 AEIGRDEKEWEKPTEFIPERFMAGGGDGEGVDVTGSREIRMMPFGAGRRICAALSVAMLH 90753
90752 LEYFVANMVKEFEWKEVAGDEVDFAERLEFTTVMAKSLRVRLIKRA* 90612

>AP004769.1 $F 45% to 89A4 65% to Lolium rigidum clone Lol2 AF321865
50173 MEETWLFLLFSISLVAVLLATARRRRSSSIKARLPPGPSPLLFLAKFLRLRRSIFDLGPLLRDL 49982
49981 HARHGPVISIRLFGTTLVFVADRRLAHRALVQGGSTFADRPPLPELGRLFTSDTRDINSS 49802
49801 PYGPYWRLVRRNLASEALSPARVALFAPARRRARDVLVRGLRDRGGDGSRPVELRPLLRR 49622
49621 AMFELLLYMSLGARLAPEALEEVERLELWMLRAFTSFPVFSFFPAITKRLFRNQWAAHVA 49442
49441 VRRRVGEIYVPLINARRAGDGDGDDPPCYTDSLLQLRVAEEGDRPLTDDEIIALCSEFLN 49262
49261 AGTDTTVTLVEWIMAELVNRPDIQAKVHDEVRRRPELTEADLQAMPYLKAVVL 49103
49102 EGLRLHPPAQFLLPHGVQSDAEVGGYVVPRGAELNVWVAELGRDEVVWTAAREFMPERFM 48923
48922 DGGEVEVDVTGSREITMMPFGVGRRMCPGYTVGTLHAEYLVGSLVRELEWLP 48767
      ETEGEAADMAEELDFTTVMKHPLRARVLPRPSSLY* 48655

>AP003723.1 $F chromosome 6 clone P0003H08 60% to CYP77B1
127597 MVDMNDVLLVVSAAVLAAMWWRRCSRTGGADG
127693 LPPGPPGWPVVGNLFQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTDADLIHD 127869
127870 ALVKQGAAFASRPEDSPTRLLFSVGKCTVNSAPYGPLWRALRRNFVAEIVSPPRVKGFSW 128049
128050 IREWAVGSHLRRLRAEFAATGAVRMMANCRLSICSILICICFGAKIPDELIREIEEVLKD 128229
128230 VMMMTMPKLPDFLPLLTPLFTKQLAAARELRRRQLGCLAPLVRARREFIRGGGERNA 128400
128401 DGNTVVGGVEMVSAPGEAYVDSLFDLEPPGRGKRLGEDELVTLCSEVMSAGTDTSATAL 128577
128578 EWAMMHLVLDAGVQDKLYGEVVSKVGTTARITEADVEAMPYLQ 128706 (0)
129997 AVVKETFRRHPPSHFVLSHAATRDTELGGYRVPADASVEFYTAWVTENPATWPDP 130161
130162 EAWRPERFLEGGEGFDTDITATRALRMMPFGAGRRICPAATLGVLHIQLMLANMVREFRW 130341
130342 VPPAGEGPPDPTETFAFTVVMKNPLRAALVERRVGGELATGGGGGAAASA* 130494

>AP005419.1 Oryza sativa (japonica cultivar-group) chromosome 9 clone
AP005570.1a 4 genes and a pseudogene seq  of gene 1 shown below
AQ575117.1 nbxb0086B24r CUGI Rice BAC genomic cloneLength = 830 
70% to rice 92 seq above ortholog of AAAA01038529.1 aaaa01083800.1 AAAA01003216.1
1053 MEVALCASFVAILLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHE 1232
1233 LSRRYGPLVYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWS 1412
1413 PCDAYWRQARRVVLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLS 1592
1593 TASLNMITRMVMGKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLE 1772
1773 WLDLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLEV 1952
1953 KLSRDSIKAFTQ 1988 (0?)
4609 DLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEAIV 4788
4789 KETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFMPERF 4968
4969 LGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDLSM 5148
5149 EEIFGLSMPRKFPLEVAVEPKLSSHLYKGD 5238

>AAAA01038529.1 (indica cultivar-group) 74% to D24290 ortholog of AP005419.1
860  VAILLTTMLFLRAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRYGPL 1036
1037 VYLRFGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAYWR 1213
1214 QARRVVLTELFSARRIESYEHIRREEV 1294

>aaaa01083800.1 (indica cultivar-group) ortholog of AQ575117.1 100%
MGKRYVQGEVVHEEPGSARTTLAQFKELLEELFF
577 LNGVFNVGDQIPWLEWLDLQGYVKRMKKVSKALDQLLEHVVDEHSERRQREGNGFVAGDM 398
397 VDVLLRLADDSSLEVKLSRDSIKAFTQ 317

>AAAA01003216.1a (indica cultivar-group) runs off end of clone (partialI)
ortholog of AP005419.1
2851 DLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPY 3015
3016 IEAIVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEF 3195
3196 VPERFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVK 3375
3376 EDLSMEEIFGLSMPRKFPLEVVVEPKLSSHLYKGD* 3483

>AP005570.1b 4 genes and a pseudogene seq  of gene 2 shown below
16178 MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH 15999
15998 SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW 15819
15818 SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASGRVVALKDYL 15651
15650 SAASLNVISRMVLGKKYLEREVVHEGEVVTTPERFRWMIDELFLLNGVLDIGDSIPWL 15477
15476 GWLDLQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLE 15297
15296 VKFSRDSVKAFTQ 15258 (0?)
13216 DLIAGGTESSSATVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTEK 13073
13072 DIPSLPYIDAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPKL 12893
12892 WDAPEEFMPERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAWR 12713
12712 LPDGMTKEQLSMEEIFGLSTPRKFPLEVVVEPKLPADLY 12596

>AP005570.1c 4 genes and a pseudogene seq  of gene 3 shown below
= D24290 $F AU070773 N-TERMINAL 67% to 92A2 C19482
AQ327338 AU068589 67% identical to C72289 76% to 92A2 PKG to end
AU068590 I-helix region 77% to CYP92A2
AU091996.1 AU091996 Rice cDNA clone R10225.Length = 435 198-328 region
D49064 60% to 92A2  3/95  8/95 432-508 REGION very similar to AQ327338
BI306309
21127 MLPPWASFVGVVLATVLFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKKYG 20936
20935 PLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGAYW 20756
20755 RQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAGGVVVLKDYLSTVSLNV 20588
20587 ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQG 20423
20422 YIKRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLEVKLKREG 20243
20242 VKAFTQ 20225 (0?)
19497 DLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLT 19336
19335 YVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEE 19156
19155 FMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVT 18976
18975 REQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLY 18877

>AP005570.1d 4 genes and a pseudogene seq  of pseudogene 4 shown below
pseudogene possible ortholog of AAAA01006146.1a $PI 4 diffs 94%
32984 MELPPWPSLLVIVLTAVVFFLATILCHGRRVYRLPLGPKPWPIIGNLNLIGALPHRSIHE 33163
33164 LSKRYGPLIQLRFGS 33208

>AAAA01006146.1a $PI (indica cultivar-group) N-term fragment does not continue
4120 LLVIVLTAVVFFLATILRHGRRAYRLPLGPKPWPIIGNLNLIGALPHRSIHELCK 4284
4285 RYGPLIQLQFGSC

>AAAA01006146.1b $PI (indica cultivar-group) N-term (plus strand)
13148 MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHELSK 13342
13343 RYGPLMQLRFGSFPVVVGSSAEMARFFL (?) KSHD 13522
13523 IVFTDRPRTAAGKHTTYNYTDILWSPYGAYWRQARKMCVTELFSARRLESFEH 13681

>AP005570.1e 4 genes and a pseudogene seq  of gene 5 shown below
ortholog of AAAA01006146.1c $PI 100% first 199 aa (not a pseudo in japonica)
47412 MELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHE 47591
47592 LSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILWS 47771
47772 PYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLHGAAAPVLLRDYLS 47936
47937 TATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKMMMDELFLLSGVLNIGD 48116
48117 FIPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGDRFAARDLVDVLLQLAD 48296
48297 DPNLEVQLRRDNVKALTQ 48350
48452 DLIAGGTDTSAITVEWAISELLRKPEILAKATEELDRVVGRGRLVTETDMTSLPYVEAI 48628
48629 VKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEEFMPER 48808
48809 FIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKVIQLSLASLLHGFEWRLPDGVSAGELS 48988
48989 MEEVFGLSTPRKVPLEVVVKPKLPAHLYTG 49078

>AAAA01006146.1c $PI (indica cultivar-group) N-term (minus strand)
14402 MEMELPSWASVLVIVLAAVVFLLATILRHGRRAYRLPPGPNPWPIIGNLNLIGALPHRSIHELSK 14208
14207 RYGPLMQLRFGSFPVVVGSSAEMARFFL (?) KSHD 14028
14027 IVFTDRPRTAAGKHTTYNYTDILWSPYGAYWRQARKMCVTELFSARRLESFEHIRGEEV 13851
13850 RALLRDLH 13827
13826 GAAAPVLLRDYLSTATLGVISRMVLGKKYVGVEGASA 13716 
only 34 bp until seq b on opposite strand

>AP003711.1 $F chromosome 6 clone P0417G12 45% to 93D
85884 MDHQLVARGLFKPLLLFVAGLIVLYALRRRRRHRRSSGLR 
85764 LPPSPFGLPILGHLHLLAPLPHQALHRLAARHGPLLFLRLGSVPCVAACSPDAAREVLKT 85585
85584 HEAAFLDRPKPAAVHRLTYGGQDFSFSAYGPYWRFMKRACVHELLAGRTLDRLRHVRR 85411
85410 EEVARLVGSLRASADGGERVDVDAALMGLTGDIVSRMVMGRRWTGDDNDAEEMRSV 85243
85242 VAETAELTGTFNLQDYIGVFKYWDVQGLGKRIDAVHRKFDAMMERILTAREAKRKLRRQA 85063
85062 AADGEDDEKDLLDMLFDMHEDEAAEMRLTRDNIKAFML (0)
84873 DIFAAGTDTTTITLEWALSELINNPPVLRKLQAELDAVVGGARLADESDIPSLPYLQ 84703
84702 AVAKETLRLHPTGPLVVRRSLERATVAGYDVPAGATVFVNVWAIGRDAAWWPEPTAFRP 84526
84525 ERFVSGGGGGGTAADVRGQHFHLLPFGSGRRICPGASLAMLVVQAALAAMVQCFEWSPVG 84346
84345 GAPVDMEEGPGLTLPRKRPLVCTVSPRIHPLPAAASASLT* 84223

>AP004070.1 $P chromosome 2 clone OJ1705_E12 two pseudogene fragments like AP003711
107009   AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSA 107110
108243 RRAAVHELLAGRTLDRLRHVGREEVARLVGSLSRSAANGEHVDADAALMGLTSDIVSRMV 108064
108041 GDDNDTEEMWSVVAETAELTSTLNLQCEVIIILVVAVEQPGEVVVVVGAALVNEEVNAVHRR 107856 

>AP004013.1 $P chromosome 8 clone OJ1575_B01 pseudogene fragment like AP003711
74046 RRPAGPGLRLPPSPFGLPILGHLHLLTPLPHQALHRLAACHGPLLYLRLGSVPCVAACSP 74225

>AP003759.1 $P chromosome 7 clone OJ1567_G09, pseudogene fragments like AP003711
100882 RRRRRHLPQQGRRLPRREAGGAPLPRAALAHDGARHG 100772
112892 AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSA 112993
114111 AAVHELLAGRTLDRLRHVGREEVARLVGSLSRSAANGEHVDADAALMGLTSDIVSRMVN 113935
113934 W*WAGDDNDTEEMWSVVAETAELTSTLNLQGEVIVILVVAVEQPGEVVVVVGAALVNEEV 113755
113754 DAVHRR 113737

>AL606632.1 $P chromosome 4 clone OSJNBa0042L16 pseudogene fragments like AP003711
79792 VHELLAGLTLDRLRHVRREEVARLVGSLSWSATDAEHVDVDAALMGVTSNIVPRMVMGRR 79613
79612 WTGDDNDMEEMRSVVAETAELTGDLVYQD 79526
79515 RGRQAELDAVVGDLQAVAKETLRLHPT 79435

>AC096855.1 $F chromosome 3 clone OJ1365_D05 54% to AC087550 73% to AF321860 Lolium rigidum
87309 MDDYFFLQSLLLCVAAVALLQLAKVAATMRRRPRTPPGPWRLPVIGSMHHLVNALPHR 87136
87135 AMRDLAGVHGPLMMLRLGETPVVVASSRGAARAVLKTHDANFATRPRLLAGEIVGYGW 86962
86961 ADILFSPSGDYWRKLRQLCAAEILSPKRVLSFRHIREDEVTARVEEIRAAAAPSTPVNLS 86782
86781 VLFHSTTNDIVARAAFGRKRKSAPEFMAAIKAGVGLSSGFKIPDLFPTWTTALAAVTGMK 86602
86601 RSLRGIHKTVDAILQEIIDERRCVRGDKINNGGAADDQNADENLVDVLIALQEKGGF 86431 (1)
86339 GKSVTTPWVIVTHMICTLDVQDMFAGGTGTSASALEWAMSELMRNPAVMKKLQGQIREAFH 86157
86156 RKAVVTEADLQASNLRYLKLVIKEALRLHPPAPLLVPRESIDTCELDGYTIPAKSRVIVN 85977
85976 VWAIGRDPK Y*Y*E DAEEFKPEQFDDDAIDFMGGSYEFIPFGSGRRMCPGFNYGLASMEL 85797
85796 VLVAMLYHFDWSLLVGVKEVDMEEAPGLGVRRRSPLLLCATPFVPAAVSADY* 85638

>AC087544.2 $F chromosome 10 clone nbxb0046P18, 
14167 MEDKLLLLLALAVSVLVAVVISKLVSYATKPRLN
14065 LPPGPWTLPVIGSIHHLVGSHPIHRSMRALAEKHGRDLMQVWLGELPAVVVSSPEAARDV 13886
13885 LRSQDLAFADRYVSTTIAAIYLGGRDLAFAPYGERWRQLRKLCTQRLLTAARVRSFRCVR 13706
13705 EEEVARLVRDLAASAAAGEAVDLTARVAELVNDVVVRCCIGGRRSRYRDEFLDALRTALD 13526
13525 QTTWLTVADVFPSSKLARMLGTAPRKALASRKKMERILEQIIQERKQIKERSTGAGAGAD 13346
13345 DEAAAAGNECFLDVLLRLQKEGDTPIPITNETMMLLLH 13232 (0)
10760 NMFSAGSETSSTTLNWTMAELIKSPRVMAKVHDEVRQAFQGKNTITDDDVAKLSYLKMVT 10581
10580 KESLRMHCPVPLLGPRRCRETCKVMGYDVPKGTIVFVNAWAICRDSKYWKSAEEFKPERF 10401
10400 ENISIDYNGNNFEFLPFGSGRRICPGITLGMANVEFPLASLLYHFDWKLPNQMEPEEIDM 10221
10220 REAPGLVGPKRTSLYLHPVTRVAPSSV* 10119

>AC087550.2 $F chromosome 10 clone nbeb0016G17 same as seq on AC087544 from 13082
139422 MEDKLPLALTVLSVSVLIAVVISKLVSYATKPRLNLPPGPWKLPVIGSLHHLVGSHAIHR 139243
139242 SMRALAEKHGRHHLMQISLGEVFAVVVSSPEAAEEILRNQDVTFADRFLSTTIGVITFGG 139063
139062 NDMAFAPYGERWRQLRKLCTLELLSAARVRSFRRIREEEVARLVRDLAASAAAGEAVNLS 138883
138882 GRIAKLINDVVVRCCVGGRSEHRDEFLDALRTALDQTTWLTVADVFPSSKLARMLGTAP 138706
138705 RKALASRKKIEHILEQIIQERKRIMDRSSHGGDGDGEAMNTSECFLDVLLRLQKDGNT 138532
138531 PIPITNEVIVVLLF (0)
136455 DMFSGGSETSSSTLIWTMAELIRKPKVMAKAHVEVRQAFQGKNTITEDDGVNELTYLKMV 136276
136275 IKESLRMHCPVPLLGPRKCRETCKVMGYDIPKDTTVFVNAWAICRDPKYWDDAEEFQPER 136096
136095 FENKSIDFKGSNFEFLPFGSGRRMCAAMNLGIANVELPLASLLYHFDWKLPDGMMPEDVD 135916
135915 MQDAPGILVGKRSSLIMCPVTRVAPSNPQVIAS* 135814

>AP003805.1 $F chromosome 7 clone OJ1080_F08, similar to AC087550.2
10416 MEDKVLLAVGASLVLVFLSKLISSYAKKPRLNLPPGPWTLPLIGSAHHLVSWSESVHSVIGKLAREHGPVMQ 10201
10200 LWLGEVPTVVASSPEAAQEILRDHDLIFADRHLTSTTAAITFGGTDVVMAQYGERWRHLR 10021
10020 KLLTQELLTVARVRSFRRVREEEVARLVRDLSAAAASGATVNLTDMVNRLVNDTVLRCSV 9841
9840  GSRCKYREEFLAALHAILHQTSALSVADLFPSSKLASMVATGPRNVLANRNKVERI 9673
9672  IEEIIQERKNQIETDMMSGNDDVGDKAAVESKSCSLDVLLRLQKEGGTPIPITNQVITVLLW (0)9487
3785  DMFGAGTDTSSTTLIWTMAELMRSPRVMAKVQAEMRQAFQGKNTITEDDLAQLSYLKMVL 3606
3605  KESFRLHCPVPLLSPRKCRETCKIMGYDVPKGTSVFVNVWAICRDSMYWKNAEEFKPERF 3426
3425  EDNDIELKGSNFKFLPFGSGRRICPGINLGWANMEFALANLLYHFDWNLPDGMLHKDLDM 3246
3245  QESPGLVAAKCSDLNVCPVTHISSSCA* 3162

>AC087550.2 $F chromosome 10 clone nbeb0016G17 74% to AC087554 seq 14167
132002 MDDKLLQLLLLALAVSVVSIVTISKLVYRATNKPRLNLPPGPWTLPVIGSLHHLVMRSPS 131823
131822 IHRSMRALAEKHGPLMQVWLGEVPAVVVSSTEAAEEVLKNQDARFADRFITTTLGAITF 131646
131645 GGGDLAFAPYGERWRHLKMLCTQQLLTAARVRSFRRIREEEVARLVRDLAASAAGGGEVA 131466
131465 VNLSERVARLVNDIMVRCCVGGRSKHRDEFLGALCTALSQTSWLTVADLFPSSRLARML 131289
131288 GTAPRRALASRKKMELILEQIIQEREEMTTDRSGDGEAGPTNECFLDVLLRLQK 131127
131126 EGDTPIPITMELIVMLLF 131073 (0)
       DIVSGGTETSTIVLNWTMAELIRTPRVMTKAHAEVRQTFQAKSTITEDDDISGL 129741
129740 TYLKMVIKESLRMHCPVPLLGPRRCRETCKVMGYDILKDTTVFVNAWAMCRSSIYWNDAE 129561
129560 EFKPERFENKCIDYKGSNFEFIPFGSGRRMCAGMNLGMADVEFPLASLLYHFDWKLPDGM 129381
129380 SPEDIDMQEAPGLFGGRRTSLILCPITRVAPSDLQVIV* 129264

>CYP98A4 AC108505.1 $F chromosome 5 clone OJ2086B07, Length = 79991
72630 MDVASLLPFALALVAIPISLALLDRLRLGRIPPGPRPWPMVGNLWQIKPVRCRGFLEWAERYGPIVSVW 72836
72837 FGSSLNVVVSTSELAKEVLKENDQLLADRPRNRSTQRFSRNGMDLIWADYGPHYIKVRKL 73016
73017 CNLELFTPKRLEALRPIREDEVTAMVESVHRAVTQP (1) 73124
74708 GSEHKPIVVRNHLAMVAFNNITRLAFGKRFMNANGDIDEQGREFKTIV 74851
74852 NNGIKIGASLSVAEYIWYLRWLCPLNEELYKTHNERRDRLTKKIIDEHAKALKESGAKQ 75028
75029 HFVDALFTLREQYDLSDDTVIGLLW 75103 (0)
75681 DMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMSETDFQSLPYLNAVV 75860
75861 KESLRLHPPTPLMLPHKASTNVKIGGYNIPKGANVMVNVWAIARDPKVWSNPLEYRPERF 76040
76041 IEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHQFEWSLPEGTRPEDVNM 76220
76221 MESNGVVTFMSTSLQVIAKPRLDNPDLYKRFPVEM* 76328

>AQ869247.1 BAC 53% to 99A1 AZ130570.1 BAC Ortholog to aaaa01013880.1 $FI 99%
(0) DMFAAGSETSSTTLEWALTELVRNPHIMEKAQSEVREIFRGENKLTEEMMD 279
280 KLSYLRLVIRETLRLHLPVPFLLPRQCREPCSVMGYDIPVGTKVLVNAWAIARDNQ 447

>aaaa01004604.1 (indica cultivargroup) 52% to 701A3 ortholog of AF088220 AP005302.1c
4885  MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPPP 5019 
8461  AVPGLPIIGNLHQLKEKKPHQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKE (0?) 8622
9972  AMIDKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQ (0?) 10130
10237 FRGTRERMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQ (0?) 10371
10526 SLGEDVSSVYVEEFGREISKDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIVSTTEFR
10721 RDAIMNALIKKQKERIARGE (0)
10866 ARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIAKNPDKQ (0) 11033
11380 ELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDDTTLAGYD 11556
11557 IAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAGRRTCAGSLQ 11736
11737 AMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRGRM* 11892

>AP005302.1c (japonica cultivargroup) chromosome 6 
AF088220 48% to 701A3 mRNA BF430785 OG04F06T3
51052 MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPPP (1) 51186
      AVPGLPIIGNLHQLKEKKP 54671
54672 HQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKE (0?)
56126 AMIDKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQ (0?) 56284
56388 FRGTRERMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQ (0?) 56525
56680 SLGEDVSSVYVEEFGREISKDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIV 56856
56857 STTEFRRDAIMNALIKKQKERIARGE (0?)
57020 ARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIAKNPDKQ (0) 57187
57534 ELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDDTTLAGYD 57710
57711 IAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAGRRTCAGSLQ 57890
57891 AMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRGRM* 58046

>AP005302.1d (japonica cultivargroup) chromosome 6 new ortholog to AAAA01009744.1 
88169 MESLLAAGAGGIGVAAAAAVVAATLAVVPPKDRGNNPPP 88285 (1)
      AVPGLPVIGNMHQLKEKK 91433
91434 PHHTFTKWSKTYGPIYTIKTGASSVVVLNSTEVAKE 91541 (0?)
96519 QAMIEKFSSISTKKLPKALSVISRKNMVSISDYGDFYKMAKRNIMLAILGFNAQ (0?)
      FCDTRERMVSNVLSSLHKLVAVDPHSPLNF 96878
96879 REVYTTELFGLSLIQ (0) 96923
97128 NLGEDVCSVYVEEFGREISKEEIFHVLVHEILSCVVEPDWRDYFPYLSWLPNKSFETIV 97304
97305 SSTEFRRDAVMNALIKRQKERIARGE
      ARISYIDFLLEAKNSTQLTDHQLMLLLAESIAAAVDTVLVTTEWAMYELAK 97664
97665 NPDKQ (0) gc boundary
      EWLYREIREVCGGK 97844
97845 AVTEEDLPRLPYLDAVLHETLRLHSPVPVLPTRFVHDDTTLAGYDVPAGTQVMINVFGCH 98024
98025 MDEEAWESPGEWSPERFLGEGFKLADRYKTLAFGAGRRTCAGSQQAVSIACVAIARFVQE 98204
98205 LQWTLREGDGDKEDTMQYTALKLHPLHVHLKPRG 98306

>AAAA01009744.1 ortholog to AP005302.1d 100%
9058 QAMIEKFSSISTKKLPKALSVISRKNMVSISDYGDFYKMAKRNIMLAILGFNAQ
     FCDTRERMVSNVLSSLHKLVAVDPHSPLNF 8699
8698 REVYTTELFGLSLIQ 8654
8451 QNLGEDVCSVYVEEFGREISKEEIFHVLVHEILSCVVEPDWRDYFPYLSWLPNKSFETIV 8272
8271 SSTEFRRDAVMNALIKRQKERIARGE
     ARISYIDFLLEAKNSTQLTDHQLMLLLAESIAAAVDTVLVTTEWAMYELAK 7912
7911 NPDKQ
     EWLYREIREVCGGK 7732
7731 AVTEEDLPRLPYLDAVLHETLRLHSPVPVLPTRFVHDDTTLAGYDVPAGTQVMINVFGCH 7552
7551 MDEEAWESPGEWSPERFLGEGFKLADRYKTLAFGAGRRTCAGSQQAVSIACVAIARFVQE 7372
7371 LQWTLREGDGDKEDTMQYTALKLHPLHVHLKPRG 7270

>AC087597.1c $F chromosome 1 clone OSJNba0088C22 Nterminal = AU163509.1
128653 MEAFVPGGAGAAAXAVGGFVAAAALAERAGVIAPRKRPNAPP 128781 (1) alt exon 1
129691 PGGVGAAAVAAVGGFVAAAALAERAGVIAPRKRSNAPP 129807 (1) alt exon 1
131498 MEAFVPGGAGAAAPAVAAVGGFVAAAALAERAGVIAPRKRTNAPP 131632 (1) 
134410 AVPGLPIIGNLHQLKEKKPHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 134571 (0)
134666 AMVAKFSSISTRKLSKALTVLTRDKSMVATSDYCDFHKMVKRYVMSSMLGTSAQ 134827 (0)
134988 FRDIRDMMIHNMLSTFHKLVKDDPHAPLIFRDVFKDELFRLSMIQ 135122 (0)
135206 SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFPYLSWVPNKSFETRV 135382
135383 FTTETRRTAVMRALIKQQKERIVRGE 135460 (0)
135577 AKTCYLDFLLAENTLTDEQLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQ 135747 (0)
       ERLYQEIREVCGDETVTEEHLPRLPYLNAV 135924
135925 FHETLRRHSPVPLIPPRFVHEDTKLAGYDVPAGTE 136029 (0)
136597 MVINLYGCNMNRKEWESPEEWVPERFAGGRLEVADMYKTMAFGAGRRACAGSLQATHIA 136773
136774 CAAVARFVQEFGWRLREGDEEKVDTVQLTAYKLHPLHVHLTRRGRM* 136914

>AP005302.1b (japonica cultivargroup) chromosome 6 = AC087597.1a $F
21490 MESLLAAGAGGIGVAAAAVGGFIAAATLAVAPPKNRRNPPP (1) 21612
25799 AVPGLPIIGNLHQLKEKKPHQTFTKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 25960
26073 AMVAKFSSISTRKLSKALTVLSHDKSMVATSDSGDFHKMGKRYIMLSMLGTSAQ
      FRDTRDMIINN 26429
26430 MLSTFHQLVKDDPHAPLIFRDVFKDELFRLSMIQ 26531
      SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFPYLSWVPNKSFETR 26788
26789 VFTTESRRTAVMRALIKQQKERIVRGE 26869
27814 ARTCYLDFLLAENTLTDEQLMMLVWEALIEAADTTLVTTEWAMYELAKNPDKQ 27981
      ERLYQEIREVCGDEAVTEEHLPWLPYL 28161
28162 NAVFQETLRRHSPVPLIPPRFVNEDTMLAGYDVPAGTE 28275
30064 MVINLYGCNMNKKEWESPEEWAPERFAGGRFKVADMYKTMAFGAGRRVCAGSLQATHIA 30240
30241 CAAIARFVQEFGWRLREGDEEKVDTVQLTAYKLHPLHVHLTPRGRM 30378

>aaaa01001279.1 (indica cultivargroup) ortholog of AP005302.1a
AVPGLPIIGNLHQLKE 20880
20881 KKPHQTFAKWAEIYGPIYTIRTGASSVVVLNSTEVAKE 20994

>AC087597.1b $F chromosome 1 clone OSJNba0088C22 CYP703A1 like
115151 MEAFVSGGAGGVGAAAVVGVFVAAAVVGGFVAAVALAERAGVIAPRKRPNAPP 115309 (1)
116986 AVPGLPIIGNLHQLKEKKPHQTFTKWAEIYGPIYTIRIGASSVVVLNSTEVAKE 117147 (0)
       AMVAKFSSISTRKLSKALTVLTRDKSMVATSDYGDFHKMVKRYVMSSTLGTSAQ 117420 (0)
117581 FRDTRDMMINNMLSTFHKLVKDDPHVPLIFRDVFKDELFRLSMIQ 117715 (0)
117799 SLGEDVSSVYVDEFGRDISKEEIYNATVTDMMMCAIEVDWRDFFSYLSWVPNKSFETRV 117975
117976 FTAEARRTAVMRALIKQQKERIVRGE 118053 (0)
119442 AKICYLDFLLAENTLTDEQLTMLVWEELIEAADTTLVATEWAMYELAKNPDKQ 119612 (0) 
119689 ERLYQEIREVCGDETVTEEHLPRLPYLNAVFHETLRRHSPVPLIPPRFVHEDTKLAGYD 119865
119866 VPAGTE (0)
120626 MVINLYGCNMNKKEWESPEEWVPERFTGGRLEVADMYKTMAFGAGRRACAGSLQVMHIA 120802
120803 CTAIARFVQEFGWRLTEGDEEKVDTVQFTAYKLHPLHVHLTPRGRM* 120943

>AP004591.1 chromosome 8 clone P0582D05, Length = 150428 Same as AU064265 C73739 71% to 703A2
4227 MDPFLLSIILCSW
4188 IFVVVSWKKLNCMRRRLPPGPPRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTID 4009
4008 AITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHL 3829
3828 LTTKRLESFAAHRALEAEHLCQFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL 3649
3648 QSAGPGEAMEFMHITHELFWLLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQ 3475
3474 KIIDEHRKAREAKKSASLDDDNKEDMDFVDVLLSLPGENGKEHMDDVEIKALMQ 3313
2680 DMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDGVVGRGRMVAESDLGQLTYLRCVV 2501
2500 RESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINTHALGRNTRIWDDVDAFRPERH 2321
2320 LPASADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFDWSPPDGLR 2141
2140 PDDIDTQEVYGMTMPKAKPLVAVATPRLPPQMYGRHGKQV* 2018

>AP003870.1 $F chromosome 8 clone OJ1116_A04  70% to D24290 related to 92A
9007 MEPSALATLLSMALAAFLLLGLIKRKGSRRGYN
8908 LPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMARLVLKT 8729
8728 HDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEHIRA 8555
8554 DEVRALVRGLFAAASSGRSGAVHLNRDHLSTLSMNVITRMVLGKRFFGEGADAAEGPVST 8375
8374 LSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLDEHSER 8195
8194 RRREGEAFVARDMVDVLMDLADDPSLEIKLGRVGVKAFTQDLIAGGTESSSVTVEWALSE 8015
8014 LFKNPAIFATATDELDRVVGRCRWVTEKDIPNLPYLDAIMKETMRMHPIVPLLIPRVARD 7835
7834 DAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFELLPFGSG 7655
7654 RRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYPLQVVVEPRLPVQLYSL* 7445

>AP003927.1 $P chromosome 7 clone OJ1120_A01, pseudogene fragment related to CYP92A
58933 PLLVPHHARENTVVAGYDVPAGTRVLVNLWAIARDPASWLDRPDAFLPERFLPGAGSCDD 59112
59113 VVDVHGQHFELLPFESGRQIYPATNLAKKMVALGVASLLQGFAWR 59247 7 aa deletion and 
59250 EDVSMEELVGLSTRRKVPLVAVAEPRLPAHERR* 59351

>D40799 $P 56% TO 76C1  11/94 447476 REGION 2 diffs with AP003927.1 = AQ578139
RRISPATNLAKKMVALGVASLLQGFAWRLPD (fs) EDVSMEELVRLSTRRKVPLVTVAEPRLPPHLYAAAAA*

>aaaa01027238.1 $P (indica cultivargroup) similar to AP003927.1
note the fs is in the same place  This is a conserved pseudogene 
1448 PLLVPHHARQDTVVTG 1401
seq. gap
1291 RVLVHVRAIAPDPASWPDRTDAFLPERFLPGAGGCDGGVDVHGQHFELLPFGSGRRISPA 1112 
1111 TNLAKKMVALGVASLLQGFAWRLPD (fs) 1037
1035 EDVSMEELVRLSTRRKVPLVTVAEPRLPPHLYAAAAA* 922

>AT003629.1 Magnaporthe grisea infected rice cDNA cDNA clone mgir2I19.Length = 468
119 knvsmkxLVGLSTRRKVPLVAVAEPRLPAHlyagtaa* 232

>aaaa01010885.1 (indica cultivargroup) ortholog of AT003629.1
 759 MAMSSWVATIVTLLIGVAVASLRGRQRRTKARLNLPPGPRGWPVFGSLGALAGALPP 929
 930 HRALAALAARHGPLMHLRLGSFDAVVASSAGAARLVLKTHDAAFADRARTAAGELVAYNY 1109
1110 KGIVHTPYGAYWRMARKLCATELFSPRRVDSYERIRAEEIGALARDLFGRAGRAVAVRER 1289
1290 LASATLRNILRMSVGDKWSGVYGSADGEAFRRTLDEAFEVSGAVSNVGEWVSLLGWL 1460
1461 DVQGFRRRMKRLSKMYDRFLEQILHEHEASMAAAGDGGQPAAAACDLVDVLLQLSGEEEE 1640
1641 GSAGAGADSEARLTRDGVKAFILDIIAGGTESSAVAMEWAMAELLRRPDAMAAATDELDR 1820
1821 VVGTARWVTERDIPDLPYVDAVVKEALRLHPVGPLLVPHHAMEDTVVAGGYVV 1979
1980 PAGARVLVNAWAIARDPASWPDRPDAFLPERFLPGGGAAAAGLDVRGQHYELLPFGSGRR 2159
2160 VCPATNLAMKMVALGVASLVQGFAWRLPDGVAAEDVSMEE 2279
     LVGLSTRRKVPLVAVAEPRLPAHLYAGTAA* 2372

>AP003378.1 $F chromosome 1 clone P0047E11, Like 706A7
28850 MATANLLYAALLVPTVLYLAVTRRRSRRLPPGPVGLPLVGSLPFIDPNLHTYFASLAAKH 29029
29030 GPILSIRLGSKVDIVVNSAQLAREVLRDQDSVFANRVMLDAGDAVSFGGAQNIVGNPLGP 29209
29210 MWRLLRRVCVQEMMSPAGLASVHGLRRREFRSTLRYLHSKPGEPVDVGAQMFLNTM 29377
29378 NVITGTMWGGTIGSESERSAVGSEFRGLVAEVTELLGTPNVSDLFPVLKPFDLQGIRRKM 29557
29558 ERLRSRFDLLFTKIIQQRMRSQQDGGEMTTDFLECLLKMEKEGSDGKTTFTMDNVKGFLL 29737 (0)
      EMVVGGTDTTSNSVE 29917
29918 WIMAELLQNPQVLNKVQQELDSIVGRDAVVEESHLPQLHYLRMVIKETLRLHPPVPLLVP 30097
30098 HSPSAAATVGGYHVPEGCRVLINVWAIQRNPLVWNKPLDFNPDRFARDGGHKGDFTGSQL 30277
30278 DYLPFGSGRRMCAGMAMGEKVMVYSVAMLLQAFDWKLPQGVQLDLSEKFGIVMKKATPLV 30457
30458 AIPTPRLSKPELYYS* 30505

>AP004704.1 $F chromosome 8 65% to AP003378.1 49% to 706A4 same as AU174693.1 
100654 MEVTSTPAMLLYAALFAAALLYLAVAVRRGRGAGLPPGPTGLPLVGSLLSLDPELHTYFAGLAARYG 100454
100453 PIFSIRLGSKLGVVVTSPALAREVLRDHDLVFSNRDTPDAACSISYGGGQNIVWNPVGPT 100274
100273 WRLLRRICVHEMIGPAGLDSLHGLRRREFMATLHHLRARSGEPVNVGAQMFLTVMNVVTG 100094
100093 ALWGGNVGSESERTTVGKEFRELVADITELLGAPNVSDFFPALAPLDIQGIRNKSDLLKD 99914
99913  RFDDIFARIIQKRTESDHAAAAGETASDFLEYMLKLEKEGGDGKTAFTMTNVKALLM 99743 (0)
       DMVIGGTETTSNTVEWGMAEMLQNRGTLRKVRE 99561
99560  ELDAVVGRDGVVEESHLPKLHYLNLVVKETLRLHPALPLMVPHCPGEDATVGGHRVPAGA 99381
99380  RVFVNVWAIQRDPAVWKDPEHFIPERFLPADGGGGRRLDFTGSEQEYMPFGSGRRICAGV 99201
99200  AMAERMVAYSLAMLVQAFDWELPAGERLDLAERFGIVMKKATPLVAVPTPRLSNPQLYSA* 99018

>AP003745.1 $P chromosome 7 clone OJ1123_B01 
60823 VLSDRTGIYPKNLTNPHSVRLLGKGLVLTDGD 60917
60918 EWKRHRKVVHPAFNMDKLKMMTMTMSDCSRSMMSEWESELGAKGGLAEIELSRRFEELTA 61097
61098 NVISHTVFGSSYKEGKQVFLAQRELQFLAFSTFLTVQVPGFR 61223 (2)
61313 YLPTMKNFKTWSLDKKVRGMLMDIIKTRHANKDVVGYGNDLLGLLLEACAPEHRESHPQ 61489
61490 LSMDEIIDECKTFFFAGHDTTSHLLT*TMFLLSTHPDW*EKLREEIAMECGDEMPTGDML 61669
61670 NKLKMVNMFLLETLRLYSPVLLIRRKVGTDIELGGIKMPEGALLMIPIATIHRDKEVWGE 61849
61850 DADEFRPERFENGVTRAAKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRFSFTLS 62029
62030 PKYVHAPTDVITLRPKYGLPMILKSLKL* 62116

>AP003752.1 $F chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
7127 MGYGWALAAVLATWCLLDALSR
7061 LVWRPRAVAAALRRQGVRGPGYRLLVGSLGDINKLRADAAGAGGAAALDVASHDFIPFVQ 6882
6881 PQFRQWIPLY (1)
6770 GRVFLYWFGWTPDMCVADVEVAKQVLSDRTGLFPKNVTTPMLLKLFGRGLVLA 6612
6611 NGDEWQRHKKVVHPAFNTDKLK 6546 (0)
6457 MMTATMAGVARSMVSRWEEKVASHGGKVVIELSSQFEELTADVISHTAFGSSYAEGKQV 6281
6280 FMAIKELQFIAFSSLLSVQIPGS 6212 (2)
6152 RYFPTKKNLKVWRLDRKVRSTLMQIISNRLAAAAKEKAGGGGGGYGEDLLGLMLEAS 5982
5981 APPELGTKRRQPPVLSMDEIIDECKTFFFAGQETTSHLLSWTMFLLSTHPDWQDKLREEA 5802
5801 VRECAGAGAGDDDDQLPTYDMLGKLKLVGMQF 5706 (0)
5130 FLLETLRLYSPVPAIRRRTAAAVEMGGVTVPGGTMLTFPIATMHRDEEVWGAD 4975
4974 AGVFDPMRFDGGGGAMAKLLSFSTGPRACVGQSFA 4870
4869 MVEAKAVVAAILRRFRLELSPEYVHAPTDVITLRPKHGLMVVTRVHA* 4723

>AP003752.1 $F chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
18593 MGNLGWMVAAAVAAVVASWAFDAVVK
18515 LVWRPRAITRRLRAQGVGGPGYRFFSGNLGEIRRLRDEGAGVVLDVSSHDFVPIVQPHFR 18336
18335 KWIPLY 18318 (1)
18171 GKTFMYWFGARPTICLADVSMVRQVLSDRTGMYPKNVSNPYFARLLGKGLVLTDGDEWKR 17992
17991 HRKVVHPAFNMDKLKMMTVTMSDCAQSMISEWESELGTKGDIVEIELSRRFEELTA 17824
17823 DVISHTAFGSSYKEGKQVFLAQRELQFLAFSTFLSIQIPGSSYLPTKKNLKTWSV 17659
17658 DKKVRSMLTDIIKSRLNNKDVAGYGNDLLGLMLEACAPE 17542
17541 HGESQPQLSMDEIIAECKTFFFAGHDTTSHLLTWTMFLLSTHPEWQEKLREEVATECDGK 17362
17361 VPTGDMLNKLKLVNMFLLETLRLYGPVAFIQRRVNAELELGGITVPEGTVLS 17206
17205 IPIATIHRDKEVWGEDADIFKPERFKNGVSKAGKYPNAL 17089
17088 LSFSSGPRACIGQNFAMIEAKAVIAMILQRFSFTLSPKYVHVPTDVITLRPKYGLPMI 16915
16914 LKSLKV* 16894

>AP003752.1 $F chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
25600 MGFEWTVATAAAAVAASWAFIAVVVK
25522 LVW*PRAITRRLGAQGVAGPGYRFFSGNLSEIRRLRAEGANLVLDVSSHDFVPIVQPHIR 25343
25342 KWIPLY 25325
25229 GKTFLYWFGTRPNICLADMNMVRQVLSDRTGMFPKYIDNMQFARLLGKGLVLTDDDEWKR 25050
25049 HYKVVHPAFDMDKLKMMTETISDYAQSMMFEWESELGMKGGSTEIELSRWFEELTA 24882
24881 DVISRTAFGSSYREGKQVFLAQRKLQFLAFSVFLTIQIPGFSYLLTKK 24738
24737 NLKTWSLDKKVRSMLMNIIKSRLTNKETMGYGNDLLGLMLEACVPEHGGSQPQLSMDD 24564
24563 IIAECKTFFFAGHDTTSQLLTWTMFLLSTHQHWMEKLRKEVRMVCNDEVPTGDMLNKLKL 24384
24383 VNMFLLETLRLYGPVSLVTRRAGTDVKLGSIKVPKGTILTIPIATIHRDKEV 24228
24227 WGEDADEFKPERSENGVLNAAKHPSALLSFSIGLRSCIG 24111
24110 QNFAMIEARTIIAMILQRFSFTLSPKYVHTPISVITLRPKYGLPMILRSLKVKRDR* 23937

>AP003752.1 $P chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
29328 NGVSKEAKNPNALLSFSSGPRSCIGQNFAMLEAKAVITMILQRFFFTLSPKYVHA 29164
29163 PTSLITLWPKYGLPKILRSLKMCRMESQELSQPEGGEWLVYPKT* 28979

>AP003752.1 $F chromosome 7 clone OJ1332_C12, Best match zea mays AF391808
34102 MGNFVWMVAAAAAAVASWAFIAVVVK
34024 LVWRPRAISRRLRAQAVGGPGYRFFSGNLGEIRRLRAEGAGVVLDVSSHDFVPIVQPHFR 33845
33844 KWVSLY (1)
33706 GKTFLFWFGAQPNICLADINIVRQVLSDRTGMYPKDLTNPYFAHLLGKGLVLIDGDEWKR 33527
33526 HYKVVHPAFDMDKLKMMTVTISDCTGSMMSEWESELGMKGGSAEIELSQRFQELTA 33359
33358 DVISRTAFGSSYSEGKQVFLAQRKLQFLAFSMFLTIQIPGFRYLPTKK 33215
33214 NLKIWSLDKKVRSMLRNIIKIRLANKDTMGYGNDLLGLMLETCAPEHDESQQLS 33053
33052 MDEIIAECKTFFFGGHDTTSHLLTWTMFLLSTHPEWMRKIRKEVTTMCGDEVPTGDMLNK 32873
32872 MNLLNMFLLETLRLYSPVSLISRRTGTNAKFGGIKVPEGTILRIPIATIHRD 32717
32716 KEVWGEDADEFKPARFENGVSKAAKHPNALLSFSNGPRS 32600
32599 CIGQNFAMIEAKAVITMILQRFSFTLSPKYVHTPISVITLRPKYGLPMILRSLKVKRDL* 32420

>AP004264.1 $F chromosome 7 clone P0025D09 missing first 113 aa 
Like AP003752 and CYP709B2
83% to AU164994 80% to C73388 91% to AU181168 possibly = C96617 
= AU093233 clone C11668  AU091277 opp end = AU062564
58901 MGLLAWMVAAAAAAVLASWAFSAVVHLVWRPRAISRRLRAQGVGGPGYRFFSGNLGEIKR 59080
59081 FRGDGAGVVLNVSSHDFLPIVQPHFRKWIPLY 59176 (1)
59544 GRTFLYWFGAQPNICLADVSMVWQVLSDRTGIYPKNLTNPHFVRLLGKGLVLTDGDEWKR 59723
59724 HRKVVHPAFNMDKLKMMTMTMSDCSRSMMSEWESELAAKGGLVEIELSRRFEELTADVIS 59903
59904 HTAFGSSYKEGKQVFLAQRELQFLAFSTFLTVQIPGF 60014 (2)
60110 SYLPTMKNFKTWSLDKKVRGMLMDIIKTRHANKDVAGYGNDLLGLMLEACAPEHGESCPQ 60289
60290 LSMDEIIDECKTFFFAGHDTTSHLLTWTMFLLSTHPDWQEKLREEIAMECGDKVPTGDMLNKLKMVNMFL 60499
60500 LETLRLYSPVSLIRRKVDTDIELGGIKMPEGALLTIPIATIHRDKEVWGEDADEFRPER 60676
60677 FENGVTRAAKHPNALLSFSSGPRSCIGQNFAMIEAKAVIAMILQRF 60814
60815 SFTLSPKYVHAPTDVITLRPKYGLPMILKSLKL* 60916

>AC084319 $F same as AC084404 but end is present CDS 2242..2659 modified
MAALNHQPHTPRRLRRPHLLEPAPKEPQQPPQAAARPDEAPHHR
QPAPDRPSAAPEPGGAGGVARLGTVSVVVLSSPKAAREALKVHDPECCSRSPSAGPRM
LSYGYKDVAFSPYSNYVRNMRKLFVVELLSMRRVQAAL (1)
MLPDYYCCMVEKLIEKLTRNGRNAVAINEHIFSTVDGIIGTFAL
GETYAAEEFKDISETMDLLSSSSAEDFFPGSVAGRLVDRLTGLAARREAIFRKLDRFF
ERIVDQHAAADDDGPAAARRKADDKGSAGSDLVHELIDLWKMEGNTKQGFTKDHVKAM
LLDTFVGGITTTSVTLHWAMSELIRNPRVMKKAQDEIRAVVGEKERVQHHDMPKLKYL
KMVVKETFRLHPPATLLVPRETTRHFKV 
GGYDIPEKTKVIVNA*AIGR 
DPNIWKDPEEFIPERFEEMDIDFNGAHF
ELVPFGSGRRICPGLAMGVANIEFILASMLFCFDWELPHGVRKEDIDMEEAGKLTFHK
KIPLLLVPTPNKAPN

>AP002968 $F 40% to 71B24
MAELPLYLLLLALLVAVPFLCLTRWSLRHGGGGGGRLPPSPWAL
PVIGHLHHVAGALPHRAMRDLARRHGPLMLLRLCELRVVVACTAEAAREVTKTHDLAF
ATRPITPTGKVLMADSVGVVFAPYGDGWRTLRRICTLELLSARRVRSFRAVREEEVGR
LLRAVAAAAAVAALTTPGATAAVNLSERISAYVADSAVRAVIGSRFKNRAAFLRMLER
RMKLLPAQCLPDLFPSSRAAMLVSRMPRRMKRERQEMMDFIDDIFQEHHESRAAAGAE
EDLLDVLLRIQSQDKTNPALTNDNIKTVIIDMFVASSETAATSLQWTMSELMRNPRVM
RKAQDEVRRALAIAGQDGVTEESLRDLPYLHLVIKESLRLHPPVTMLLPRECRETCRV
MGFDVPEGVMVLVNAWAIGRDPAHWDSPEEFAPERFEGVGAADFKGTDFEYIPFGAGR
RMCPGMAFGLANMELALAALLYHFDWELPGGMLPGELDMTEALGLTTRRCSDLLLVPA
LRVPLRDHER

>AL662934.1 chromosome 4 clone OSJNBa0027O01 39% to 71B 
4399 MEINSAATLTLVSLLTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSHPQVALRELASKYGP 4602
4603 VMFLRMGQIDTVVVSSPAAAQEVLRDKDVMFASRPSLLVSEIFCYDNLDVGFAPYGAYWR 4782
4783 MLRKLCTVELLSTKVVRQLAPVRNDETLTLVRNIKAASSGHGGGGGKKPVTLARLLTTCT 4962
4963 NTITAKAAFGQACGVELQEQFLTALDVGLKFSGGFCFGDLFPSLRFIDAMTGLRSRLW 5136
5137 RARGQLDSVFDKIIAQCEEHQGDSLVNVLLRIRDQGDLEFPFGTTNIKAIIL (0)
     DMFTGGTETTSSAAEWVMSELMRNPEVMAKVQA 5481
5482 EVRRVFDNKSPQDHEGLIDNLRYMKMVIKETMRLNPVLPLLMPHLCRETCDIGGYEVVEG 5661
5662 TRVVINSWAMARSPEYWDDAEEFKPERFEDGMADYKGSRFEYLPFGTGRRRCPGDTFGMV 5841
5842 LLELIVARLLYYFDWSLPAGMQPDDVDMDFVVTATTRRKNHLQLVASPYKLAPIQI* 6012

>AC104708.1a two $F 72A like seqs same as BI305681.1 D15759 = AQ913924
27908 MAALLGILLAAFLAAAAVLFALRLLHSFLWVPRRLERRFRRQGIRGPPRRPLSGNAAGY 28084
28085 RDLLAAAQSAPLASFHHAVVARVAPHHREWPERYGRPFVFWLGPRPRLVVSDPEVVKAVL 28264
28265 TDTTGTFGKAGPGGNNPLARQLFSEGLVGLTGEAWARHRRVIAPAFNMERVK 28420 (0)
29030 AWIPEITSITSSMLDKWELQDEVRTEFEIDVNKEFHTLIADVISCVAFGSSYEEGKRVFQLQ 29215
29216 EEQLKLVILAMRTVYIPGFR 29272 (2)
29354 FVPTKKNQRRKIVNQEIRNSLRKLIEINGRKCEDSNNLLGMMLSASKIDSEF 29509
29510 KMGIEEIIDECKTFYFAGKETTATLLTWATLLLALHQEWQNKARDEVLQVCGKYEHPKAE 29689
29690 NLSELKI 29710 (0)
29798 VNMVLKETLRLYPPAVFLNKIANRDVKLGKLDIPAGTQLQLPILDIHHDVSIWGADADEF 29977
29978 DPSRFAEGKSYHLGAYFPFGIGPTICVGQNLAMVEAKVALAMILQRFALVVSPSYVH 30148
30149 APMLVVTLQPQYGAQVLVHKI* 30214

>aaaa01007665.1 (indica cultivargroup) ortholog of AC104708.1a BI305681.1
11936 AWIPEITSITSSMLDKWELQDEVRTEFEIDVNKEFHTLIADVISCVAFGSSYEE 11775
11774 GKRVFQLQEEQLKLVILAMRTVYIPGFR (2?)
      FVPTKK 11595
11594 NRRRKIVNQEIRNSLRKLIEINGRKCEDSNNLLGMMLSASKIDSEFKMGIEEIIDECKTF 11415
11414 YFAGKETTATLLTWATLLLALHQEWQNKARDEVLQVCGKYEHPKAENLSELKI (0)
      VSSSILY 11235
      VNMVLKETLRLYPPAVFLNRIANRDVKLGKLDIPAGTQ 11055
11054 LQLPILDIHHDVSIWGADADEFDPSRFAEGKSYHLGAYFPFGIGPTICVGQNLAMVEAKV 10875
10874 ALAMILQRFALVVSPSYVHAPMLVVTLQPQYGAQVLVHKI* 10752

>AC104708.1b two $F 72A like seqs same as AQ686474 AQ853376.1 
41941 MAALLGILLVAFLAAAVPFALRLLHSFLWVPRRLERRFRRQGIRGPPRRPLSGNAAGYRDLLA 42129
42130 AAQSAPLASFHHAVVARVAPHYREWPERYGRPFVFWLGPRPRLVVSDPEVVKAVLTDPTG 42309
42310 TFDKAGSGGGNPLARQLFGEGLVGLTGEKWARHRRVIAPAFNMERIK 42450 (0)
43002 GWISEITAITSSMLDKWEVQDEARAEFEIDVHKEFHTLIADVISSVAFGSSYEEGKRVFELQEEQLKLAI 43211
43212 LAMTTVYIPGFR 43244 (2)
43277 FVPTKKNRRRHMLNQEVRNSLRKLIEINGRKC 43435
43436 EDSNNLLGMMLSASKLGSEFRMGIEEIIDECKTFYFTGKETTANLLTWATLL 43591
43592 LALHQEWQNKARDEVLQACGKSEHPNAENLSNLKI 43696 (0)
      VNMVLKETLRLYPPAMFLNRMVNRDVKLGKLDIPAGT 43909
43910 QLHFPILDIHHDVNIWGTNADEFDPSRFAEGKSYHLGAYFPFGIGPTICVGQNLTMV 44080
44081 EEKVALAMILQRFALVVSR 44137 (frameshift)
44137 SYVHAPMHGVTLQPQYGAQVLAHKI* 44214

>CYP72A17 $F AP002839 Oryza sativa genomic DNA, chromosome 1 3655339431
MGIGIGIGIGIGIGTGTGAALPFGEASPWSLLGGAVAALLLVWAAQMLEWAWLAPRRMERALR
AQGLRGTQYRFLHGDLTEDLRLVTAARSKPVPMDRPHDFIPRVAPLLHRALEEH ( 1 )
GRVSFTWFGPMPRVTITDPDLVREVLSNKFGHF
EKTKLATRLSKLLVGGLVILHGEKWVKHRRIMNPAFHAEKLK ( 0 )
RMLPAFSASCSELIGRWENAVAASVGKAELDIWPDFQNLSGDVISRAAFGVRHHEGRQ
IFLLQAEQAERLVQSFRSNYIPGLS ( 2 )
LLPTENNRRMKAIDREIKSILRGIIEKRQKATKNGEASKDDLLGLLLQSNMDYYSDEDGKS
SKGMTVEEIIDECKLFYFAGMETTAVLLTWTMVALSMHPEWQDRAREEILQVFGRNKPDI
NGVSRLKV ( 0 )
VTMVLHEVLRLYPPVVMMNRRTYKEIELGGVRYPAGVMLSLPVLFIHRDAAAWGHDAGEF
DPGRFAEGVARACKDPGAGAFFPFSWGPRICIGQNFALLEAKVALGMILQRFAFELSPAY
AHAPYTVLTLHPQHGVPVRLRRL*

>CYP72A18 $F AP002839 Oryza sativa genomic DNA, chromosome 1 4499341630
MLMMLGAASQWILAAAAAAAVAALLWLAVSTLEWAWWTPRRLERALRAQG 
IRGNRYRLFTGDVPENVRLNREARKKPLPLGCHDIIPRVLPMFSKAVEEH ( 1 )
GKPSFTWFGPTPRVMISDPESIREVMSNKFGHYGKPKPTRLGKLLASGVV 
SYEGEKWAKHRRILNPAFHHEKIK ( 0 )
RMLPVFSNCCTEMVTRWENSMSIEGM 
SEVDVWPEFQNLTGDVISKTAFGSSYEEGRRIFQLQAESAERIIQAFRTIFIPGYW ( 2 )
FLPTKNNRRLREIEREVSKLLRGIIGKRERAIKNGETSNGDLLG 
LLVESNMRESNGKAELGMTTDEIIEECKLFYFAGMETTSVLLTWTLIVLS 
MHPEWQERAREEVLHHFGRTTPDYDSLSRLKI ( 0 )
VTMILYEVLRLYPPVVFL 
TRRTYKEMELGGIKYPAEVTLMLPILFIHHDPDIWGKDAGEFNPGRFADG 
ISNATKYQTSFFPFGWGPRICIGQNFALLEAKMAICTILQRFSFELSPSY 
IHAPFTVITLHPQHGAQIKLKKI*

>CYP72A19 $F AP002839 Oryza sativa genomic DNA, chromosome 1 comp(5369951708)
MDPTSVPWSSMVYGLLGLALLWQVHRLLVRLWWQPRRLERALRAQGVRGTSYRFLTGDLKDYGRLS
KEAWARPLPLRCHDIAPRVAPFVHRTIAEHGKACLSWFGPIPKVTIADAEIAKDVLSNKMGHFEKLKFPVLS
KLLADGVANYEGEKWAKHRRILNPAFHLEKLK ( 0 )
LMLPAFSACCEELVGRWAASLGSDGSNEIDVWPEMQSLTGDVISRTAFG
SSYLEGRRIFQLQAEQQELFMGAIQKISIPGYM ( 2 ) 
SLPTKNNRRMYQIKNEVESIIRDLVQKR
MHAMKDGERTKDDLLGILLESSTRHADENGHSGPGMTIEEVMEECKVFYFAGMETTAILL
TWTMVVLSMHPEWQHRAREEVLSLFQKNKLDYEGLSKLKT 
VTMILYEVLRLYPPGIGFVRQTYKEMEIGGVKYPAG
VMIELPLLFIHHDPDIWGSDVNEFKPERFAEGISRASNDHGAFFPFGWGPRICMGQNFAL
LEAKMALCMILQRFEFELAPSYTHAPHIVLMLRPMHGAPIKLRAI

>CYP72A20 $F AP002839 Oryza sativa genomic DNA, chromosome 1 5658159004
MEVGVSLEAGKPAAAPWGMLYYGVPALLVLGALYRAAERCWLGPRRVAGALQGQGLRGTAYRFPAGDL
PENARRSKEARAKPMPPCHDIVPRVAPLLQDIVKEY ( 1 )
GNVCITWFGTTPRVVIAEPELVKDILSNKFGHFEKFTLKSLGKLIALGLASYEGEKWARH
RRILNPAFHLEKLK ( 0 )
HMLPAFSTCCSEMIDRWDSKLAGSDGPFELDIWQEFQNLTGDVISRTAFGSSFMEGRRI
FQLQEEQADRIIKTIQYIYIPGYL ( 2 )
VSCRYFPTENNRRMKENSREIEGLLRGIIEKRSRAVENGELSGDDLLGLMLKSNMDSGE
PSNLRMSTEDVIEECKLFYFAGMETTSVLLTWTLVVLSMHPEWQHRAREEVLSAFGRDKP
NFDGLSRLKT 
VTMILHEVLRLYPPAVTLSRRTFKEIQIGGITYPAGVGLELPIILIHHNTDVWGKDAHEFKPERFADGISKAT
KTNQQAFFPFGWGPRICIGQNFAMLEAKMALCVILQNFEFQLSPSYTHAPYASVTLHPQH
GAQIILTRL*

>CYP72A21 $F AP002839 Oryza sativa genomic DNA, chromosome 1 6199363890
MVLGAWLMSPASVPWSLLAYGVLGLVLLWQAGRLLHSLWWRPRRLELALRAQGLRGTRYRFLTGD
LGEHGRLNREAWARPLPLRCHDIAPRVAPFLHNAVREHGSACFTWFGPTPKVTITDPDLA
KGVLSNKFGHFEKPKFPTLTKLFSDSLANHEGEKWVKHRRILNPAFHLEKLK ( 0 )
LMLPAFSACCEELVSKWMESLGSDGSYEVDVWP
EMQILTGDVISRTAFGSSYLEGRRIFQLQAEQTERLLKCMQKIVIPGYM ( 2 )
SLPTKNNRKMHQIKKETDSILRGLVDKRMQA
MKEGECTKDDLLGLLLESNMRHTEEDGQSNHGLTIEEVIEECKLFYFAGMETTSVLLTWT
ILLLSMHPEWQDRAREEILGLFGKNKPEYEGLSRLKI ( 0 )
VTMILYEVLRLYPPAVTFTRKTYKQMEIGGVTYPAGVIVELPVLLIHHDPNIWGSDAHEF
KPDRFVEGISKASKNPGAFLPFGWGPRICIGQNFALLEAKMALCMILQCFKLELMPSYTH
APYSMVTLRPMHGAQIKLRAI* 

>AP004019.1 $P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice
19871 FSTRKNSLLGYKTESLGDDGLCELLDIWREMQRLNGCHFPHSIRQPSYCEMRRIF 19707

>AP004019.1 $P chromosome 2 clone OJ1118_C03 similar to CYP72A23 of rice
37945 LSLMSLAFPTCNEELVWR*TE 37883  
37883 NPFNDEGLCVLLDVWPEIQRFH*DAISRTASGGGYRERRRIFQLQSEQSE 37734

>CYP72A22 $F AP002839 Oryza sativa genomic DNA, chromosome 1 6643568424
MVLGAGLRCPASVPWSSLAYGLLGLVLLWQGGRLLHRLWWRPRRLELALRAQGLRGTRYRFLTGDL
GEHGRLNREAWARPLPLRCHDIAPRVAPFLHSSVREHGKACFSWFGPIPKVTIANPDLAKDVLSNK
FGHLEKHKFQGLTKLLSDGVASHEGEKWVKHRRILNPAFHLEKLK ( 0 )
RMLPAFSTCCEELISRWMESLGSEGSYEVDVWPEMQSL
TGDVISRTAFGSSYLEGRRIFQLQAEQAERLLKCVQKIIIPGYM ( 2 )
SLPTKNNRKMHQIKKEIDSILRGLIGKRMQAMREGESTKDDLLGLLLESNMRHTAEHGQSS
QGLTIEEVIEECKLFYFAGMETTSVLLTWTMLLLSMHPEWQDHAREEILGLFGKNKPEYE
GLSRLKI 
VTMILYEVLRLYPPAVTLTRQTYKQIEIGGVTYPAGVIIELPLLLIHSDPDIWGSDVHKF
NPERFAEGISKASKDPGAFLPFSWGPRICIGQNFALLETKMALCMILQHLELELALSYTH
APQSIITLRPTHGAQIKLRAI*

>CYP72A23 $F AP002839 Oryza sativa genomic DNA, chromosome 1 7214974091
MVFGELFSRASLPPPWSLLAYGLVGPV
LLWQAGRLLDRLWWRPRRLERALRAQGLRGTAYRFLLGDLREFGRLNEEAWSSAPLPLGC
HDIVPRVTPFVHRNVRDNGRPCCFSWFGPIPSVTITDPAQVRDVLSNKLGHFEKPKLPAL
TKLLADGLTSHDGEKWVKHRRIMNPAFHLEKLK ( 0 )
LMLPAFSTCCEELVGKWMDSLGPDGSCELDVWPEMQSLTGDVISRTAFGSSYSEGR
RIFQLQTEQAELFIGAIQKFVIPGYM ( 2 )
YLPTKKNRRMRRINSEVESILRGIIGKRMQAIAEGESTNDDLLGLLLESNMRHADENGRS
SPGMTTEDVIEECKLFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLGLFGRDKPEY
EGLSRLKT ( 0 )
VTMVLYEVLRLYPPAIVFSRKTYKEMEIGGVVYPRGVILELPVLFIHH
DREIWGRDVHEFRPERFAEGISRASNDRGAFLPFGWGPRVCIGQNFALLEAKMALCMILQ
RFEFELAASYTHAPHTVMTLHPMHGAQMKLRMI*

>AP003278 $F 1986322437 chromosome 1, PAC clone:P0518F01, similar to 72A22
50023 MVLGGWLLMWAPASSPTILVAFGLLFG
49942 LVLAWQ AGLQLHRLWWRPRRLEKALRARGLRGSSYRFLTGDLAEESRRRKEAWARPLPLR 49763
49762 CHDIAPRIEPFLHDAVVRPEQHYGKPCITWLGPTPEVHVTDPELAKVVMSNKFGHFEKIR 49583
49582 FQALSKLLPQGLSYHEGEKWAKHRRILNPAFQLEKLK 49472 (0)
49071 LMLPVFSACCEELISRWMGAIGSDGSYEVDCWPELKSLTGDVISRTAFGSSYLEGR 48904
48903 RIFELQGELFERVMKSVEKIFIPGYM 48826 (2)
48363 YLPTENNRKMHQINKEIESILRSMIGKRMQAMKEGESTKDDLLGILLESNMRHT 48202
48201 EENSQSSQGLTIKDIMEECKLFYFAGADTTSVLLTWTILLLSMHPEWQDRARKEILGLFG 48022
48021 KNKPEYDGLNNLKI (0) 
      VTMILYEVLR 47842
47841 LYPPFIELKRRTYKEMKIGGVTYPAGVIINLPVLFIHHDLKIWGSDVHEFKPERFSEGIS 47662
47661 KASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELAPTYTHAPHTMITLHP 47482
47481 MHGAQIKIRAI* 47446

>AP003278 $F chromosome 1, PAC clone:P0518F01, 82% to 72A22
59493 MVLEGK AGLQLHRLWWRPRRLEKALRARGLRGSRYRFL
      TGDLAEEGRRRKEAWARPLPLRCHDIAPRVEP 59284
59283 FLHGAVGVGAAHGKPRITWFGPTPEVHVADPELARVVLSNKFGHFEKVSFPELSKLIPQG 59104
59103 LSAHEGEKWAKHRRILNPVFQLEKLK 59026 (0)
58537 LMLPV FSACCEELISRWMGSIGSDGSYEVDCWPEFKSLTGDVISRTAFGSSYLEG 58373
58372 RRIFELQGELFERVIKSIQKMFIPG 58298 (2)
57483 YLPTENNRKMHQMNKEIESILRGMIGKRMQAMKEGESTKDDLLGILLESN 57334
57333 TRHMEVNGQSNQGLTIKDIMEECKLFYFAGADTTSVLLTWTMLLLSMHPEWQDRAREEIL 57154
57153 GLFGKNKPDYDGLSRLKI (0) VTMIL 56977
56976 YEVLRLYPPFIELTRKTYKEMEIGGITYPAGVIINLPVMFIHHDPEIWGSDVHEFKPER 56800
56799 FSEGISKASKDPGAFLPFGWGPRICIGQNFALLEAKMALCLILQRLEFELATSYTHVPHT 56620
56619 IISLHPMHGAQIKVKSYMTISDYSVFY* 56536

>AP003330.1 $F chromosome 1 clone B1085F01 CYP72A like
4264 MAI (0)
4363 LVWRPYAVGRALGQQGVRGPAYRLLVGNIGEANEMRAAASGGVLDRRCHDVVPRVLPHY 4539
4540 RAWMSRYGKVFVSWTGPFPALCVGDYAMAKEILADRTGLYAKPDPGASILALFGNGL 4710
4711 AFVNGDDWARHRRVVHPAFAMDKLKMMAKTMAECARKVIQAWEARAAAAADGERMVQVEV 4890
4891 GEQFHELTADVISHTAFGSSYRQGKEVFVAQRELQYIAMSALNSVRIPGSQYIPTKANIR 5070
5071 RRQLAKKVRGTLMAIIRERQATAAAAKEDRGYGNDLLGLMLEANAAAGGGEKSMTM 5238
5239 DEIVDECKTFFFAGHDTTSHLLTWAMFLLGTHPEWQQRLREEVLRECCGGGGGDTEALPN 5418
5419 GDALNKLKL 5445 (0?)
5528 MTMVLYETLRLYGPVSMLVRTATADAELGGVRVPKGTMTMMPVAILHRDADVWGADAGEF 5707
5708 DPLRFRGGVNKAAAHAGALLAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYVH 5887
5888 APLDLLTLQPKCGLPMVLKLLDQ* 5959

>AP003514.1 $F chromosome 6 clone P0698A06, start MET is missing
9625 MAT (0)
9530 LVWRPYAVARAFGRQRIRGPAYRLFVGSDGEANAMRAATRGDVLDRRCHDIVPRVMPHY 9354
9353 RAWMSRYGKVFVSWSGATPALCVGDYAMVKQILSDRTGLYGKPEPEPSILALIGNGL 9183
9182 IFIGGDDWARHRRVVHPAFAMDKLKMMAKTMADCAREVIREWEARATADGERRVQVEVGG 9003
9002 QLQELTADVISHTAFGSSYREGKEVFVAQRELQSIAFSAINSTRFPGSQYIPTKTNLRRR 8823
8822 HLAKKVRGTLMAIIRERQAAAAKEDSGHGNDLLGLMLEANATDACGSGGEKSMTMDEIV 8646
8645 DECKTFFFAGHDTTSHLLTWAMFLLGTHPEWQHRLREEVLRECGGGGDTEALPNGDALNK 8466
8465 LKL 8457 (0?)
8374 MTMVLYETLRLYGPVSLMARTATADAELGGVRVPKGTMTMIPMAILHRDADVWGAGAGEF 8195
8194 DPLRFRGGVNKAAAHAGALLAFSLGQRSCIGQDFAMMEAKTTLAMILRRFAFEVSPEYVH 8015
8014 APLDLLTLQPKCGLPMVLKLLDQ* 7943 

>AP002899 $F 52% to 72A14 = AQ161379
MLGEAASPWSLAGAGAAVALLWLCAWTLQWAWWTPRRLERALRA
QGLRGTRYRLFIGDVAENGRLNREAASRPLPLGSHDVVPRVMPFFCNVLKEHGKLSFV
WTGPKPFVIIRDPDLAREILSNKSGNFAKQTTAGIAKFVVGGVVTYEGEKWAKHRRIL
NPAFHQEKIKRMLPVFLACCTKMITRWVNSMSSEGISELDVWDEFQNLTGDVISRTAF
GSSYQEGWRIFQLQEEQAKRVLKAFQRIFIPGYWYLPIENNRRIREIDQEIRTILRGI
IVKRDKAVRNGEGSNDDLLGLLVESNMRQSNEKEDVGMSIEDMIEECKLFYAAGSETT
SMLLTWTLILLSMHPEWQEQAREEVMHHFGRTTPDHDGLSRLKIVTMILHEVLRLYPP
VVFLQRTTHKEIELGGIKYPEGVNFTLPVLSIHHDPSIWGQDAIKFNPERFANGVSKA
TKFQTAFFSFAWGPRICLGQSFAILEAKMALATILQSFSFELSPSYTHAPHTVLTLQP
QYGSPIKLKKL

>AP003142.2 $P chromosome 1, PAC clone:P0435H01 probable pseudogene 
5354 YLPIENNRRIREIY*EIRKILRGLIVKGDKAIRNGENTNDDLLGLLVESNMRQSNERE 5181
5180 EVGMSIED 5157
1115 IIEECRLFYFAGSETTS 1065 
1065 MLLT*TLIMLSMHPEWQERAREEVMHHFRRTTPDHDGLSRLKIVHM 928

>AP003278 $P chromosome 1, PAC clone:P0518F01, similar to 72A22 missing Nterm half
31539 SLPIENNRKMHQINKEIESILRGLIGKRMQAMKEGESTKDDLLGILLESNTKHMEENGQSS 31718
31719 QGLTIKDIVEECKLFYFAGAETTSVLLTWTMLLLSIHPEWQDHAREEIMGLFRKNKPDYE 31898
31899 GLSRLKI
32030 VTMIFYEVLRLHPPFIEIGWKTYKEMEIGGVTYPAGVSIKIPVLFIHHDPDSWGSDVHEF 32209
32210 KPERFSEGISKASKDPGAFLPFGWGPRICIGQNFALLESKMALCLILQRLEFELAPSYTH 32389
32390 APHTMVTLHPMHGAQMKVRAI 32452 or  after KVR to 
      SYMIISDYSVFYYYNSWL* 

>CYP72A24 $F AP002839 Oryza sativa genomic DNA, chromosome 1 109970113787
MVVFAAGDERPLMLVWAAVAGAVLAWCAVRAMEWAWWRPRRLERALRAQGLRGTPYRSPA
GDAPLNVQLSAEARARTMPLGCHDVVPRAMPLFHQAMKEH ( 1 )
GKVSITWFGPVPRVTITKPELVREVLSNKFGHFEKLKFGRFQRLLHNGLGSHEGEKWAKH
RRIINPAFHLEKLK( 0 )
RMLPAFAACCTELVDK
WEGLAKGGDEPYEVDVWPEMQSLTGDVISRAAFGSSYLEGKRIFQLQGEQIELIVATMNK
IHIPGYI ( 2 ) 
HLPTKSNRRMKQIAAEIEGMLKRIIAKRESALKAGEASSDDDLLGLLLESNLDHSKGNGGA
ASSGISIDDVIGECKLFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLHVFGSRAPD
YDGLSRLRI ( 0 )
VTMVLYEVLRLYTPLTALQRKTYKPMELGGVRYPAGVVLTLPLLCVHHDKDVWGADADEF
RPERFAEGISKASREAPAFFPFGWGPRICIGQNFALLEAKMGLSMILQRFSFDLSPSYTH
APFPVGLLQPEHGAQVRLTRLN*

>CYP72A25 $F AP002839 Oryza sativa genomic DNA, chromosome 1 115472117492
MEIVDGASPPLHPWSLLLYALGALAALWWAWRALDRFWLRPRRLGRALRSQGLRGTDYRFPSGYLKEFARLL
AAALAAPMPPLSHDVASRALPFELAAIKQH ( 1 )
GNVCVTWFGPEVRVIVSDPKLFREILANKNGRFGKQKSILWVQNLLADGLTSHQGEKWVA
HRRIMNHAFHLEKLK ( 0 )
VQRMLPAFAACSSELISRWQDSVGADGAQEIDVWPEFQNLTGDVISRSAFGSSFSEGRRI
FQLQSEQARNVMKMAKALYFPGYR ( 2 
FLPTELNRRTKANAREVRELLKGIITKRESAMKDGHAVNDDLLGLLLETNIKESQEAGSS
KPTMTTKDIIEELKLLYFAGSDTTAVLLTWTMVLLSMHPEWQDRAREEVLRVFGKNSPDF
EGINHLKV ( 0 )
VTMILHEVLRLYPPILLLGREAYEETELGGVTYPPGVTFALPIAGIHHDPDVWGEDV
GEFKPERFAEGVSRASKDSPALVPFSWGPRICVGQNFALLEAKMALSMILQRFSFGLSPS
YTHAPFPIPTLQPQHGAQIKLTKL*

>AC119289.1 (japonica cultivargroup) chromosome 5 clone
AQ916317.1 (partial) nbeb0063E04r CUGI Rice BAC genomicLength = 521 52% to 72A7
AQ871967.1 nbeb0045H22r CUGI Rice BAC genomicLength = 824
50424 MLIMLGLGLVPAGAAAALAVALVCLAAAAWWTVERAPRRLERALRAQGVGGGRY
      QLLLGGDVAENGRLNREAWSRPLPLGCHRIAPRVLPLLWNAVRDH (1) 50720
54713 GKLSFIWFGPVPRVMIPDPELVREVFNKFDQFGKPKMIRVGKLLATGVVSYEGEKWAK 54886
54887 HRRILNHAFHHEKIK (0) 54931
55175 RMLPVFANCCTEMVTRWENSISLEAASEIDVWPEFRNLTGDVISRTAFGSSYQEGRRIF 55351
55352 QLQEELAQYLTEALQKLFIPGYW (2?) 55420
56034 YRYLPTKNNRRMREIDREVRKILLEIIGNKERAITNGENSNDDMLGLLVESNTKQPELRM 56213
56214 STDDIIEECKLFYFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLHHFGRTTTPDYDSL 56393
56394 SRLKI 56417 (0?)
56923 VTMILYEVLRLYPPVVLLNRRTFKETNLGGIKFPADMNLILPILFIHHDPEIWGKDASEF 57102
57103 NPGRFADGISNASKYHDASFFPFGWGPRICIGQSFALLEAKMALSMILQRFSLELSPSYI 57282
57283 HAPYIVLTLRPQHGAQIKLKRI* 57351

>aaaa01009485.1 (indica cultivargroup) ortholog of AQ916317.1
101end
1444 GKLSFIWFGPVPRVMIPDPELVREVFNKFDQFGKPKMIRVGKLLATGVVSYEGEKWAKHR 1623
1624 RILNHAFHHEKIK 1662 (0?)
1903 QRMLPVFANCCTEMVTRWENSISLEAASEIDVWPEFRNLTGDVISRTAFGSSYQEGRRIF 2082
2083 QLQEELAQYLTEALQKLFIPGYW 2151 (2?)
2765 YRYLPTKNNRRMREIDREVHKILLEIIGNKERAITNGENSNDNMLGLLVESNTKQPELGM 2944
2945 STDDIIEECKLFYFAGMETTSVLLTWTLIVLSMHPEWQERAREEVLHHFGRTTTPDYDSL 3124
3125 SRLKI 3139 (0?)
3654 VTMILYEVLRLYPPVVLLNRRTFKETNLGGIKFPADMNLILPILFIHHDPEIWGKDASEF 3833
3834 NPGRFADGISNASKYHDASFFPFGWGLRICIGQSFALLEAKMALSMILQRFSLELSPSYI 4013
4014 HAPYIVLTLRPQHGAQIKLKRI* 4082

>BE041018.1 OF16D12 OF cDNA 5'Length = 816 70% to 709A1
GPPSADHLSKLTVLQMIIQETLRLYPPATLLPRMAFEDIQLGGLRLPRGLTVWIPVLAIHHDEFIWGPDAH

>AP004142.1 $F chromosome 8 clone OJ1567_B05 similar to 709A1
66952 MAMAAAVLVAIALPVSLALLL
66889 VAKAVWVTVSCYYLTPARIRRVLASQGVRGPPPRPLVGNLRDVSALVAESTAADMASLSH 66710
66709 DIVARLLPHYVLWSNTY 66659 (1)
66576 GRRFVYWYGSEPRVCVTEAGMVRELLSSRHAHVTGKSWLQRQGAKHFIGRGLLMANGATW 66397
66396 SHQRHVVAPAFMADRLK (0) 
      GRVGHMVECTRQTVR 66217
66216 ALRDAVARSGNEVEIGAHMARLAGDVIARTEFDTSYETGKRIFLLIEELQRLTARSSRYL 66037
66036 WVPGSQ 66019 (2)
65469 YFPSKYRREIKRLNGELERLLKESIDRSREIADEGRTPSASPCGRGLLGMLLAEMEKK 65296
65295 EAGGNGGGEVGYDAQMMIDECKTFFFAGHETSALLLTWAIMLLATHPAWQDKARAEVAAV 65116
65115 CGGGAPSPDSLPKLAVLQMVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWI 64939
64938 PVLAIHHDEGAWGRDAHEFRPDRFAPGRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVAL 64759
64758 AMLLSSFRFAISDEYRHAPVNVLTLRPRHGVPVRLLPLPPPRP* 64627 

>AC082644 $F 50% to 709B2 EST AU066048, AU032967 from this gene
140516 MATLLLLAVAAAAAAWVWWGRYAWRARAVARRLAAQGVRGPRRGG 140650
140651 LLRGCNDEVRRRKAEAEADGVAMDVGDHDYLRRVVPHFVAWKELY 140785 (1?)
141949 GTPFLYWFGPQPRICVSDYNLVKQILSKKYGHFVKNDAHPAILSMIGKGLVLVEGADWVR 142128
142129 HRRVLTPAFTMDKLK 142173 (0?)
142311 VMTKTMASCAECLIQGWLDHASNSKSIEIEVEFSKQFQDLTADVICRTAFGSNSEKGKEV 142490
142491 FHAQKQLQAIAIATILNLQLPGFK 142559 (?)
142648 YLPTKRNRCKWKLENKLRNTLMQIIQSRITSEGNGYGDDLLGVMLNACFSTEQGEKRDEL 142827
142828 ILCVDEIIDECKTFFFAGHETTSHLLTWTMFLLSVYPEWQDRLREEVLRECRKENPNADM 143007
143008 LSKLKE 143025
143212 MTMVLLETLRLYPPVIFMFRKPITDMQLGRLHLPRGTAIVIPIPILHRDKEVWGD 143376
143377 DADEFNPLRFANGVTRAAKIPHAHLGFSIGPRSCIGQNFAMLEAKLVMAMILQKFSFALS 143556
143557 PKYVHAPADLITLQPKFGLPILLKALDA* 143643

>AQ865256.1 AQ795997.1 AQ871363 AQ913328 ortholog to aaaa01013573.1 $FI 99% lower case
MEKMLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI
RQELKFSQKQGTNNFISTLFPHFLLCRETYGMHML
GPVFLYSTGALEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTENGDEWA 399
YQRKIIAPEFFMDKIK
MIQLIEDATVTVLEAWEDMIDDVG 
42 aa gap gcreivvddylrnlsadviaracfgssftegeeifcklrqlq
YLPTKSNQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLVNAIIDGAQDGRS 
AAEAEDFIVGNCKTIYFGGHE
47? aa gap stvvtaiwclmllathsewqerarseamevcrgrstldvdalrrlki 
vtmviqetlrlyppasvmmqealtdvklg
NIEVPRGTIVQVPRLMLHLDKEAWGADADEFRPDRFANGVAAACRAAHMYVPFGHGPRTC 
IGQNLAMAELKVVLARLLTKFAFSPSPRYRHSPAFRLTIEPGFGLPLMVTKLP* 

>aaaa01013573.1 (indica cultivargroup) 99% to AU166330.1
3100 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 
     RQELKFSQKQGTNNFISTLFPHFLLCRETYGMHML 3384 (?)
4290 GPVFLYSTGALEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTEN 
     GDEWAYQRKIIAPEFFMDKIK (0?) 4517
4616 MIQLIEDATVTVLEAWEDMIDDVGGCREIVVDDYLRNLSADVIARACFGSSFTEGEEIFC 
     KLRQLQ 4813 (?)
5159 YLPTKSNQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLLNAIIDGAQDGRSAAEA 
     EDFIVGNCKTIYFGGHE STVVTAIWCLMLLATHSEWQERARSEAMEVCRGRSTLDVDA 
     LRRLKI 5515 (0?)
5611 VTMVIQETLRLYPPASVMMQEALTDVKLGNIEVPRGTIVQVPRLMLHLDKEAWGAH 
     ADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMAELKVVLARLLTKFAFSPSP 
     RYRHSPAFRLTIEPGFGLPLMVTKLP* 6033

>aaaa01013573.1b (indica cultivargroup) Second Nterm
7217  MELLFSSQQWLALLPPIILCILLFSYVYIILWLRPERLRQKLRSQGVRGPKPSFLFGNI
      QEMRRIQQLAKSAHEQE 7444
7445  AGSTDMFSSNYVATLFPYFLHWSRVY 7522

>AQ575202.1 AG023995.1 (partial)
118 MELFSSQQWLALLPPIILCILLFSYVYIILWLRPERLRQKLRSQGVRGPKPSFLFGNIPEMR 297
298 RIQQLAKSAHEQEAGSTDMFSSNYVATLFPYFLHWSRVY 414

>aaaa01004558.1 (indica cultivargroup) 96% to AAAA01013573.1
7614 MEKLLALIVVLVILLSLALFYLCNILWLRAVKIRKKLRRQGIRGPKPTFLYGNTKEIKRI 7793
7794 RQELKLSQKQGTNNFISTLFPHFLLWRETYGMYML 7898 (?)
8802 GPVFLYSTGAMEILQVSHPDMVKDIGRWTPSELGKPNYLKKSRKALFGGGLFTENGDEWA 8981
8982 YQRKIIAPEFFMDKIK 9029 (0?)
9125 GMIQLIEDATVPVLEAWEDMIDDEGGCREIVVDDYLRNLSADVIARAC 9268
9269 FGSSFTKGEEIFCKLRQLQ 9325
9674 YLPTKSSQEIQMLDEQVRLLILDVAKEQHHYQDSHNSLVNAIIDGAQDGRSAAEAEDFI 9850
9851 VGNCKTIYFGGHESTAVTAIWCLMLLATHPEWQERARAEAMEVCRGRSTLDVDALRRLKI 10030
     VTMVIQETLRLYPPASVMMREALTDVKLGSIEVPRGT 10259
10260 IVQVPRLMLHLDKEAWGADADEFRPDRFANGVAAACRAAHMYVPFGHGPRTCIGQNLAMA 10439
10440 ELKVVLARLLTKFAFSPSPRYRHSPAFRLTIEPGFGLPLMVTKLP 10574

>AP003258.2 $F genomic DNA, chr 1, PAC clone:P0463A02, complete 46% to 709B2
MLKSTIELYIFTTAIAKKSLHSQTKHKSKMDVPSVVIP
151039 ILVVLVSRLLTSALVHLLWKPYAITKLFRGQGITGPKYRLFVGSLPEIKRMKAAAAADEVA 150857
150856 AGAHSHDFIPIVLPQHSKWATDHG (1)
       KTFLYWLGAVPAVSLGRVEQVKQVLLERTGSFTKNYMNANLEA 150497
150496 LLGKGLILANGEDWERHRKVVHPAFNHDKLK 150404 (0)
149815 FMSVVMAESVESMVQRWQSQIQQAGNNQVELDLSRELSELTSDVITRSAFGSSHEEGKE 149639
149638 VYQAQKELQELAFSSSLDVPALVFLR 149561 (2)
149237 GNTRAHQLVKKSRTMLMEIIEGRLAKVEAAEAGYGSDLLGLMLEARALEREGNGLVLTTQE 149055
149054 IIDECKTFFFAGQDTTSNHLVWTMFLLSSNAQWQDKLREEVLTVCGDAIPTPDMANRLKL 148875 (0)
148359 VNMVLLESLRLYSPVVIIRRIAGSDIDLGNLKIPKGTVLSIPIAKIHRDRDVWGPDADEF 148180
148179 NPARFKNGVSRAASYPNALLSFSQGPRGCIGQTFAMLESQIAIAMILQRFEFRLSPSYVH 148000
147999 APMEAITLRPRFGLPVVLRNLQG* 147928

>AC082644.10 $F chr 3 BAC OSJNBa0013M12 genomic sequence, complete sequence
146763 MASLALVFLALLLPTISWLWDYIIVPHIWRPYIAAKRLREQGIRGPPY 146906
146907 KFLKGCNEDVKKMKDAADDLVLDVHDHNYLPRVMP*YLKWRSQY 147038 (1) 
147228 GRALCILVWGKA
147262 RICIFNYEWARQILSSKSGHFLKNDTTPTVLALLGKGLVLVEGIDWERHRRV 147417
147418 INPAFTMDKIK 147450 (0)
147771 MMTKTMVACAQNMVKELEDQASSNKNGETQVELDKQFQELTADIISHTAFGSS 147929
147930 YKLGIEAFHAQKELQEIAVKSLLNVQIPG 148016 (?)
148136 FSYLPTKGNWRKLTLEKKLRGTLMQIIQSRLSSKGSGYGSDLLGLMLEACIATDQGREQH 148315
148316 QLSLSIDEIIHECKTFFFAGHETTSLLLTWTVFLLSVYPEWQARLRLEALRECGKENPNG 148495
148496 DNLSKLKE 148519 (0?)
148671 MSMVFLETLRLYGPALFLQRKPLTDITVGETKIPKDHAIIIPSAIMHRDKEIWGDDTDE 148847
148848 FNPLRFQNGVTRAAKVPHALLAFSIGPRSCIGQNFAMLEAKSVMAMILKKFSFTLSPNYV 149027
149028 HAPVDLLTLQPKFGLPVVLRLLDA* 149102

>AC087220.7 $F chromosome 3 clone OSJNBb0097F01 similar to 709B2 
154905 MDSILLLPLVALLVVAISWLWDYTVVRLIWRPHCIAK 155015 this piece from AC082644.10
132837 EFREKQGIRGPAYKFLGGNNGEISRLKEEADGQVLDNLRDHNYLPRIAPHFLKWRAQY (1)
129645 GEAFLFWYGAKP RICIFDYELARQILSSKSGHFLKNDAPPTLVALMGKGLVLLEGTDWVR 129466
129465 HRRVINPAFNMDKLK 129421 (0)
129177 MMISTMTGCAQSLAKELEDVAAKNKDRVTEVDLNQKFR*LTADIIAHTAFGSS 129019
129018 YQLGKEAFQAQHELTEITMATLFQVQLPGLN 128935 (2)
128834 YLPTERNRRKWRLQKNLRDTLMQIIRSRLSSKDGGYGNDLLGLMLGACASDEQ 128667
128666 GEASSLSMDEIVDECKTFFLAGHETTSLLLTWTVFLLSVYPEWQERLRNEVLRECGTDQ 128490
128489 CPDANSLGKLKE 128457 (0) 
127940 MTMVLLETLRLYNPALFIQRKPTADITVGSLAIPAGVAVYIPVPIMHRDREVWGHDAGEF 127761
127760 NPLRFRDGAARAAAAAGIPHALLSFSIGPRSCIGQGFAMLEAKAAMAAMLRRLSFRVSPG 127581
127580 YVHAPVDLITLKPKFGLPVIVRLPDA* 127500 

>AP005099.1 (japonica cultivargroup) chromosome 7 
AQ258184.1 nbxb0019H10f
73606 MVVVVAAAMAAASLCCGVAAYLYYVLWLAPERLRAHLRRQG
73483 IGGPTPSFPYGNLADMRSHAAAAAGGKATGEGRQEGDIVHDYRQAVFPFYENWRKQY 73313 (1)
70996 GPVFTYSVGNMVFLHVSRPDIVRELSLCVSLDLGKSSYMKATHQPLF 70856
70855 GEGILKSNGNAWAHQRKLIAPEFFPDKVK 70769 (0)
70616 GMVDLMVDSAQVLVSSWEDRIDRSGGNALDLMIDDDIRAYSADVISRTCFGSSYVKGKQI 70437
70436 FDMIRELQKTVSTKKQNLLAEMTGLSFLFPKASGRAAWRLNGRVRALILDLVGENGEEDGG
      NLLSAMLRSARGGGGGGGEVAAAAEDFVVDNCKNIYFAGYESTA
      VTAAWCLMLLALHPEWQDRVRDEVQAACCGGGGRSPDFPALQKMKN (0) 69984
69906 LTMVIQETLRLYPAGAVVSRQALRELSLGGVRVPRGVNIYVPVSTLH 69766
69765 LDAELWGGGAGAAEFDPARFADARPPLHAYLPFGAGARTCLGQTFAMAELKVLLSLVLCR 69586
69585 FEVALSPEYVHSPAHKLIVEAEHGVRLVLKKVRSKCDWAGFD* 69460

>aaaa01012955.1 (indica cultivargroup) ortholog of AP005099.1
4863 MVVVVTAAMAAASLCCGVAAYLYYVLWLAPERLRAHLRRQGIGGPTPSFPYGNLADMRSH 4684
4683 AAAAAGGKATGEGRQEGDIVHDYRQAVFPFYENWRKQY 4570 (1)
2232 GPVFTYSVGNMVFLHVSRPDIVRELSLCVSLDLGKSSYMKATHQPLFGEGILKSNGNAWA 2053
2052 HQRKLIAPEFFPDKVK 2005 (0)
1852 GMVDLMVDSAQVLVSSWEDRIDRSGGNALDLMI 1754
     DDDIRAYSADVISRTCFGSSYVKGKQIFDMIRELQKTVSTKKQNLLAEMTGL 1474
1473 SFLFPKAIGRTAWRLNGRVRALILDLVGENGEEDGANLLSAMLRSTRGGGGGG 1315
1300 AAAEDFVVDNCKNIYFAGYESTAVTAAWCLMLLALHPEWQDRVRDEVQAACCGGGGRSPD 1121
1120 FPALQKMKN 1094 (0)
1016 LTMVIQETLRLYPAGAVVSRQALRELSLGGVRVPRGVNIYVPVSTLHLDAELWGGGAGAA 837
836  EFDPARFADARPPLHAYLPFGAGARTCLGQTFAMAELKVLLSLVLCRFEVALSPEYVHSP 657
656  AHKLIVEAEHGVRLVLKKVRSKCDWAGFD* 567

>aaaa01009691.1 $P (indica cultivargroup) ortholog of AQ856705.1
missing exon 1
6272 GPIFTYSMGNVVFLHVSRPDVVRDINLCVSLDLGKSSYLKATHEPLFGGGILKSNGEAWA 6093
6092 HQRKIIAREFFLDKVK 6045 (0)
     GMVDLMVDSAQTLLKSWEEGIDKNGGTIDIKIDDDIR 5260
5259 AYSADVISRTCFGSSYIKG 5203
     Deletion of 248 aa segment
5203 AELKTLISLIISKFVLKLSPNYEHSPTLKLIVEPEFGVDLSLTRVQGAYRH* 5048

>AQ856705.1 nbeb0004C17f CUGI Rice BAC genomicLength = 767 53% to 714A2
EFNPERFSNAQPQLHSYLPFGAGARTCLGQGFAMAELKTLI
SLIISKFVLKLSPNYEHSPTLKLIVEPEFGVDLSLTRVQGAYRH*

>AP004026.1 $F chromosome 2 clone OJ1136_C04, similar to 715A1
88341 MELVVQALAAAAALLAVFFLSTLYLSPAATARRLRNAGFRGPTPSFPLGNL
      REIASSLASNNDTDESNTKGGDIHAAVFPYFARWRRA
88605 FGKVFVYWLGTEPFLYVADPEFLKAATAGALGKLWGKPDVFRRDRMPMFGRGLVMAEGDE 88784
88785 WARHRHIIAPAFSATNLNDMIGVMEETTAKMLGEWGDMVASGRSCVDVEKGVVRNAAE 88958
88959 IIARASFGISADDDDATGARVFHKLQAMQAILFRSTRLVGVPLAGLLHIRAT 89114
89115 YEAWKLGREIDALLLDIIESRRRREGGGGGKKKKKTTSNDLLSLLLAGSEASAGAERK 89288
89289 LTTRELVDECKTFFFGGHETTALALSWTLLMLAAHPEWQAAVREEVVEVAGRSGPLDAAA 89468
89469 LGKLTKMGCVLSEVLRLYPPSPNVQRQALQDVVVVAGDGEKKVVIPKGTNMWIDVVAMH 89645
89646 RDGELWGEEASEFRPERFMREGVQGGCRHRMGYVPFGFGGRICVGRNLTAMELRVVLAM 89822
89823 VLRRFAVEVAPEYRHAPRIMLSLRPSHGIQLRLTPLC* 89936

>AP003727.3 $P chromosome 1 clone:P0672D08 Pseudogene fragment 
NRMPMFGRGRVMAEGDEWARHRCIVAPAFSATNLN
DMIGVMEETTSKMLGEWSDIVALGHSCIDIEKGVVRNAAEIIAKASFSIAADDATVFHK 
VRLVSVPLASLLHIRADRATYEAWKLGRKIDALLLDIIESRRRCEGGGRK
TTTTDLLWLLLAGNEASAAAERKLTTALALSWTLLMLATHPEWRAAVRE 
EVEEVTGWSGPMDAAAMGKLTKMGCMLNEVLRLYPPSPNVQRPAACDAEV

>AP004123.1 $P chromosome 2 clone OJ1654_A02, related to AP004026.
GAFGKL*GKPAVFRHDRMP MWP 
MFGRGRIMAEGDEWARHRCIIAPAFSATNLN
DTIGVMEETTSKMLGEWSDMVALGHSCIDIEKGVVRNAAEIIAKANFSIAAADATVFHK 
LQAMLFHST 
RLVGVPLASLLHIRATYEAWKVGRKIDALLLDIIDSRRRREGGG
MK 
EVEEVTGWSGPMDAAVMEKLTKM
GCMLNEVLRLYPPSPNVQRPAACDAEV

>AP004365.1 $P chromosome 1 93% to AP004026.1 $F chromosome 2 715 like
184935 ETTSKMLGEWSDMVVSG*SCIDIEKGVVWNAAEIIAKASFGIGTDDDATGAGVFHKLQAMQAMLFRSTRLVGVP 184714 frameshift and deletion
       RANYEAWKLGREIDALLLDIIESRRHXXXXXXXX 
       TNDLL*LLLGGNKASAGA 
184557 ERKLTTRELVDECKTFFFXXXXXXXXX 
184108 LSWTLLMLAAHPEWQAAVREEVVEAAGRSGLLDAAALGKLTKMGCVLNEVLRLYQPSPNVQRQALQDVVV 183902

>AP003822.1 $F chromosome 7 clone OJ1316_A04, 68% to 72B
52729 MWSSWAWTWSWSGAAAVAVAAAAAWVAVYAAAARAAEAL
52846 WWRPRRVERHFAAQGVRGPGYRFFVGSSIELVRLMVDAASRPMEPPTSHDILPRVLPFYH 53025
53026 HWRKLY 53043 (1)
55138 GPMHLIWFGRTPRLVVSEPELIREVLLTRADHFDRYEAHPMICQFEGYGLSNLHGERWA 55314
55315 RRRRVLTPAFHTENLRMIAPFVAGTVTRMLDELAERARAGGAGEAEVDVAEWFQRVPQEA 55494
55495 ITFAAFGRRNYDDGAAVFRLQDELAGYATEAHSKVYIPGYRFLPTRKNRRVWQLDREIRS 55674
55675 HLAKFVTGLQSCSSSHGDDADDGGDGGGGMREFMSFMAPAMTAGEIIEESKNF 55833
55834 FFAGKETLSNLLTWTTVALAMHPEWQERARREVVAVCGRGDLPTKDHLPKLKTV 55995
56559 LGMILNETLRLYPPAVAMIRTAKEDVELGGCVVPAGTEVMIPIMAVHHDAAAWGDDAAEF 56738
56739 NPARFAADDDGGRRRHPMAFMPFGGGARVCIGQNMALMEAKVALAVVLRRFEFRLS 56906
56907 PAYVHAPRVLMILSPQFGAPVIFRPLTSAAA* 57002

>AP003612.1 $F chromosome 6 clone P0457B11, 62% to 72B
109843 MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGPPYRFLVGCVR 109682
109681 EMVALMAEATAKPMPPAAPHNALPRVLAFYHYWRKIY 109571 (1)
109284 GPTFLIWFGPTPRLTVAEPEMVREIFLTRAEAFDRYEAHPVVRQLEGDGLVSLHGDKW 109111
109110 AHHRRVLTPGFYPDNLN (0) 
108953 RLVPHVGRSVAALAERWRAMACAGGGEVEVDVAEWFQAVAEEAITRATFGRSYDSGRV 108780
108779 VFRLQARLMAFASEAFRKVLVPGYR 108705 (2)
108606 FLPTKKNRMSWGLDREIRRGLVRLIGRRSGGDGGEEDETTTELKDKQDSGFNDLLGLMI 108430
108429 NAGVDRTMPVEDMVEECKTFFFAGKQTTTNLLTWATVLLAMHPDWQDRARREVLAVCGDA 108250
108249 AGELPTKDHLPKLKT (0) 
       LGMILNETLRL 108070
108069 YPPAVATIRRAKFDVTLGGGGDGDAGGIHIPRDTELLVPIMAIHHDARLWGPDAAQFNPA 107890
107889 RFASGAARAAKHPLAFIPFGLGSRMCIGQSLAILEAKLTMAVLLQRFDLALSPTYVHAPT 107710
107709 VLMLLHPQYGAPLIFRPRQSQPSN* 107635

>AC099043.1 chromosome 3 74A like probably same as C72393, D47977, C99549 opp end = C99548 Nterm may be different
62290 MATAAACISFASPSPARVVIR
62227 RQTRASASASATDRQEVVSPKRRLPLRKVPGDYGPPVVGAIRDRYEYFYGPGGRDGFFAA 62048
62047 RVRAHRSTVVRLNMPPGPFVARDPRVVALLDAASFPVLFDTSLVDKTDLFTGTFMPSTD 61871
61870 LTGGYRVLSYLDPSEPNHAPLKTLLFYLLSHRRQQVIPKFREVYGDLFGLMENDLARVGK 61691
61690 ADFGVHNDAAAFGFLCQGLLGRDPAKSALGRDGPKLITKWVLFQLSPLLSLGLPTLVED 61514
61513 TLLHSLRLPPALVKKDYDRLADFFRDAAKAVVDEGERLGIAREEAVHNILFALCFNSF 61340
61339 GGMKILFPTLVKWLGRAGARVHGRLATEVRGAVRDNGGEVTMKALAEMPLVKSAVYEAL 61163
61162 RIEPPVAMQYGRAKRDMVVESHDYGYEVREGEMLFGYQPMATKDPRVFARPEEYVPDRFL 60983
60982 GEDGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLVELFLRYDSFDVEV 60812
60811 GTSTLGSSVTVTSLKKATF* 60752

>AY055775 $F allene oxide synthase (AOS) mRNA, complete cds. 
MELGVPLPRRPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRA
ERYGSTVVRINVPPGPFMARDPRVVALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSL
TGGYRVCAYLDPSEPNHAKIKQLLLSLLVSRKDAFVPVFRSNFGALLDTVQSQLASGG
GKSDFTALNDATSFEFIGKAYFGVRPSASSSLGTGGLDQGRLWLLWQLAPLTTLGLPM
IIEDPLLHTLPLPPFLISSDYKALYAYFAAAASQALDAAEGLGLSREEACHNLLFATV
FNSYGGFKLLLPQILSRVAQAGEKLHERLAAEIRSAVADAGGNVTLAALEKMELTRSV
VWEALRLDPPVRFQYGRAKADLEIESHDASFAIKKGEMLFGYQPCATRDPRVFGATAR
EFVGDRFVGEEGRKLLQYVYWSNGRETENPSVDNKQCPGKNLVVLVGRLLLVELFLRY
DTFTAEAGKKVVITGVTKASTSAVNRTA*

>AC107226.1 chromosome 3 98% to AY055775 $F allene oxide synthase probably same gene
108155 MELGVPLPR
108182 RPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRAERYGSTVVRINVPPGPFMARDPRV 108358
108359 VALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSLTGGYRVCAYLDPSEPNHAKIKQLLLS 108538
108539 LLVSRKDAFVPVFRSNFGALLDTVESQLASGGGKSDFTALNDATSFEFIGEAYFGVRPSA 108718
108719 SSSLGTGGPTKAALWLLWQLAPLTTLGLPMIIEDPLLHTLPLPPFLISSDYKALYAYFA 108895
108896 AAASQALDAAEGLGLSREEACHNLLFATVFNSYGGFKLLLPQILSRVAQAGEKLHERL 109069
109070 AAEIRSAVADAGGNVTLAALEKMELTRSVVWEALRLDPPVRFQYGRAKADLEIESHDAS 109246
109247 FAIKKGEMLFGYQPCATRDPRVFGATAREFVGDRFVGEEGRKLLQYVYWSNGRETEN 109417
109418 PSVDNKQCPGKNLVVLVGRLLLVELFLRYDTFTAEAGKKVVITGVTKASTSAVNRTA* 109591

>AP004181.1 $F chromosome 2 clone OJ1136_G09, AU184424.1 45% to 74A of Arabidopsis
6988 MAPPRANSGDGNDGAVGGQSKLSPSGLLIREIPGGYGVPFLSPLRDRLDYYYFQGADEFFRS 7173
7174 RVARHGGATVLRVNMPPGPFLAGDPRVVALLDARSFRVLLDDSMVDKADTLDGTFMPSLA 7353
7354 LFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAMFDEVDAGLVAGGP 7533
7534 VEFNKLNMRYMLDFTCAALFGGAPPSKAMGDAAVTKAVKWLIFQLHPLASKVVKPWPLED 7713
7714 LLLHTFRLPPFLVRREYGEITAYFAAAAAAILDDAEKNHPGIPRDELLHNLVFVAVFNAY 7893
7894 GGFKIFLPHIVKWLARAGPELHAKLASEVRAAAPAGGGEITISAVEKEMPLVKSVVWEAL 8073
8074 RMNPPVEFQYGRARRDMVVESHDAAYEVRKGELLFGYQPLATRDEKVFDRAGEFVPDRFV 8253
8254 SGAGSAARPLLEHVVWSNGPETGTPSEGNKQCPGKDMVVAVGRLMVAGLFRRYDTFAADV 8433
8434 EELPLEPVVTFTSLTRAADGDGAARRGV* 8520 
724 (29 sequences)

>AL607001.1 chromosome 4 clone OSJNBA0088I22, gene 1 9297697891
92976 MYAYVGLVGGAAALVLLLLLRHQARRWRNPRCGGQLPPGSMGLPLVGETFQFFSSDASLDIPPFIRHRLAR  93188 (2)
93267 YGPIFKTSLVGHPVVVSADEELNHMVFQQEGQLFQSW 93377
93378 YPDSFVEILGKDNVGEQQGAMFRYLKNMVLRYFGPESLKEGIIRDVERAVSSSLCTWSTL 93557
93558 PAVELKEAVST 93590 (0)
93686 MVFDLAASKLLGLEPSRSKILRKSFFDFVRGLISFPLYLPGTAYYSCMQ 93832 (0)
93922 GRRRAMVVLEQVLEERKQSTGLQRGGEAQQHGDFLDYVIQEITKEKPVMTEKMALDLMF 94098
94099 VLLFASFHTTSLALTLAVKLLADHPLVLEELT 94194 (0)
94293 VEHETILKDREAGSELDRITWKEYKSMAFTSQ 94388 (0)
94575 VINETVRLANIAPVIFRKALKDIRFN 94652 (1)
97033 GYTIPAGWGVMVCPPAVHLNPYIYPDPLTFIPSRFK 97140 (0)
97486 DKPEINRGSKHFMAFGGGLRFCVGADFSKLQLAIFLHFLVTKYR 97617 (2)
97802 WIPLGASRVVRTPGLEFPDGYRIKVIQRH* 97891

>AL607001.1 chromosome 4 clone OSJNBA0088I22, gene 2 105584109445 
105584 MEKSELLLGSYSYAALCGVTLIIGWLAHWVYKWMNPPCIGRLPPGSMGFPIIGETFQFFRASPSIDMPSYYKQRLER (2?) 105814
105556 YGPLFKTSLVGRPVIISLDPEVNRFIFQQEGKLFQSWYPETAINIFGKKSLTTYNGTIHKFIRGVAAK 106159
106160 LFGLENLKESLLPELENSMRESFASWTGKPSVEVQDGVSD 106279 (0)
106493 MIFDLVAKKLIGLDVTNSRELRKNFQDFFQGMVSFPIYFPGTSFYRSMQ (0)
       GRRNVRNTLTDIMKERLSAPGKKYGDLVDLIVEELQSEKPM 108258
108259 IDENFAIDALAALLFTSFATLSSTLTVAFKYLTDNPKVVEELK (0)
       EEHGTILKKREGVNSGFTWEEYRSLKFSTQ (0)
       VMNEITRISNVTPGVFRKTLTDVQVK 108747 (1?)
108863 GYTIPSGWLVMISPMAVHLNPKLFEDPLKFDPWRWR (0)
       EEKRSSMLKNYMPFGGGVRLCLGAEFSKLFIALFLHILVTEYR 109231 (2)
109356 WTEIEGGEVLRISEIMFPQGYHIQLVPQT* 109445

>AL607001.1 chromosome 4 clone OSJNBA0088I22, gene 3 136970140694 61% to 87A2
136970 MAYIALLCAALAAVVALLRWAYRWSHPRSNGRLPPGSLGLPVIGETLQFFAPNPTCDLSPFVKERIKR 137173 (2?)
137287 YGSIFKTSVVGRPVVVSADPEMNYYVFQQEGKLFESWYPDTFTEIFGRDNVGSLHGFM 137460
137461 YKYLKTLVLRLYGQENLKSVLLAETDAACRGSLASWASQPSVELKEGIST (0) 
       MIFDLTAKKLIGYDPSKPSQVNLRKNFGAFICG 137820
137821 LISFPLNIPGTAYHECME 137874 (0)
138176 GRKNAMKVLRGMMKERMAEPERPCEDFFDHVIQELRREKPLLTETIALDLMFVLLFASF 138352
138353 ETTALALTIGVKLLTENPKVVDALX 138424 (0)
138574 EEHEAIIRNRKDPNSGVTWAEYKSMTFTSQ (0)
139123 IMEIVRLANIVPGIFRKALQDVEIK 139197 (1?)
139305 XYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQ 139421 (0)
140396 XXEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYR 140518 (2)
140605 WRTVKGGNIVRTPGLSFPDGFHIQLFPKN* 140694

>AC090482.3 $F 45% to 87A2 in the CYP85 clan 2 diffs with AQ868994
       MAVLATACWLVFVKRNTSRPSG (?) 
135052 RLPPGSRGFPIIGETLEFLTESPANQLPAFFKRRLDR 134942 
116833 RYGPIFKTNMIMEDLIVSLDPEVSNFVLQQEEKLFQIWCPGSFMRITGAESIITTHALLHR 116651
116650 HIRNLVLRIFGPGNLRQEIIQEMHKTAEASLSSWLNHPSIELKEAISS 116519 (0?)
113034 MIFSVTAKKLISYDSSTSDGKMWKHYDAFAQGLITLPLCIPGTAFYKCMQ 112876 (0?)
98384  GRKNVMKMLKEILNERKKIEGRHESIDFLDVLIEEVKEDNPSMTENTALNLLFSL 98211
98210  LFGSFDTTSSGITGMLKFLTDNPEALRELT (0?)
97814  EHNNIRRRRADLNSEITWEEYKSMKFTSH 97704 
97599  VIHEALRLASITPMMFREAIEDVHIK 97519 (1)
96537  GFAIPKESKIMICPSTVHLNPVVYEDPI 96457 
       TFNPLRWK (0)
95926  DIAEPAGGASKDFMPFGGGLRLCVGAHFAKLQMAVFVHCL 95831
95446  LSTLVSWKAIKGGRMVLSPGLRFLEGFHIQLFPKD* 95339

>AC083944.6 $F clone OSJNBa0047G15 three bad AG boundaries
40470 MAVLATACWLVIRLVFVKGNTDRRPCEADGMRMVPGSRGLPIIGETLEFLALSPS 40634
40635 LQIPAFFQRRFD 40670 (2) 
43217 YGPLFKTNMIMEDLIVSLDPEVTNFVFQQEERLFQMWYPDSFIRIIGTDSLIRTHGLLHR 43396
43397 HIKNLALRLFGPENLRREIIHDVQKTVEASLSSWLNQPSIELKEAVSS 43540 (0)
44000 MIFKVTAKKLISYDSSTSDGKMWKQYDAFTQGLFAFPLCIPGTAFYKCMQ 44149 (0)
46292 GRKNVIKMLKEILDERKNTEEHHESVDFFDVIEEVKAKNPDQMTENAVLDLLFLLLF 46462
46463 ASFETTSSGITAMLIFLTDNPEALQELI 46546 (0)
47088 EHNNIRKRKADKNSEITWEEYKSMKFTSH 47174 (0)
47314 VIHEALRLASIAPVMFREAIEDVHIK 47391 (1)
47742 GFAIPKGSKIMICPYTVHLNPVVYKDPNTFNPWRWK 47849 (0) 
48552 RNIPEPASGASKDFMAFGGGLRLCVGAHFAKLQMAVFLHCLVTS 48683 (0) 
48972 LSTIVSWKAIKGGRMALSPGLRFPEGFHIQLFPKA* 49079

>AC092778.2 $F chromosome 3 clone OSJNBa0015G17, 59% to 85A2
105850 MVLVAIGVVVAAAVVVSSLLLRWNEVRYSRKRGLPPGTMGWPLFGETTEFLKQGPSFMKA 106029
106030 RRLRY (1)
       GSVFRTHILGCPTVVCMEAELNRRALASEGRGFVPGYPQS 106945
106946 MLDILGRNNIAAVQGPLHRAMRGAMLSLVRPAMIRSSLLPKIDAFMRSHLAAWSSSSSSA 107125
107126 VVDIQAKTKE (0)
       MALLSALRQIAGVSAGPLSDALKAELYTLVLGTISLPI 108109
108110 NLPGTNYYQGFK 108145 (0) 
AMLEQMIAERRSSGQVHDDMLDALLTGVEGTREKLTDEQIIDLIITLIYSGYETMSTTSMM
       AVKYLSDHPKALEQLR (?)
       KEHFDIRKGKAPEDAIDWNDFKSMTFTRA (?)
       VIFETLRLATVVNGLLRKTTQDVEMNG (?)
       YVIPKGWRIYGYTREINYDPFLYPDPMTFNPWRWLEKNMES
       HPHFMLFGGGSRMCPGKEVGTVEIATFLHYFVTQYRWEEEGNNTILKFPRVEAPNGLHIRVQDY* 

>D48181 45% to 708A1 and 702A2 85 CLAN 44% to 87A2  Ortholog to aaaa01003340.1 $FI 1 diff
MAVLASWLIRLVSLKWNSSHPCKADEGSRLPPGSRGLPLLGESLEFFTSSTSLELPVFFK
RRLNRYGPVFRTNMVGQDLIVCLDPEVNSFVFQQEERLFQCWYP 
GFFYPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWKDTAEPTGGASKDFMAFGGGLRLCVGX 
DFAKLQTAIFLHCLVTKYRWKAIKGGTMVLGPGLRFPEGFHIQLFPKP*

>aaaa01003340.1 (indica cultivargroup) ortholog of D48181 (less the Nterm)
4887 MAVLASWLIRLVSLKWNSSHPCKADEGSRLPPGSRGLPLLGESLEFFTSSTSLELPVFFKRRLNR 5081 (2)
11460 YGPVFRTNMVGQDLIVCLDPEVNSFVFQQEERLFQCWYPDSFMRIIGADNIITTLGSSHK
      YIRNLILRLFGPENLRRAMLQDVHRTAQASLLSWLDRPSIELKDAVSS (0?)
      MIFSVTAKKLISYDSLASDGKMWKQFDAFIRGLLAFPIGIPGTAFYKCMQ (?)
      SIDFIDVLLEELNEEKPLISENVALDLIFLLLFASFETTASAITAVVRFLTDNPEALQEL (0?)
      EEHDNIQKRRVDLNSEITWEEYKSMKFTSH (0?)
      VIHEALRLANIAPVMFRKATEDVHIK (1?)
13238 GFFIPKGSKIMICPSTVHLNPMIYKDPNIFNPWRWK 13345 (0)
13765 DTAEPTGGASKDFMAFGGGLRLCVGADFAKLQTAIFLHCLVTKYR 13899 (2)
14151 WKAIKGGTMVLGPGLRFPEGFHIQLFPKP* 14240

>AQ157412 AQ577511 C72168 C73926 opp end C99700 ortholog to aaaa01004251.1 $FI 7 diffs
MEKSEIFVGAHSYAAICAFTLIIGWLAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFR
TSPSIDMPIYYKRRLER
YGPIFKTNIGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAH
KLIRSFVCKLYGPENVKKSLLPELENSMR 3
ANSGFTWEEYKSLK
FSTQVVNEITRISNVAPGVFRKALTDVQVNGYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWTEEKRISMQRNFMPFGGGIRMC 
PAAEFNKLFITLFLHIVVTEYRWKDIDGGNVKRISEVLVAQEYHIQLVPQT* 

>aaaa01004251.1 $FI (indica cultivargroup) ortholog of AQ157412 contig
2320 MEKSEIFVGAHSYAALCAFTLIIGWLAHWVYRWINPPCNGRLPPGSMGFPIVGETFQFFR 2499
2500 TSPSIDMPIYYKRRLER (2) 2550
2709 YGPIFKTNIGGQHVVISLDPEVNQFIFQQEGKLFQSWFPETTLNIFGKKTLTTYNRTAH 2885
2886 KLIRSFVCKLYGPENVKKSLLPELENSMRESLASWIGKPSVEVNDGVSN (0) 3032
3130 MIFGLAAKHLIGLDITNSGELKKNFQEIFQVMVSIPFPIYFPGTSFYRCMQ (0) 3282
3407 GRRNVWTTLTNVMKKRLSAPGNKFGDLVDLIVEELRSENPTI
     DESFAIDTLSGLLFASFAPLSCTLTTTFKFLNDNPEVFDKLK (0) 3658
3778 EEHEMILKKREGANSGFTWEEYKSLKFSTQ (0) 3867
3965 VVNEINRITTVIPGGFRKALTDVEVN (1)
4133 GYTIPSGWLVMISPMGVHLNPKLFEDPLKFDPWRWT (0)
4343 EEKRISMQRNFMPFGGGIRMCPAVEFNKLFITLFLHIVVTEYR 4471 (2)
4752 WKDIDGGNVKRISEVLVAQEYHIQLVPQT* 4841

>AQ576451 nbxb0089M21r 80% to C72007 67% to 702A8 and 87A2 84% to AL607001 gene 2
KEHPTVPEQTSQSKFGVPWEEYNPLMFTSQ (0)
VVHEFTRISNVAPGIFRKTLADVKVK (1)
GYTIPAGWLVMISPMAVDLNPTLFEDPLEFNPWRWT 203 (0)
DKTKQSELLRNYMPFGGGIRLCLGAEF

>aaaa01000436.1a (indica cultivargroup) ortholog of AQ576451
998  EEHTTILNKRGSLNSGFTWEEYKSLMFTSQ (0) 1087
1188 VVNEITRISNVAPGIFRRTLADVKVN 1265 (1)
1367 GYTIPAGWLVMISPMAVHLNPTLFEDPLEFNPWRWT (0) 1474
1595 DKTKQSELLRNYMPFGGGIRLCLGAEFSKLFIAIFIHVLVTEYR 1726 (2)
1814 WKEIKGGDVLRISEVIFPQGYHIQLIPHT* 1903

>AP000616.1 $F chr 6, clone:P0514G12 Length = 138739 = AP002805 like CYP88
125060 MEGMGMAAAWAAGDLWVLAAAVVAGVVLVDAVVRRAHDWVR 125182
125183 VAALGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIR 125320
127992 RFGRTGVYRTFMFSSPTILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDD 128171
128172 HRRIRKLTAAPINGFDALTTYLSFIDQTVVASLRRWSSPESGQVEFLTELRRMTFKIIVQ 128351
128352 IFMSGADDATMEALERSYTDLNYGMRAMAINLPGFAYYRALRARRKLVSVLQGVLDGRRA 128531
128532 AAAKGFKRSGAMDMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFL 128711
128712 QENPDIFARAKAEQEEIMRSIPAT 128891
128892 QNGLTLRDFKKMHFLSQ 128942
129448 VVDETLRCVNISFVSFRQATRDIFVN 129525
129704 GYLIPKGWKVQLWYRSVHMDDQVYPDPKMFNPSRWE 129811
129937 GPPPKAGTFLPFGLGARLCPGNDLAKLEISVFLHHFLLGYK 130059
130322 LKRANPKCRVRYLPHPRPVDNCLATITKV 130408

>AC079935.3 (japonica cultivargroup) cultivar
155791 MMSGMQTPVVAVGATDWAWRLGALVAGAVPLLALAV
       WHCTDAFHRAAFAFRRRGTRRARRLPPGHMGLPFV 155579
155578 GETLALLWYFNLARRPDAFIQAKRRRYCYGDGDDDAGIYRTHLFGSPAVLVCSPASNGFV 155399
155398 FRSAPPGSFGVGWPDPELVGVSSIVNVHGGRHARLRRFVLGAINSPNSLRSFAEVVQPRV 155219
155218 AAALRSWAAKGTITAATEIKK (0) 
       VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK (0)
       CRRKLNSVFREEVKRRKLKAKLEEHDDVMSGLMRMEDEQGRRLG
154678 DDEVVDNIVSLVLGGYKSTSSAIMWATYYLAKLSAVLAKLR 154556 (0)
148738 EENLAIAKEKNGASFITLDDISKMKYTAK 148652 (0)
148565 VVEETIRLANISPMLYRVALRDVEYR 148488 (1)
147994 GYTIPEGWKVIVWIRSLHVDPKYYDDPLSFNPDRWD 147887 (0)
146817 KAAKPGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK 146698 (2)
146576 WELLNPDAGVVYLPHPRPTDGAAMSFSKL* 146499

>AP004129.1 $F chromosome 2 clone OJ1007_A03 similar to 707A2
76179 MGAFLLFVCVLAPFLLVCAVRGRRRQAGSSEAAACGLPLPPGSMGWPYVGETFQLYSSKNPNVFF 76373
76374 NKKRNKYGPIFKTHILGCPCVMVSSPEAARFVLVTQAHLFKPTFPASKERMLGPQAIFFQ 76553
76554 QGDYHAHLRRIVSRAFSPESIRASVPAIEAIALRSLHSWDGQFVNTFQEMKT 76709 (0)
76814 YALNVALLSIFGEEEMRYIEELKQCYLTLEKGYNSMPVNLPGTLFHKAMKARKRLGA 76984
76985 IVAHIISARRERQRGNDLLGSFVDGREALTDAQIADNVIGVIFAARDTTASVLTWMVKF 77161
77162 LGDHPAVLKAVT 77197 (0)
77278 EEQLQIAKEKEASGEPLSWADTRRMKMTSRVIQETMRVASILSFTFREAVED 77433
77434 VEYQ 77445 (1)
77627 GYLIPKGWKVLPLFRNIHHNPDHFPCPEKFDPSRFE (0) 77734
77890 VAPKPNTFMPFGNGTHSCPGNELAKLEMLVLFHHLATKYR 78009
78010 WSTSKSESGVQFGPFALPLNGLPMSFTRKNTEQE* 78114

>AP004162.1 $F chromosome 8 clone OJ1320_D12, = AY023201.1 searched with 707A3 
35847 MAFLLFFVFVTAAVLCFVVPAFLLLCTSVQRRRDVGQGGGRDWQKKK
35706 KLRLPPGSMGWPYVGETLQLYSQDPNVFFASKQKR 35602 (2)
35464 YGEIFKTNLLGCPCVMLASPEAARFVLVSQARLFKPTYPPSKERMIGPSALFFHQGEYH 35288
35287 LRLRRLVQAALAPDSLRALVPDVDAAVAATLAAWSGGHVASTFHAMKK 35144 (0)
34944 LSFDVGVVTIFGGRLGRRHREELRTNYSVVERGYNCFPNRFPGTLYHKAIQ 34792 (0)
34706 ARKRLRAILSEIVAERRARGGGGGGGGDDLLGGLMRSRDDGTAGAVALLTDDQIADNV 34533
34532 VGVLFAAQDTTASVLTWILKYLHDSPKLLEAVK 34434 (0)
      AEQMAIYVANEGGKRPLTWTQTRSMTLTHQ (0)
33645 VILESLRMASIISFTFREAVADVEYK 33568 (1)
32047 GFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFK 31940 (0)
31338 VAPRPSTFLPFGSGVHACPGNELAKLEMLVLVHRLVTAYR 31219 (2)
31105 WEIVGASDEVEYSPFPVPRGGLNAKLWKQEAEEDMYMAMGTITAAGA* 30962

>AL606442.1 $F chromosome 4 clone OSJNBa0068L06 62% to 705A27
122031 MASLMEVQVPLLGMGTTMGALALALVVVVVVHVAVNAFGRRR
122157 LPPSPASLPVIGHLHLLRPPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIR 122333
122334 SHEAKISERPLTAVARQFAYESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRA 122513
122514 GLVSLLRHVLSQPEAEAVDLTRELIRMSNTSIIRMAASTVPSSVTEEAQELVKVVAELV 122690
122691 GAFNADDYIALCRGWDLQGLGRRAADVHKRFDALLEEMIRHKEEARMRKKTDTDV 122855
122856 GSKDLLDILLDKAEDGAAEVKLTRDNIKAFII 122951 (0)
123050 DVVTAGSDTSAAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRLPYLQAAYKETLRL 123247
123248 RPAAPIAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLEFRPERFLAGGGGE 123427
123428 GVEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCMDNKLIDMEEADG 123604
123605 LVCARKHRLLLHAHPRLHPFPPLL* 123679

>AL607097.1 chromosome X clone OSJNBa0082A03 = AY021309.1
118528 MEEGVVGGGGAAVLVALLVTVVLAVMRSAGSRSSKRGRLPPSPMALPIIGHLHLIRPPPHRAFDRILARH 118737
118738 GPLVYLRLGPSTHCVVIGSADVARDFLKFEASIPERPPTAVTRQLAYGKAGFAFAPYGA 118914
118915 YWRFVKRLCMSELLGPRTVELLRPVRAAELADVLRAAQSAAERGEGVDMSHELVRMA 119085
119086 NNSIMRMVASALPGEMAEAARDCAKQVAELVGAFNAEDFVAVCRGWDLQGIGRRT 119250
119251 NEVHARFDALLETIIEAKEEARRRSLRLGRRESSSKDLLDMLMDAAEDDTAEVKLTRD 119424
119425 NIKAFVL (0) 
       DIF 119604
119605 TAGSDTTATTVEWMLAELVNHPECMAKLRGELDAVVGRSRLVGEQDVARLPYLQAVLKET 119784
119785 LRLRPPAVFAQRVTVEPVQVRGYTIPTDTQVFFNIFSIGRDATYWDQPLHFRPDRFL 119955
119956 PDGAGATVDPKGQHPQLMPFGSGRRACPGMGLAMQAVPAFLAALVQCFDWAPPPSQP 120126
120127 LPLDMEEAAGLVSARKHPLLLLPTPRIQPLPSFYS* 120234

>C73729 39% to 88A1 43% to 707A1 44% to 90A1 85 CLAN ortholog of AAAA01010113.1 $FI
STASAIMWATYHLAKSPSALAKLR (0?)
EENLAIAKEKNGDGFITLEDVSKMKYTAK (0?)
VVEDTIRLANIAPMAHRVALRDVEYR (1?)
GYTIPKGWKVIVWFRSLHVGPXYYDXPL

>aaaa01010113.1 (indica cultivargroup) ortholog of C73729
6784 MSGATADWAWWLGLVAGAVPLLALAVWHCTDAFHSAAFAFRRRGTRAR
     LPPGHMGLPFVGETLALIWYFNLARRPDAFIEAKRRRYCYGDGDDDGGIYRTHLFGSPAV 1481
     LVCSPASNGFVFRSAPPGSFGVGWPVPELVGASSLVNVHGGRHARLRRFVLGAINRPG 1307
     SLRTIARVAQPRVAAALRSWAAKGTITAATEMKN (0) 6185
5443 VTFENICKIFVSMEPSPLTEKIHGWFTGLVAGFRSLPLDMPGTALHHARK (0) 5294
5218 CRRKLNSVFREELERRKVKMVTGEGGDDDDDGDLMSGLMHVEDEQGR
     RLD DDEVVDNIVSLVIAGYESTASAIMWATYHLAKSPSALAKLR 4946 (0)
2321 EENLAIAKEKNGDGFITLEDVSKMKYTAK 2235 (0)
2148 VVEETIRLANIAPMAHRVALRDVEYR 2071 (1)
1745 GYTIPKGWKVIVWIRSLHVDPAHYDNPLSFNPDRWD (0) 1638
9851 KSAELGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK (2) 9970
10088 WELLNPDAGIVYLPHPRPTDGAVMSFSEL* 10177

>aaaa01001707.1b (indica cultivargroup) PLUS STRAND NTERM aa 1262
13182 MMSGMQTPVVAVGATDWAWRLGALVAGAVPLLALAVWHCTDAFHCAAFAFRRRGTRRARR 13361
13362 LPPGHMGLPFVGETLALLWYFNLARRPDAFIEAKRRRYCYGDGDDDAGIYRTHLFGSPAV 13541
13542 LVCSPASNGFVFRSAPPGSFGVGWPDPELVGVSSIVNVHGGRHARLRRFVLGAINSPNSL 13721
13722 RSFAEVVQPRVAAALRSWAAKGTITAATEIKK (0) 
13909 VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK 14058 (0)

>aaaa01001707.1c (indica cultivargroup) MINUS STRAND aa 148507
27328 ELVGVSSIVNVHGGRHARLRRFVLGAINSPNSL
      RSFAEVVQPRVAAALRSWAAKGTITAATEMKK 27134 (0)
27014 VTFENICRMFVSMEPSPATAKIDEWFAGLVAGFRALQLDIPGTAFHHARK 26865 (0)
26763 QCRRKLNSVFREEVKRRKLKAKLEEHDDVMSGLMRMEDEQGRRLGDDEVVDSIVSLVLGG 26584
26583 YESTSSAIMWATYHLAKLPAVLAKLR 26506 (0)
20697 EENLAIAKEKNGASFITLDDISKMKYTAK 20611 (0)
20524 VVEETIRLANISPMLYRVALRDVEYR 20447 (1)
19953 GYTIPEGWKVIVWIRSLHVDPKYYDDPLSFNPDRWD 19846 (0)
18777 KAAKPGTYQVFGGGERICAGNMLARLQLTIMLHHLSCGYK 18658 (2)
18547 WELLNPDAGVVYLPRPRPTNGAAMSFSKL* 18458

>AL606588.1 $F chromosome 4 clone OSJNBa0016O02 = D15214 AQ576430 85 clan
165880 MVGGELVLAALVILLALLLTLVLSHFLPLLLNPKAPK
165769 GSFGWPLLGETLRFLSPHASNTLGSFLEDHCSR 165671 (2)
165313 YGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSSMLVVLGEDH 165137
165136 KRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFCEEARK 164999 (0)
164739 FAFSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKA 164587 (0)
164467 ARARISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGYETTSLLISMVVYFLGQS 164255
164254 AQDLELVK (0) 
       REHEGIRSKKEKDEFLSSEDYKKMEYTQH 164042 (0)
163752 VINEALRCGNIVKFVHRKALKDVRYK 163675 (1)
163488 EYLIPSGWKVLPVFSAVHLNPLLHGNAQQFQPCRWE 163381 (0)
162923 GASQGTSKKFTPFGGGPRLCPGSELAKVEAAFFLHHLVLNYR 162798 (2)
162134 WRIDGDDIPMAYPYVEFQRGLPIEIEPLCSES* 162036

>AC104473.1 chromosome 3 63% to AL606588.1 85 clan same as AQ689106 77% to 90B1
      MAAMMASITSELLFFLPFILLALLTFYTTTVAKCHGGHWWRGGTTPA
34958 KRKRMNLPPGAAGWPLVGETFGYLRAHPATSVGRFMEQHIAR 34833 (2)
34664 YGKIYRSSLFGERTVVSADAGLNRYILQN 34578
34577 EGRLFECSYPRSIGGILGKWSMLVLVGDPHREMRAISLNFLSSVRLRAVLLPEVERHTLL 34398
34397 VLRAWPPSSTFSAQHQAKK 34341 (0)
34237 FTFNLMAKNIMSMDPGEEETERLRREYITFMKGVVSAPLNLPGTPYWKALK 34082 (0)
31271 SRAAILGVIERKMEERVEKLSKEDASVEQDDLLGWALKQSNLSKEQILDLLLSLLFAGHE 31092
31091 TSSMALALAIFFLEGCPKAVQELR (0)
30871 EEHLGIARRQRLRGECKLSWEDYKEMVFTQC 30776 (0)
29986 VINETLRLGNVVRFLHRKVIKDVHYK 29909 (1)
29811 GYDIPSGWKILPVLAAVHLDSSLYEDPQRFNPWRWK 29704 (0)
28816 SSGSSGGLAQSSSFMPYGGGTRLCAGSELAKLEMAVFLHHLVLNFRW 28676
28675 ELAEPDQAFVFPFVDFPKGLPIRVHRIAQDDEQE* 28571

>AP003244 $F 59% to 90D1
MVSAAAGWAAPAFAVAAVVIWVVLCSELLRRRRRGAGSGKGDAA
AAARLPPGSFGWPVVGETLEFVSCAYSPRPEAFVDKRRKLHGSAVFRSHLFGSATVVT
ADAEVSRFVLQSDARAFVPWYPRSLTELMGKSSILLINGALQRRVHGLVGAFFKSSHL
KSQLTADMRRRLSPALSSFPDSSLLHVQHLAKSVVFEILVRGLIGLEAGEEMQQLKQQ
FQEFIVGLMSLPIKLPGTRLYRSLQAKKKMARLIQRIIREKRARRAAASPPRDAIDVL
IGDGSDELTDELISDNMIDLMIPAEDSVPVLITLAVKFLSECPLALHQLEEENIQLKR
RKTDMGETLQWTDYMSLSFTQHVITETLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCV
FVYFRSVHLDDTLYDEPYKFNPWRWKEKDMSNGSFTPFGGGQRLCPGLDLARLEASIF
LHHLVTSFRWVAEEDHIVNFPTVRLKRGMPIRVTAKEDDD

>AP004314.1 $P chromosome 7 clone P0495H05, Length = 205470 90D like
137016 QAKKKMVRLIQRIIWDKRARRATTGPP
136946 RDAIDVLFRDTSDELTDELISDTMIDLMIPAGDSVPVLITLTVKFLSECLLALHQLEXXXXXX 136776
135719 KRRKTSMGETLQWTDMSLSFTXX 135657
135520 VITETLWLGNIIGGIMHKAVRGVEVNGYLIPKGWC 135416 
135413 SVHLDDMLYDEPYKFNP*RSK
134847 EKDMSNGSFTPFGGGQRLCPGLDLARLEASIFFHHLVTSFRY 134722

>AP003895.1 $P chromosome 7 clone OJ1564_F08 pseudogene of AP003244 gene (CYP90D like)
59055 QAKKKMVRLIQRIIWDKRARRA 59120 
59119 PPRDAIDVLFRDTSDELTDELISDTMIDLMIPAGDSVPVLITLTVKFLS 59265
59266 ECLLALHQLE 59295 (0) 
      EENMQL 60350 
60352 KRRKTSMGETLQWTDMSLSFTH 60414 (0) 
60551 VITETLWLGNIIGGIMHKAVRGVEVNGYLIPKGWC 60655 
60658 SVHLDDMLYDEPYKFNP*RSK 60720 (0)
61224  EKDMSNGSFTPFGGGQRLCPGLDLARLEASIFFHHLVTSFRY 61349

>AP003850.1 $P chromosome 7 clone OJ1793_E11 pseudogene fragment last half of ex 4 
14670 SLRYLVRQFRWKLCCKEEGYRNATPMPVLGLPIELETRSPPDYAHA* 14810

>AP003850.1 $F chromosome 7 clone OJ1793_E11 gene 1 36% to 725A1 83% to gene 2
22610 MSMDSSMLLALLLALFIPILLHLVTRRKYASYNLPSGSLGFPLIGQTISLLRALRKNT 22783
22784 DYQWYQDRIKKYGPVSKMSVFGSPTVLLTGPAANRFAFCNPDLIFTQTKALNALV 22948
22951 RSILMLSGEELKQVRSAVQGYLRPEMVTKYIWKMDKEVRRHIDLHWVGQKTLT (0)
      VAPLAKRLTFNITCSVFFGEEAGP 23310
23311 IREALATDFEALVKATLSIPVNIPFTKFNKGLSASWRIRKLLSRIARERE 23460
23461 AALQQGRCSSTDDFFTYMIALRSEG 23535 
23535 HTLTVEDIVDNAILLLTAGYETTSVLIIFLLRYLANEPDILGNITE (1) 23672
      EQEEIARNKGPNEPLTWDDVSRMKYTWKVAMETLRTVPAIFGSFRT 23894
23895 AIKDIEYQGYHIPKGWQ 23945 (0)
24091 IFTDQIVTHLDTNFFDGPRKFDPARFHNQSSIPPYCFVPFGGGPRMCPGNEFAKTGTLV 24267
24268 AMHYLVRQFRWKLCCKEEGYRKDPTPMPLLGLPIDLETRSPPGYAHS* 24411

>AP003850.1 $P chromosome 7 clone OJ1793_E11 pseudogene fragment end of exon 2 
24875 SFTVEDIVDNAIFLLIAGYETTSVLITFIPWHLDKEPEILGK 25000

>AP003850.1 $F chromosome 7 clone OJ1793_E11 gene 2 37% to 725A1 59% to Zea AF090447
26522 MDSSMPFALLLALLIPILLHFVIRRKYSSYNLPPGSLGFPVIGQSISLLRAL 26677
26678 RSNTDYQWYQDRIKKYGPVSKMSVFGSPTVLLTGPAANRFVFSNQDLIITETKAANALIG 26857
26858 RSILTLSGEELKQVRSALQGYLRTEMVTKCIRKMDEEVRRHIDLNWVGQKTVT 27016 (0)
27144 VAPLAKRLTFDIICSVIFGQGAGPIREALAADFKKMVQAMLSIPVNIPFTKFNKGL 27311
27312 SASRRVRKVLRQIARDREAALQQGHSSSADDFFTYMLVLRSEGTHSL 27452
27453 TVEDIVDNAILLLLAGYETSSVLITFLLRYLANEPDILGKITE 27581 (1)
27674 EQEEIARYKGPDEPLTWDDVSRMKYTWKVAMETLQTVPPIFGSLRTAIKDIEYQGYHIPKGWQ 27862 (0)
28024 VFTAIIITHLDANFSDDPNKFNPARFHNQSSVPPYCFVPFGGGPRMCPGNEFARTETLV 28200
28201 AMHYLVRQFRWKLCCKDEGYRKDPVPMPLELPIELETRSSPWICLK* 28341 

>AP003850.1 $F chromosome 7 clone OJ1793_E11 gene 3 37% to 725A1 85% to gene 2
32688 MSMDSSIPFALLLALLIPILLHVVIRRKYSSYNLPPGSLGFPVIGQTISLLRALHSNTDYQ 32870
32871 WCQDRIEKYGAVSKMSLFGSPTVLLAGPGANHFVFSNQDLIFTETKAINALVGRSILTLS 33050
33051 GEELKQVRGALHGYLRPEMVTKYMRKMDEEVRRHIDLNWVGHKTVT (0)
      VAPLARRLAFDIICSVIFGQGVGPIREALAADFETMVK 33410
33411 AMLSIPVNIPFTKFNKGLNASRRIRKVLRQIARDMEGALQQGYSSSA 33551
33552 DDFFTYMLVLRSKGTHSLTVEDIVDNAIVLLAAGYETSSVLITFLIRCLANEPDIFGKITD 33734 (1)  
      EQEEIARSKGPNEPLTWDDVSRMKYT 33911
33912 WKVALEILRTISPIFGSFRTAIKDIEYRGYHIPKGWQ 34022
34162 VFHAQSITHLDGKFFNDPIKFDPTRFDNQSLIPPYCFVPFGGGPSMCPGNEFPRTETLV 34338
34339 AMHYLVRQFRWKLCCKEEGYRKDPLPTPVLGLPIELETRTPPEYAHA* 34482

>AP003850.1 $F chromosome 7 clone OJ1793_E11 gene 4 37% to 725A1 87% to gene 2
44135 MPFALLLALLIPILLHFVIRRKYSSYNLPPGSLGFPVIGQSISLLRAL 44278
44279 RSNTDYQWYQDRIKKYGPVFKMSLFGSPTVLMAGPAANHFVFSNQDLIFTQTKAINTIIG 44458
44459 RSILTLSGEELKQVRGALQGHLRPEMVTKYMRKMDEEVRRHIDLNWVGHKTVK (0)
      VAPLAKRLTFDIICSVVFGQGIGPIREALATD 44818
44819 FETLVQALLSLPVNIPFTKFNKGLSASRRIRKVLRQIAREREAALQQ 44959
44960 GHSSSADDFFTYMLVLRSEGTHSLTVEDIVDNAIVLLTAGYGNSAVLITFLLRYLANDPDILGKITE 45160 (1)
45259 EQEEIASSRGPNEPLTWDDVSRMKYTWKVALETLRTVPPIFGSFRTAIKDIEYRGYHIPKGWK (0) 
45601 VFTAQSITHLDGNFFNDPVKFDPTRFDNQTSIPPYCFVPFGGGPRMCPGNEFARTETLVTMHYL 45792
45793 VRQFRWKLCCKEEGYRKDPLPMPVLGLPMELETRSPP* 45906

>AP003850.1 $P chromosome 7 clone OJ1793_E11 pseudogene 5 missing Nterminal 29 aa
48172 SIPPGSLGLPLIGQSLALLRAMP 48240 
48243 RNTAERWLQDRIDRYGPVSKLSLFGAPTVLLAGPAANKVVFLHEALAPKQPRSLATI 48413 
48415 PREEEHPGARQRADAVPQAGDAAAVRGKDRRRGE
48517 VRRHLADRWAGRRTVTVLPLMKTLTFDIIATLLFGLERGAIREQLADAYTGMLEGTQSVPVDL 48705 
48711 PFTAFRNGLKAIERDGAPAARGDRELREKKANLEEQGKSS 48830
48831 PTDDPISCLVSLRLRRRRRPAAADRWRRRSSITPCSNALVAGHDTSAILLTFMVRHLAND 49010
49011 PATLAAMVQ (1)  
      EHDEIAKSKQEGEALTRE 49190
49191 DVTRMKLSWRVAQESTR 49241 
49243 DIEVDGYVIPKGWQAFWSPCVTHMDPAKFLPSRFDAQAASAAPPPPL 49383
49384 P*SFVAFGGGPRVCPGMELARVETLVTTHYLVRHFRWQLCC 49506 
49517 EENTFVRDPLPTPLNGLPVELDRIAPLW* 49603

>AP003850.1 $F chromosome 7 clone OJ1793_E11 gene 6 0ne in frame stop codon
60284 MDSSMPFALLLALLIPTLLRFVIRRKY
60365 SSYNLPPGSLGFPLIGQSISLLRALRSNTDYQWYQDRIKKYGPVFKMSLFGSPTVLMAGP 60544
60545 AANHFVFSNQDLIFTQTKAINTILGRSILTLSGEELKRVRSALQGYLRLEMVTKYMRKMD 60724
60725 EEVRRHIDLNWVGHKTVK  (0) 
60884 AAPLAKRLTFDIICSVVFGQGIGPIREALATDFETLVQALLSLPVNIPFTKFIKGLRASRRIRKVLR 61084
61085 QIAREREAALQQGHSSSADDFFTYMLVLRSEGTHSLTVEDIVDNAIV 61225
61226 LLTAGYGNSAVLITFLLRYLANDPDILGKITE 61321 (1)
61420 EQEEIARRKGPNEPLTWDDVSRMKYTWKVALETLRTVPPIFGSFRTAVKDIEYHGYHIPKGWQ (0) 
61762 VFTAQRITHLDGNFFNDPVKFDPTRFDNHTSIPPYCFVPFGGGPRMCPGNEFARTEILVTMH*L 61953
61954 VRQFRWKLCCEEEGYRKDPVPIPVLGLPIELETRSPPEYAHA* 62082

>AP003850.1 $F chromosome 7 clone OJ1793_E11 36% to 716A2
65671 MALAVVVVALLVAFLTPLAVYLAGRSTRTKPPPRRNLPPGSLGLPLVGQSLSLLRAMRRNTAER 65862
65863 WLQGRIDRYGPVSKLSLFGAPTVLLAGPAANKAVFLSEALAPKQPRSLAAIIGRRNMLEL 66042
66043 VGDDHRRVRGALAQFLRPEMLRRYVGRIDGEVRRHLAGRWAGRRTVAVLPLMKLL 66207
66208 TLDVIATLLFGLARGAVRERLAAAFADMLEGLWAVPLDLPFTAFRRSLRASARARRL 66378
66379 LAATVREKKANLEQGESSPSDDLISYLVSLRDGDGGGGRPLLTEEEIIDNSIVCLTAGHD 66558
66559 TSAILLTFMVRHLADDPAILAAM (0) 
      HEEIARSKRD 66738
66739 GEALTWEDVARMKLTWRVAQETLRMVPPVFGSFRRALEDVELDGGYVIPKGWQVFW 66906
66907 APCVTHMDPAIYHDPDKFDPSRFDAQAAASAPPPYSFVAFGGGPRICPGMELARVETLV 67083
67084 TMHYLVRHFRWRLCCGGEENTFVRDPLPSPANGLPVELDHIAPLRCDEFNS* 61239

>AP004051.1 $F chromosome 7 clone OJ1218_C12 similar to AP003850
27221 MAVVAVAVVIALLAAFLTPLAVYLARRASPPPP
27122 PRRNLPPGSLGLPLIGQSLSLLRAMRRNTADRWLQDRIDRYGPVSKLSLFGAPTVLVAG 26946
26945 PAANKVVFHHEALAPKQPRSLAAIIGRRNILELVGDDHRRVRGAILQFLRPDMV 26784
26783 RRYVGKIDSEVRRHLAARWAGRRTVAVFPLMKTLAFDVIATLLFGLDRGAIREQLA 26616
26615 DAFDGMHEGLWTVPVDLPFTPFRRGLMASARARRLVEATVREKAAKLEH 26469
26468 GESSPSDDLISCLLSLRDGGRQLLTEEEIVDNSVLALVAGHDTSAVLLTFMLRH 26307
26306 LANDPATLAAM 26292 (0?) 
      HEEIARGKRDGEALTCEDVAKMKLSWRVAQETLRMVPPVLGSFRRAPVDVEFEGYTI 26017
26016 PRGWQIFWSPSVTHMDPAIFHEPTKFEPSRFDGAAAAAAYSFVPFGGGPRICPGMEL 25846
25845 ARVETLVTAHYLVRHFRWKLCLGEEKNTFLRDPMPTPHDGLPVELDHIAPLC* 25687

>AC092557.2 $F chromosome 3 clone OSJNBa0096I06 
11388 MAVFGAAVLVALAVTCGLIWSRSRRLSKEMRDIPGTMGWPVVGETFSFISGFSSPAGILSFMRDRQKR 11185 (2) 
11068 FGKVFKTYVLGRMTVFMTGREAAKILLSGKDGVVSLNLFYTGKQVLGPTSLLTTNGD 10898
10897 EHKKLRRLIGEPLSIDALKKHFDFINDLAVQTLDTWLDRRVLVLEEASS 10751 (0) 
10664 FTLKVIANMLISLEPEGEEQEKFRANFKIISSSFASLPLKIPGTAFHRGLK 10512 (0)
10413 ARNRMYAMLDSVIARRRDGGEVRNDFLQTLLRKHAKDGTAADEDDGGGGGDRTLNG 10258
10257 DADKLTDAQLKDNILTLLVAGHDTTTAGLTWLIKFLGENPEALQKLR 10117 (0) 
      EEHMEIKERLDGSSHLRWSDVNSMPYTNK (0) 
9726  VMNETLRRATILPWFSRKAAQDFSID 9649 (1)
9538  GYEIKKGTSVNLDVVSIHHDPSVFADPYKFDPNRFD (0) 
9345  GTLKPYSFLGFGSGPRMCPGMSLARLEICVFIHHLVCRYS 9244 (2)
9165  WTPLEDDDSVQPTLVRMLRNKYPIVAAAI* 9076

>AC073405.2 $F chromosome 5 clone P0036D10, complete sequenceLength = 156772  
MESLAAGAWWVVVLLLLVLTIVASWYRSWWKTTEAGGPLLPPPAAGAGPWWVWVWQWR
72407 ETAAFLASHGSGRGFYHFVQERYKLYKGEGEGEATCCFRTALMGRVHVFVSASHPAASQL 72228
72227 LTAEPPHLPKRYARTAADLLGPHSILCSTSHAHHRHARRALATTLFATPSTAAFAAAFDR 72048
72047 LVIRHWTTLLPPHNQNQVVVVLDAALHISYRAICEMLLGAGGGKLRPLQSDVFAVTQAM 71871
71870 LALPLRWLPGTRFRRGLHARKRIMAALREEMAARNHHHHHHHHHHDLLSVLMQRRQLGH 71694
71693 PDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLSDNRLIQDKLR 71556
      AEAFRLELKGDYSLTMQHLNAMDYAYK
71216 AVKESLRMATIVSWFPRVALKDCQVA 71139
70844 GFHIKKDWIVNIDARSLHYDPDVFDNPTVFDPSRFDV 70734
70609 QPQKRRLLVFGAGGRTCLGMNHAKIMMLIFLHRLLTNFR 70493
70397 WEMADDDPSLEKWAMFPRLKNGCPILLTPIHNS* 70296

>AP003232.1 $F chromosome 1 clone P0034E02 one in frame stop
100994 MEFSSSSTSLFLLLSILPLLYFLCQRNDPKKQPHAHGLKSYPVVGIVPHFTKNNDRF 100824
100823 LEFTTEIMKRSPTQTMSFKALGLTGGGVITANPANVEYTLKTNFGNYPKGELAVSMVVDF 100644
100643 LGHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVERLLPLLERAERDGRTLD 100464
100463 VQDVLERFAFDNICQVAFDEDPACLAEDSMASPQSAEFMRAFNDAQIAVRDRFMSPVKSL 100284
100283 WRFKRLFNMEPERRMREALATIHGFAERIVRERRERGKAGLARSDDFLSRFAASGEHSDE 100104
100103 SLRDVVTNFLLAGRDTTSSALTWFFWVLSGRPDVEDKIVREIHAVRRASGSTSDATFSFD 99924
99923  ELRDMQYLHAAITESMRLYPPVAMDTHSCKEDDFLPDGTFVGKGWLVTY*AYAMARVEDI 99744
99743  WGADCEEFRPERWLDEVGAFRPESPFKYPVFHAGPRMCLGKEMADIQMKSIVASVLERFS 99564
99563  LQYAGGEGHPGLVLSVTLRMKGGLPMQVATRG* 99465

>AP003232.1 $F chromosome 1 clone P0034E02 
91065 MEFSSSSTSLFLLLSILPLLYFLCQRHDPKKQPHAHGLKSYPVVGTLPHFAKNKDRF 90895
90894 LEFITEIMKRSPTHTLSFKALGLTGGVITANPANVEYTLKTNFGNYPKGELAVSMLVDFL 90715
90714 GHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVERLLPLLERAERDGRTLDV 90535
90534 QDVLERFAFDNICHVAFDEDPACLAEDSMASPQSAKFMRAFSDAQNAVMDRFMSPVKSRW 90355
90354 RFKRLFNMEPERQMREALATIHGFAERIVRERRERGEAGLARSDDFLSRFAASGDHSDES 90175
90174 LRDVVTNFLIAGRDTTSTALTWFFWLLSGRPDVEDKIVREIHAVRRASGGTGDPTFNLDE 89995
89994 LRDMQYLHAAITESMRLYPPVAMDSHSCKEDDFLPDGTFVGKGWFVSYSAYAMARVEDIW 89815
89814 GADCEEFRPERWLDEAGAFRPESPFKYPVFHAGPRMCLGKEMAYIQMKSIVASVLERFSL 89635
89634 RYAGGEGHPGFVLWLTLRMKGGLPMQVTTRG* 89539

>AP003232.1 $F chromosome 1 clone P0034E02 
86279 MKFSSTSTPLFILLLPFLPLLYFLYLYQDTKKQPAGSNGLKSYPVVGTLPHFAKNRHRFLEWST 86088
86087 DVMKRSPTHTMTFKALGLTGGVITANVANVEHILKTNFSNYPKGELSVSLLEDLLGHGIF 85908
85907 NSDGEQWLWQRKAASYEFNQRSLRSFVVDTVRFEVVERLLPLLEWARRDGRTLDVQDVLE 85728
85727 RFAFDNICHVVFHEDPACLAEDSMVSSQSAEFIRACSDAQNAIIARFMSPVKSLWRVKRL 85548
85547 FNLDPERRMRDALTTIHGYADRIVRERRARGEAGLARSDDFLSRFAAGGEHSDESLRDVV 85368
85367 TNFLIAGRDSTSSALTWFFWLVSSRPDVEDKIVHEIRAVRSASSSGGTSSATFSFDELRD 85188
85187 MHYLHAAITESMRLYPPVHLDTHSCKEDDFLPDGTFVGKGWLVTYCAYAMGRVEDIWGAD 85008
85007 CEEFRPERWLDEAGAFRPDSPFKYPIFHAGPRMCLGKEMAYIQMKSIVACVLEQFSLRYA 84828
84827 GGDGHPGFVLWSTLRMEGGLPMQVTTRE* 84741

>AP003232.1 $F chromosome 1 clone P0034E02 51% to 94D1 4 diffs with BE230752
81213 MELSPISASLLLILILLAFLPLLYFLYMHQDPKKKPRIHGLKSYPVVGTLPHIIKNK 81043
81042 HRFLKWSTSIMKCSPTNTMSYKALGLTGGVITANPANVEHILKTNFDNYPKGKLTVSML 80866
80865 EDFLGHGIFNSDGEQWLWQRKAASYEFNKRSLRNFVVDTVRFEIVKRLLPLLEQAGLDGR 80686
80685 TLDLQDVLERFAFDNICLVAFGEDPACLTKERMAAPQSAEFMRAFNDAQNAILARFNSPA 80506
80505 KSLWRVKKLFNMEPERRMREALATIHGFAERIVRERRERGEAGLARGDDFLSRFAASGEH 80326
80325 SDESLRDVVTNFVLAGRDTTSSALTWFFWIVSGRPDVEDRVVREIRAVRASSGSTDATF 80149
80148 SFDELREKHYLHAAITESMRLYPPVAIDTHSCKEDDFLPDGTFVGKGWL 80002
80001 VMYSAYAMGRMEGIWGADCEEYRPERWLDEAGAFRPESTFKYPVFNAGPRICIGKE 79834
79833 MAYIQMKSIVACVLEKFSLRYAS 79765
      DANERPRSVLSLTLRMKWGLPMKVTIRK* 79678

>AC105364.1 $F chromosome 3 53% to 94D2
53146 MAAILLLLLVFLVSVALVVRTWSASRRSHEKARYATAELRPY
53273 PLVGHLPQFLANRHRILDWMTEVLSRQPTRTFVLRRPGGVRGVITANPANVERF 53434
53435 LRSGFDNYPKGERFASLLHDFLGRGIFNADGEAWRSQRKAASYEFNTRSLRAFVARCVHG 53614
53615 ELHGRLLPLLRRAAAEGRAIDLQDALERFAFDNICRVAFDHDPGQLPDASGGGALAEADD 53794
53795 GSTASGRFADAFRDAANLSAGRFRYAVPWFWRVKKALHIGSERRLRESIAIVHDFADRII 53974
53975 RSRREEIRAGLEKHDLLSRFMASHDESYTEVALRDVVISFLLAGRETTSSALTWFFW 54145
54146 LLSSRPDVERRIREEVATVRARRGDGDVDRVGFDLDELREMQYVHAAITESMRLYPP 54316
54317 VPVDSLHAQEDDVLPDGTAVEAGWFVAYNSYAMGRMESVWGKDAAEFRAERWLEDAAAAT 54496
54497 FRPESPFRYVSFHGGPRVCLGKEMAYIQMKSIIACVLQELELAVDGAYRPRQVTSLTLRM 54676
54677 ADGLPTRVKVRGN* 54718

>AP003232.1 $F chromosome 1 clone P0034E02 
76378 MELSSISASLLLILPLLPLLYFLYLHQDPKKQPRAHGLKSYPVVGTLPHFIKHKNHI 76208
76207 LEWSAGVLKRSPMHTMSFKALGLTGGVFTANPANVEHMLKTNFGNYVKGEAIITMLEDFL 76028
76027 GRGIFNSDGEKWLWQRKATSYEFSKRTLRNFVVDTVQFEVIERLLPLLERAGRDGRTLDV 75848
75847 QSVLERFAFDNICRVVFDEDPACLAKDSVASPHIAEFMGACNDAQNAILARFNSPIKSLW 75668
75667 RVKRLFNIESERRLREALATIHAYTDRIIRERRERGEARGDDFLSRFAAGDKHSDES 75497
75496 LHDVITNLVLAGRETTASALTWFFWLVSGRPDVEDNIVREIRAVRRASSSNGVTSGAAFS 75317
75316 PHELRDMHYLHAAITESMRLYPPVSLDTYVCKEEDFLPDGTFVGKGWQVTYCAYAMARVE 75137
75136 DIWGTDCEEFRPERWLDEAGVFRPESSFKYPVFHGGPRMCLGKEIAYIQMKSIVSCVFDR 74957
74956 FTLRYTGGEGHPGLVTSLALRMEGGLPMQVLLTNRGQAVSC* 74831 

>AP003232.1 $P chromosome 1 clone P0034E02 pseudogene fragments 
67707 FT*VFNDAQNTIVSRFLS*VKSL*RFKRLFNMEPKRQMWEALAR 67576
67575 HDPATPSGSFSKHNN*SLREVVTSFLLA 67492
67313 TFVGKGWLVIYYAYAMRYVEDIRGSDCEEFRLEQWMNKAGVF*PKSSFK 67167
67164 FEYPIFYIGQRMCLGKEMTYIHGFGFTALEKLMQRVA 67054

>AP003232.1 $F chromosome 1 clone P0034E02 
60720 MELSSTSASLLLILLLTLVYFLYLHQDPKKKPRTHGLKSYPVVGTLPHFINNKDRF 60553
60552 LEWSTGVMKRSPTHTMSFKELGLTGGVITANPANVEHILKANFGNYPKGELAVSLLEDFL 60373
60372 GHGIFNSDGEQWLWQRKAASYEFNKRSLRNFVVDTVRFEVVERLLPLLEYAGRHGRTLDV 60193
60192 QDVLERFAFDNICRVAFDEDPACLTEESMAAPQSAEFMRAFNDAQNAILDRFNSPAKSLW 60013
60012 RIKKLFNMEPERRMRDSLATIHGYAERIVRERRERREARLERRDDFLSRFAASGEHSDES 59833
59832 LRDVVTNFILAGRDTTSSALTWFFWLLSGRPDVEDKIVREIRAVRQSSAGSEGTRGATFS 59653
59652 LDELRDMQYLHAAITESMRLYPPVPFDTHSCKEEEFLPDGTFAGKGWLVTYCAYAMGRVE 59473
59472 DIWGADCEEFRPERWLDEAGAFRPESTFKYPVFHAGPRMCLGKEMAYIQMKSIVACVLEQ 59293
59292 FSLRYAGDAKGHPGLVVALTLRMEGGLPMKVTIRE* 59185

>AP003232.1 $F chromosome 1 clone P0034E02 
43934 MGTELSLTSSVPLLLLLLFPLLCFLCLRHGSTRKQPRADGLKAYPIVGILPHFVRNQHRL 43755
43754 LEWSAGVVARCPTHTMSFNFKGFGLIAGAITGNPANVEHIVKTNFQNYSKGEYVVSVMED 43575
43574 FLGHGIFNSDGDQWLWQRKAASYEFNKRSLRNFVVDTVRSEVVDRLLPLLTRAERDGRTL 43395
43394 DEQDVLERFAFDNVCCVAFDEDPACLTEEGMGTNARTEFLRAFNDAQNILMARFMSPVEW 43215
43214 AWRAKRLLDLEPERRMREALATIHGYADRIVRERRERGAAGLARKDDFLSRFAATGKHSD 43035
43034 ESLRDVX 43017 
43014 TNFVLAGRDTTSSALTWFFWLVSGQPDVEDRIAREIRAVRASSGSTDAAAFSFDELREMH 42835
42834 YLHAAITEAMRLYPPVAMDSHCCQNDDVLPDGTFVGKGWQVTYSAYAMARLEELWGADCE 42655
42654 EFRPERWLDEDGVFRPESPFKYPVFHGGPRMCLGKEMAYIQMKSIAACVFERFSFRFVG 42478
42477 GEGRPGLVFSVTLRMEGGLPMRVKKRRDSVC* 42382

>AP004239.1 $P chr 6 clone OJ1115_C07 90% identical to Ihelix region of AP003232
136094 SSALTWFFWILSGRPDVEKR 136153

>AC090870.8 $P chromosome 10 clone OSJNBb0015K05 
104876 KVMKRSPTHTMSFKALGLTGGVITANPANVEYTLKTNFGNYPKGELAVSMLVDFLGHGIF 105055
105056 NSDGEQWLWQQKAASYKFNKRSLRNFVVDTVRFEVVERLLPLLERAERDGRMLDVQDVLE 105235
105236 CFAFDNICHVAFDEDPACLA 105295 
105297 EESMASPQSAEFMRAFNDAQNAVMDRFMSPVKSRWCFKRLFNMEPERRLQEVLATIHGFA 105476
105477 ERIVGERRERVVAGLARSDDFLLRFAASGEHSNESLRDVVTNFLLVGHDTTSSALTWFLC 105656
105657 RPVVEKREEKE 105689

>AP003735.2 $F genomic DNA, chromosome 1, BAC clone:B1147A04, complete 39% to 94A2
4872 MYMQMDSSYLHLVLPAAAAAVVVAVVLLLSLWRRCQ
4981 TTSNHRPQANPILGNLVAFLANGHRFLDWSTGLLAAAPASTMQVHGPLGLGYCGVATASP 5160
5161 DAVEHMLRASFHNYVDKGDRVRDAFADLLGDGLFLANGRLWRLQRKLAASSFSPRLLRLF 5340
5341 AGRVVLDQLRRRLLLFFDAAADARRVFDLQDVLKRFAFDNICSVAFGVDRDDSSPSSSSP 5520
5521 SRLEAGGDGRDDAFFAAFDDAIDISFGRILHPTTLAWKAMKLLDVGSERRLRQAIGVVDE 5700
5701 YVTAIMESKQRCSDSEEESDLLSRFTAAMMEEDGGNELGAMFDSPEAKRRFLRD 5862
5863 TVKTFVLAGKDTTSSALTWLFWFLAANPECERRVYEEVTALRGDTAGDERDDGYEELKRM 6042
6043 HYLHAAITETMRLYPPVPLASRVAAADDVLPDGTVVRAGWFADYSSYAMGRMPQLWERDC 6222
6223 GEFRPERWLDGGGGGGGRFVAVDAARYPVFHAGPRSCLGKEMAYVQMKAVAAAVVRRFSV 6402
6403 EVVPAAAANAPPSPPPHETAVTLRMKGGLRVLLTRRRGVLSHA* 6534 

>AP003735.2 $F genomic DNA, chromosome 1, BAC clone:B1147A04, complete 
8263 MDGTLAPLLLLLLLFLPALLLYLRRRPAAASRINNNHCPHPNPVLGNALPFLRNRHRFLDW 8445
8446 ATDLLAAAPTSTIEVRGALGLGSGVATANPAVVDHFLRASFPNYVKGARFAVPFEDLLGR 8625
8626 GLFAADGRLWALQRKLASYSFSSRSLRRFSARVLRAHLHRRLVPLLDAAAGSGEAVDLQD 8805
8806 VLGRFGFDNICNVAFGVESSTLLEGGDRRHEAFFAAFDAAVEISVARVFHPTTLVWRAMR 8985
8986 LANVGSERRMRDAIRVIDEYVMAIVASEERLRLRRGEDEREHEQHLLSRFAASMEEEGGE 9165
9166 LAAMFGSPGAKRRFLRDVVVSFVMAGKDSTSSALTWLFWLLAANPRCERRVHEEVSSSRH 9345
9346 ADPRRADAGEDGHGDGYDELRRMHYLHAAISEAMRLYPPVPIDSRVAVAADALPDGTAVR 9525
9526 AGWFADYSAYAMGRMPQLWGEDCREFRPERWLSDGGEFVAVDAARYPVFHAGPRAC 9693
9694 LGREMAYVQMKAVAAAVIRRFAVEPVQAPASMETPPACEVTTTLKMKGGLLVRIRKR 9864
     EDDAAQQKLT* 9897

>AP003442.1 $F chromosome 1 clone B1096A10 similar to 86A2
49790 MAAAAVALASAYMVWFWALSRRLSGPRMWPLVGSLPSVVLNRARVHDWIADNLRATGDAATYQTCILPLPFLARRQGLV 
50026
50027 TVTCNPRNLEHILRARFDNYPKGPMWQASFHDLLGQGIFNSDGETWLIQRKTAALEFTTR 50206
50207 TLRQAMARWANRSIKYRLWRILDDHCNAAASVDLQDLLLRLTFDNICGLTFGKDPETLSP 50386
50387 GLPENPFANAFDEATEATMQRFLFPSLLWRIKKAFGVGSERSLRDSLAVVDRHMTETIAA 50566
50567 RKATPSDDLLSRFMKKRDSKGKAFPEDVLQWIALNFVLAGRDTSSVALSWFF 50722
50723 WTLMQRRDVERKVVLEIASVLRETRGDDTARWTEEPLNFDELERLVYLKAALTETLR 50893
50894 LYPSVPQDSKYVVADDVLPDGTVVPAGSAITYSIYSVGRMESIWGKDCAEFRPERWLSAD 51073
51074 GSRFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVLLRNSVELVPGHKVEQKM 51247
51248 SLTLFMKNGLRVHVKPRDIASYVEPSEPAPPQGSLVIPTTTAAAA* 51385

>AC073556.1 $F unknown clone OSJNBa0091P11 14 unordered pieces 73% to 86E1
49583 MKSPMEEAHAMPVTSFFPVAGIHKLIAIFLVVLSWILVHKWSL
49712 RNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTVDMPFTSYTYI 49864
49865 ADPVNVEHVLKTNFTNYPK 49921
50010 GEVYRSYMDVLLGDGIFNADGEMWRKQRKTASFEFASKNLRDFSTVVFREYSLKLSSI 50183
50184 LSQACKAGRVVDMQ 50225
50317 ELFMRMTLDSICKVGFGVEIGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKK 50484
50485 FLHVGSEALLEQSMKLVDDFTYSVIRRRK 50571
50718 NGEQIKHDILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIAGRDTTATTLSWFTYMA 50897
50898 MTHPAVADKLRRELAAFEDERARELSYDAVGKLVYL 51077
51078 HACVTETLRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGPDAASF 51257
51258 RPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYTFDLV 51428
51429 EDHPVKYRMMTILSMAHGLKVRVSTSV* 51513

>AP004092.1 $F chromosome 2 clone OJ1568_B05, similar to 86C3
84356 MAIASMAAAAAAAIVGAVREHVRASDLAVAGAVL
84458 FAFSAAVSAVRARRRGAPVLWPLVGIVPTLFVHRDDIYEWGSAALLRAGGVFPYRGTWG 84634
84635 GGSSGVITSAPANVEHVLRANFGNYPKGPYYRERFVELLGGGIFNADGEAWRAQRRAATA 84814
84815 EMHSSRFVEFSVRSIEQLVYGRLVPLAERLSGGGAAVDLQEVLLRFTFDNICAVAFGVDA 84994
84995 GCLADGLPDVPFARAFELATELSLLRFVTPPFIWKAKRLLRAGSERRLVEATRAVREFAE 85174
85175 RAVADRRNEMRKVGSLRGRCDLLSRLMSSAPGADYSNEFLRDFCISFILAGRDTSSVG 85348
85349 LAWFFWLLAGHPDVESRVVGDVLAAGGDIKRMDYLHAAL 85465
85466 TEAMRLYPPVPVDFKEALADDVLPDGTPVRARQRVIYYTYAIGRDPASWGDDAAAFRPER 85645
85646 WMRGGAFAGGESPFKYAVFNAGPRLCIGKRFAYTQMKTAAAAVLSRFAVEVVPGQEVK 85819
85820 PKLTTTLYMKNGLMVRFRRRSPPPPSPPPRHVVADDDDDDDVAAGRHVAVGSCNSNHL* 85996

>AP003230.1 $P pseudogene fragment at Chelix 2 diffs with AP004139.1
65348 PFWHTVFRDLLGDGIFNSDGETWVA*RNTAALEFTT 65241

>AP003242.1 $P 38% to perf region of AP004139.1 possible pseudogene fragment 
11819 ISYSIFSTGVLQITM*QGEILLHFWPSWL*LVDGKRPFGPMDGHLLIAYN 11670

>AP004139.1 $F chromosome 2 clone OJ1486_E07 similar to 86B
55281 MEVGTWAVVVAVAAAYMTWFWRMSRGLS
55335 GPRVWPVVGSLPGLVQHAENMHEWIAANLRRAGGTYQTCIFAVPGVARRGGLVTVTCDP 55511
55512 RNLEHVLKSRFDNYPKGPFWHAVFRDLLGDGIFNSDGETWVAQRKTAALEFTTRTLRTAM 55691
55692 SRWVSRSIHHRLLPILDDAAAGKAHVDLQDLLLRLTFDNICGLAFGKDPETLAKGLPENA 55871
55872 FASAFDRATEATLNRFIFPEYLWRCKKWLGLGMETTLASSVAHVDQYLAAVIKARKLELA 56051
56052 GNGKCDTVAMHDDLLSRFMRKGSYSDESLQHVALNFILAGRDTSSVALSWFFWLV 56216
56217 STHPAVERKVVHELCAVLAASRGAHDPALWLAAPFTFEELDSLVYLKAALSETLRLYP 56390
56391 SVPEDSKHVVADDYLPDGTFVPAGSSVTYSIYSAGRMKTVWGEDCLEFRPERWLSADGSK 56570
56571 FEPHDSYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKMSLTL 56744
56745 FMKNGLRMEVRPRDLAPVADELRGADVRATAPCA* 56849 

>AL606687.1 $F chromosome 4 clone OSJNBa0084K11 similar to AP004139
94178 MEAGTWAVVVAAVAAYMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMH
      EWIAANLRRTRGTYQTCIFAVPGLARRGGLVTVTCDPR 94441
94442 NLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNSDGETWVAQRKTAALEFTTRTLRTA 94615
94616 MSRWVSRSIHSRLLPILSDAAAAGGGGGGATVDLQDLLLRLTFDNICGLAFGKDPETLAR 94795
94796 GLPENDFASAFDRATEATLNRFIFPECVWRFKKWMGLGMETTLARSVQHVDRYLSAVIKA 94975
94976 RKLELAAGNGKGDASSATPHDDLLSRFMRKGTYSDESLQHVALNFILAGRDTSSVA 95143
95144 LSWFFWLVSTHPAVERKIVRELCTVLAASRGADDPALWLAAPLNFEELDQLVYLKAALSE 95323
95324 TLRLYPSVPEDSKHVVADDVLPDGTFVPAGSSVTYSIYSAGRMKTVWGDDCLEFRPERWL 95503
95504 SADGTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVL 
      LRHRLAVAPGHRVEQKMSLTLFMKHGLRMEVRPRDLAPIVDELRGAGEYAAAARATAACA* 95815

>AL606448.1 $P two short pseudogene fragments = D15209 6 diffs with AL606687.1
135204 AFGDLLGNGIFNSDGETWVAQRKTLA 135278
135631 STSIKARKLELAAESGKGDASS 135696

>AP003767.1 $P two short pseudogene fragments only 4 diffs with AL606448.1
72817 FGDLLGNGIFNFDGETWVAQHKTTA 72891
73228 STSIKARKLELAAGSGKSDASS 73293

>AC087182.8 $F chromosome 10 clone OSJNBa0029C15, similar to 86B2
53685 MDAVMPGAAGAHNATAAAAAGRRGGGIVAGMMALPEVQTVELLVAVSIFVAIHSLRQRRSQGLPSW 53882
53883 PLVGMLPSLLLGLRGDMYEWLTGVLASRGGTFTFHGPWLTNLHCVVTSDPRNLEHMLKTK 54062
54063 FGSFPKGPYFRDTVRDLLGDGIFGADDEVWRRQRKAASLEFHSAEFRALTASSLVELVHR 54242
54243 RLLRVLGDAEEAGDAVDLQDVLLRLTFDNVCMIAFGVDPGCLRPGLPEIPFAKAFEDATE 54422
54423 ATIVRFVTPTAVWRAMRALGVGHERVLQRSLAGVDRFAYDVIRQRKEEVAAGGGGGGGGR 54602
54603 SDLLTIFTKMRDADTGAAAYSDKFLRDICVNFILAGRDTSSVALAWFFWLLNKNPAVEAK 54782
54783 ILEEIDDIVAARRSSPPAPAVAANGADEDDLVFHPEEVKKMEYLHAALSEALRLYPSVPVDHKE 54974 (0)
56977 VVEDEVFPDGTVLKKGTKVIYAMYTMGRMESIWGEDCREYKPERWLRDGRFMGESAYKF 57153
57154 TAFNGGPRLCLGKDFAYYQMKFAAASILRRYHVRVVDGHPVAPKMALTMYMKHGLKVK 57327
57328 LTKRDKSKL* 57357

>D39760  46% to 704A1 48% to 94B1 53% to 94D1 ortholog of aaaa01003917.1 $FI 1 diff
MNLFDLFFVLQLLLSGVCVLVICYRYQRLKSMKKCSLGVVQWPIVGVLPAIVANMHRLLD 
GVTFLLATSQLNFQCRFWLAGFRFFVTCDPDNVR 
KHRADDESKSRQGGGG
GGDKQSVADLLSSFLCDDEIAGSADADVYIRDMAMNLLVAGRDTTSSA
LSWFFYLLSTNPRVEQKLLQELAPIASRKPQL 
QQGGSSPATAGMVTFDAS
WITENGKLRYVPSNKFVAFNSGPRTCLGK
EMALVQMKVTAAAMAWNFAVEVVPGHVVEPRLSVILHMKNGLLVRVKRREPVMNT*

>aaaa01003917.1 (indica cultivargroup) ORTHOLOG OF D39760
8147 MNLFDLFFVLQLLLSGVCVLVICYRYQRLKSMKKCSLGVVQWPIVGVLPAIVANMHRLLDGVTFLLAT 8350
8351 SQLNFQCRFWLAGFRFFVTCDPDNVRHIFTSNFDNYPKGDVFADMFDVLGGGIFNTDGER 8530
8531 WRRQRNKAQMLMTTPRFRAFVARSSLDKVEKGLLPFLAHVADARKTCDLQDVFTRWSLDA 8710
8711 TCHLVFGVDPGCLDIGLPEVPFARAMDDVLRTIFLRHTMPVSFWKTMRWLGIGHEKRNAA 8890
8891 ARRTVESFVASAIAKHRADDESKSRQGGGGGGDKQSVADLLSSFLCDDEIAGSADADVYI 9070
9071 RDMAMNLLVAGRDTTSSALSWFFYLLSTNPRVEQKLLQELAPIASRKPQLQQGRLFPGNG 9250
9251 GMVTFDASEVRNLLYLHAALCEAMRLYPPVPLEHKAAVADDVLPSGHEVMAGDKVLVFYY 9430
9431 SMGRMKRVWGKDCREFRPERWITEDGKLRYVPSNKFVAFNSGPRTCLGKEMALVQMKVTA 9610
9611 AAMAWNFAVEVVPGHVVEPRLSVILHMKNGLLVRVKRREPVMNT* 9745

>AP003289 $F 55% to 94C1 CDS complement(91864..93438)
MGVVEAEALHGAVEALAGSLQPHVATAFFVFSACTVALAALLAV
VRLRPPWWCDCTVCEAFLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANP
VTVDHVLRARFDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRA
FAARVVASELRCRLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLEL
SMPVSTLVEAFDTASTLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEV
IRQRRKLGGAATGSDLLSRFMGSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSD
HPEVATAIRDEVARVTGDGNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAA
GDDTLPDGTVVAKGTRVTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYP
VFQAGVRVCIGKELALMEMKAVIVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGLPV
RVRRRRARASGHNPPI

>AC116949.3 chromosome 11 NO INTRONS
BI804955.1 clone S002F11.Length = 411 62% to AP003289 similar to 94C1
BI805571.1
AU056498 AU056805 64% to 94B1 from aa  79123
AU056681.1 Oryza sativa mature leaf cDNA clone S20781_1A.Length = 419
73586 MEMELPWGARCAGLAFFAFSVCLAALGVVLLVARRWPWCSCHVCRAYLTGSWAREFTNLG 73407
73406 DWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRTRFDNFPKGRPFAALLGDLLGDGI 73227
73226 FNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEVEARLMPVLADAADRGAVLD 73062
LQDVFRRFAFDXIC
KISFGLDPGCLDREMPVSELADAFDAASRLSAMRGAAASPLLWRAKRFLNVGSERELRKA
IKVVDELAAAMIRERQKLGVGSSHDLLSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDT
VSTALTTLFMLLSKNPEVAAAMRAEAEAGDGGETGAAITYEHLKGLHYTHAVLHENMRL
FPPVQFDSKFCAAADVLPDGTYVGGDARVMYHPYAMGRMPHIWGADYAAFRPARWLTGPG
ASFVPANPYKYPVFQAGQRVCLGKELAVTEMKAASVAVVRAFDVEVVGENGRSGGAAAAP
RFVPGLTASISGGLQVRVRRRVHT* 72048

>aaaa01011965.1 (indica cultivargroup) 94CLIKE ORTHOLOG OF AU056498
RUNS OFF END
526 MEMELPWGARCAGLAFFAFSVCLAALGVVLLVARRWPWCSCHVCRAYLTGSWAREFTNLG 347
346 DWYAHLLRRSPTGTVHVHVLGCTVTANPANVEHMLRTRFDNFPKGRPFAALLGDLLGDGI 167
166 FNVDGHAWRHQRK 128
127 MASLELGSVAVRSYAYKIIAQEVEARLMPVLADAADRGAVLD

>AC118132.1 chromosome 10 
AU031131 45% to 96A1 and 86A4 440512 region Cterminal 86 CLAN
137194 MDKAMAFIPPRDLVVVLPFLALLLPLYIYLRYSRSAKANPSLPTEWPLVGMLPSLVANIH 137373
137374 NLFDYATALLAASGNSFEARGPPMSSLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFD 137553
137554 VMGDSFFNADGESWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPF 137733
137734 DLQRLLTRFAFDVTAMAVFGVDTCRLSIDMPPLDVANAMDAVMEVGFFRHTVPVSCWKLM 137913
137914 RSLRIGPERKLTAAQRLLRRFVAEMIEKRRVAGGACKATDDEQGGVPPPADIVSSYINDP 138093
138094 EYVDEDGNPREFMYATFINYMVAGRDTVGTALSWLFFNLTEHPRVVARIREELEPIASSK 138273
138274 AGGGGMVVFDPEETKPLVYLQAALFESMRLYPPGPIERKATLAEDVLPSGHTVRAGDNIL 138453
138454 IPVYSMGRMASVWGKDSGEYRPERWVTEDGKLRHVPAHRFMPFNA 138588 (fs)
138590 GPRLCLGKDISVLQMKSVAAA 138652
138653 VAWNFDLEVVAGHAVEPKVSMVMQIKNALMVKVKKR* 138763

>aaaa01018092.1 (indica cultivargroup) ortholog of AU031131
2350 MDKAMAFIPPRDLVVVLPFLALLLPLYIYLRYSR
     SAKANPSLPTEWPLVGMLPSLVANIHNLFDYATALLAA 2135
2134 SGNSFEARGPPMSGLRFFVTCDPDNVRHIFINNFANYPKGEEFASFFDVMGDSFFNADGE 1955
1954 SWRRQRARVQHVMSNPRLLASMAACCRGKVEKGLLPILDRMASAGAPFDLQRLLTRFAFD 1775
1774 VTAMAVFGVDTCRLSIDMPPLDVANAMDAVMEVGFFRHTVPVSCWKLMRSLRIGPERKLT 1595
1594 AAQRLLRRFVAEMIEKRRVAGGACKATDDEQGGVPPPADIVSSYINDPEYVDEDGNPR 1421
1420 EFMYATFINYMVAGRDTVGTALSWLFFNLTEHPRVVARIREELEPIASSKA 1268
1267 GGGGMVVFDPEETKPLVYLQAALFESMRLYPPGPIERKATLADDVLPSGHTVRAGDNILI 1088
1087 PVYSMGRMASVWGKDSGEYRPERWVTEDGKLRHVPAHRFMPFNAGPRLCLGKDISVLQMK 908
 907 SVAAAVAWNFDLEVVAGHAVEPKVSIVMQIKNGLMVKVKKR* 782

>AP002484  CDS  $F join(76365..77485,77598..78009) 42% T0 96A5 new 96 subfamily
MGPLWTFILLYPEIFLAIICFFWFSLFRPIRQRQKSNLPVNWPV
FGMLPFLVQNLHYIHDKVADVLREAGCTFMVSGPWFLNMNFLITCDPATVNHCFNANF
KNYPKGSEFAEMFDILGDGLLVADSESWEYQRRMAMYIFAARTFRSFAMSTITRKTGS
VLLPYLDHMAKFGSEVELEGVFMRFSLDVTYSTVFAADLDCLSVSSPIPVFGQATKEA
EEAVLFRHVIPPSVWKLLRLLNVGTEKKLTNAKVVIDQFIYEEIAKRKAQASDGLQGD
ILSMYMKWSIHESAHKQKDERFLRDTAVGFIFAGKDLIAVTLTWFFYMMCKHPHVEAR
ILQELKGLQSSTWPGDLHVFEWDTLRSAIYLQAALLETLRLFPATPFEEKEALVDDVL
PNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEPSYKFLSFNT
GPRSCLGKELSLSNMKIIVASIIHNFKVELVEGHEVMPQSSVILHTQNGMMVRLKRRD
AA*

>AP002484 $F    CDS  80463..81980 43% to 96A1
MELLPWLLGFVVKYPEIMASAACFLLLFCRFRRRSKRIPTNWPV
VGALPAIVANAGRVHDWVTEFLRAAAMSHVVEGPWGSPGDVLITADPANVAHMFTANF
GNYPKGEEFAAMFDVLGGGIFNADGESWSFQRRKAHALLSDARFRAAVAASTSRKLGG
GLVPLLDGVAASGAAVDLQDVFMRLTFDLTAMFVFGVDPGCLAADFPTVPFAAAMDDA
EEVLFYRHVAPVPWLRLQSYLKIGHYKKMAKAREVLDASIAELIALRRERKAADANAT
GDADLLTAYLACQDEIGMDGAAFDAFLRDTTLNLMVAGRDTTSSALTWFFWLLSNHPG
VEARILAELRAHPPSPTGAELKRLVYLHAALSESLRLYPPVPFEHKAAARPDTLPSGA
AVGPTRRVIVSLYSMGRMEAVWGKGCEEFRPERWLTPAGRFRHERSCKFAAFNVGPRT
CLGRDLAFAQMKAVVAAVVPRFRVAAAAAPPRPKLSIILHMRDGLKVKVHRRQED*

>D46472, D46467 NTERMINAL 1127 REGION 38% to 96A5 40% to 96A3 ortholog of aaaa01022933.1 $FI 8 diffs
MALSLTPSLQDLVSSLMILLVLLYISYWRSKYQSLFPVDWPIVGLLPTLVANLHRLHDKITEYLAASGISFTGN
GPAASNMRLFVTCDPDNVRHIFTTNHDNYPKGHEFAEIFDIMAGGFFTMDGXL 
FETLXLYPPGWIERKTVVADDVMPSGHEVRAGDAVLISIYSM
GRMESLWGDDCRVYRPERXLYDSRGGRKMRHVPHKFLSFNSGPRMCPGKNIAVMQMKIIAAPVVWNFDLEVVEGQAV
GPKLSCLLQMKNGVMVKVKKRAV*

>aaaa01022933.1 (indica cultivargroup) 96A like ortholog of D46472
AAAA01066972.1 (100%) AAAA01040384.1 (4 diffs)
1337 MASLTPSLQDL
1370 LVSSLMILLVLLYIAYWRSKYQSLFPVDWPIVGLLPTLVANLHRLHDKITEYLAASGHS 1546
1547 FTGNGPAASNMRLFVTCDPDNVRHIFTTNHDNYPKGHEFAEIFDIMAGAFFTMDGELYRR 1726
1727 QRAKTHSILSDPRMVASMASSCADKVRDGLLPLLTSMASTRTPFELQDLATRLMFDVTAM 1906
1907 PVFGVDPGRLSPDMPSMHVSAAMDTIMEVGLFRHTVPPSCWKAMRRLKIGPERKLAAAHA 2086
2087 ALHVFVSEMMEKARKQEAAPSSMSMDVLSSYINDPDYVGLLHSIL 2221
2222 ITYMVAGRDTVGTTLPWFFYNLAMNPRVVSGIREELAHNIATSTCNGDGAPVMFSPEDTK 2401
2402 SLVYLHAALFETLRLYPPGWIERKTVVADDVMPSGHEVRAGDAVLISIYSMGRMESLWGE 2581
2582 DCRVYRPERWLYDSRGGRKMRHVPSHKFLSFNSGPRMCPGKNIAVMQMKIIAAAVVWNFD 2761
2762 LEVVEGQAVVPKLSCLLQMKNGVMVKVKKRAV* 2860

>AP000391 $F CDS complement(join(110051..110242,110615..110815,
MVTQLTYLAASAGVCLASALAIALLSIALYIIGVVASFAVLCAKEFAERAHDRP
113301 PLVGTVFRQLKNFDRMFDEHVNYATAHRTSRIVYPGHCEVFTSDPAVVEHVLK 113143
NSFSKYSKGDFLTTA
MKDLFGDGIFATDGDMWRHQRKLASYEFSTKVLRDFSSDTFRRN
AAKLAEKISCAAANRISINIQDLLMRATMDSIFKVGFGFELNTLSGSDESGIQFSKAF
DEANSLVYYRFVDIMWKLKRYLNIGSEAKLKRNIQIIDSFVMKLIHQKREQMKIAADY
KTKEDILSRFVLASEQDPGTMDDRYLRDIVLNFLIAGKDTTGNTLTWFFYLLCKNPIV
QDKVALEIREFVEWSKEDNTIESFTKRLDEGAISKMHYLQATISETLRLYPAVPVDAK
MADEDDVLPNGYRVVKGDGINYMIYAMGRMTYLWGEDAQEFRPERWLVNGVYQQESPF
KFVSFNAGPRICLGKEFAHRQMKIMAATLIHFFKFRLEDESKEPIYKTMFTLHIDNGL
HLLANPREISP

>AL606640.1 $F chromosome 4 clone OSJNBa0019K04, similar to 704A2 and AP000391
77409 MESPLSHPAMVALSLLLLVALYLARRAVLGKKRRYPPVAGTMF 77537
77538 HQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILKTNFANYGKGPMTHD 77717
77718 VLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTAAELAGILERGPAAK 77897
77898 GRERVDMQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGLVFARAFDDASEQVLFRFFDLL 78077
78078 WKVKRFLNISSEATMKQSIRTINDFVYSIIDRKIEQMSREQHEF (0)
      AKKEDILSRFLLEREKDPGCFDNKYIRDIILNFVIA 78437
78438 GRDTTAGTLSWFLYAVCKNQRVQDKIAREVRDATTGDRDVGVQDFSSFLTEDAINKMQY 78614
78615 LHAALTETLRLYPGVPL 78665 (0)
78800 DVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMKFLWGDNAEEFKPERWLDDSGMFVAES 78979
78980 PFKFTAFQ 79000 (0)
79119 AGPRICLGKEFAYRQMKIVSAVLLYFFRFEMWDDDATVGYRPMLTLKMDGPFYLRALAR* 79298

>AC074232.2a $F chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 1 51% to 
2688 MGEDGGVNSSSNSPAAAVGLVLVVAICTYLAVVATRKQKRRRRRRP
2822 PVVGTAFHQLYHVRRVHDYHTALSREHMTFRLLVPAGREQIYTCDPAVVEHI 2977
2978 LRTNFANYGK 3007
4645 GSFNHGNMSDLFGDGIFAVDGDKWKQQRKIASYDFTTRALR 4767
4943 LQGFLMRATMDSIFTIAFGQDLNTLDGSGEGRRFAAAFDDASEFTMLRYLNPFWKLSR 5116
5117 LLNVGAEAMLKERIKVVDGFVYKLIRDRSDELSNTKAHDT 5242
5337 DILTRFIQATTSDSGTVDYKYLRDIILNIVIAGKDTTAGSLAWFLYMMCKHPEVQEKICH 5516
5517 EAMEATNAGEAASIDEFSQSLTDEALNKMHYLHAALTETLRLYPAVPL 5672
5746 DNKQCFSDDVLPNGFNVSKGDIVFYIPYAMGRMESLWGKDAESFRPERWL 5925
5926 DENGVFQQESPFKFTAFQA 6096
6097 GPRICLGKDFAYRQMKIFAAVLLRFFVLKLRDEKEIISYRTMITLSVDQGLHLTAMAR* 6273

>AC074232.2b $F chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 2
28049 MGMDGDSSYSPALAAVAGAVALVAFCSYYLAVTRATGDGEARRRRRRHP
28196 PVVGTVFHQLYHVRRLHDYYTALCREHTTFRLLATPGRRNIYTCDPAVVEHI 28351
28352 LRTNFPSYGK 28381
29955 GPLNSEILNDLFGEGIFAVDGEKWKTQRKIASYDFTTRALRDFSSDVFKRNAAKLAGVV 30131
30132 SNHAASNSKCSFLQGLLTRATMDSIFTIAF 30311
30312 GQDLNTLDGSGEGRHFAKAFDDAGEYLLLRYLNPFWKLARLLNVGAEATLKERIKVVD 30485
30486 EFVYKLIRARSDELS 30530
30653 DDLLSRFIQATTSDSGTVDYKYLRDIVLNIVIAAKDSTSGSLAWFLYMACKRPEVQEKIF 30832
30833 DEVMETTNAGDCASIDEFLTSLTDQALNKMHYLHAALTETLRLYPSVPLVI 30985
31122 NGFSVSKGDGVFYMPYAMGRMEFLWGKDAEAFRPERWLDEHGVFQQESPFKFTAF 31286 
31388 AGPRICIGKDFAYRQMKIFAAVLIRSFVFKLRDKKDNVSYRTAITLAIDQDLHLTATAR* 31567

>AC074232.2c $F chromosome 10 clone OSJNBb0005J14, 5 unordered pieces gene 3
85065 MGAERGGDSCYSPAAVMATAGALALVAICSYLAVTSNKQKRRRRP
85198 PVVGTVFHQLYNVRRIHDYHTALSREHTTFRMLVPAGGDQIYTCDPAVVEHI 85353
85354 LKTNFANYGK 85383
87710 GPFNHGNAKDLFGDGIFAIDGEKWKQQRKIASYDFSTRALR 87832
      DFSCAVFKRNAAKLAGIVSNHAA
      TYGLCRTFVQGLMLRATMDSIFTIAFGTDLNTLDGSGEGSRFAAAFDDASEFTM
      LRYISPLWKLARLLNVGVEAMLKERIKVVDEFVYRLIRARSDELS
88423 DILSRFLQATTSDSVVDYKYLRDIILNIVIAGKDTTAGALAWFLYMVCKHPEVQ 88584
88585 EKICHEAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTETLRLYPSVPM 88764
88765 ENKQCFSDDVLPNGFNVSKGDIVFFIPYA 88944
88945 MGRMESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQ 
      AGPRICLGKEFAYRQMKIFAAVLLRFFVLKLRDEKEIVSYRTTLTLAI 89298
      DQGLHLTATAR* 89334

>AP004326.2a $P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence
67989 LPPVPWPLPVIGSMH*LLGSLPHH 68060 frameshift with deletion
68060 RPACAVELLSPRRARSFRRVREAEPARLVRAVAASPAWPLVNVVGGEHVAAMMTAV 68227
68228 GARP 68239 frameshift with small deletion
68238 RCPRQEEYLEELGKVAKLAAGFNLVDLFPESRLVRAAQAAHGKIHSIMDAMVQ 68396
68397 DHLKAMEERREEVADGVVDDGDGDGADRDEELLSILLRFQRDGGLGITLTNGNHQRDS 68570 (0)
68886 GILAGGSDTTTTTVMWAMSELLRCPRAMQ 68972 frameshift with deletion
69023 YMQLVIKETLRLHLPFPLLFPRLCTETCKIMGFDVPKGTIVIVNNWAISRDERCWEDAED 69202
69203 F*PERFEHDDTDYNGTYFQFLSGGFGRRMFPDFIFAQFNIEIALANLLYHFDWELPCSEN 69382
69383 RMELDMTESAGLTASRLTDLFG* 69451

>AP004326.2b $F genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence
71860 MAGIVDTAAFCT
71896 LLCLLLTLVVFKLKTATSSRHNAGVNLPPGPWALPVIGSIHCLLGSLPHHAMRELSRR 72069
72070 YGPVMLLRLGHVRTLVLSSPEAAREVMKTHDAAFATRAVTPTASILTYGARDIVFAPF 72243
72244 SKHLRELRKLCTLELLSPRRVRSFRHVRDEEAARLARSVAAAAPAVVNVSELVKI 72408
72409 MANNIIMTAIIGDTCPQRDEYLEALDKTMDLMNGFNLIDLFPGSRLARVLGARSLRATKR 72588
72589 VHQKLHQITDTIIQGHEIIKDGSVGDDTIQETVGTHNMHGHGHKCEDILDVLL 72747
72748 RFHRDGGLGITLTKEIVSAVLF 72813 (0)
73327 DLFAAGSETTSTTIIWAMSELVRTPHVMERAQSEIRQVLQGKTVVSEADIEGRLHYL 73497
73498 QLVIRETLRLHPPVPFLIPRLCSEANSKIMRYNIPQGAMVLVNISAIGRDEKIWKNANEF 73677
73678 RPERFKDDMVDFSGTDFRFIPGGAGRRMCPGLTFGLSNIEIALASLLYHFDWKLPNDASS 73857
73858 CKLDMRETHGVTARRRTELLLKATPLYT* 73944

>AP004326.2c $F genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence
77487 MAGIMDSTTASYYTTLLCG
77544 ALLLAAVVFKLKTAAAFSRHNAGVNLPPGPWALPVIGSIHCLLGSLPHHAMRELSRRY 77717
77718 GPVMLLRLGHVRTLVLSSPEAAREVMKTHDVAFANRAVTPTASIDIVFAPFG 77873
77874 KHLRELRKLCALELLSPRRVRSFRHVREEEAARLARSVAAAASASSAVNVSELVKIM 78044
78045 TNDVTMRAIIGDRCPQREEYLEALDKTMDLLAGFNLVDLFPGSPLARVLGGRSLRTTKRV 78224
78225 HEKLHQITEAIIQGHGIKDTVGDEHHECEDILDVLLRFQRDGGLGITLTKEIVSA 78389
78390 VLF 78398 (0)
78554 DLFAGGSETTSTTILWAMSELMRSPHVMEQAKYEIRQVLQGKAMVSEADIEGRLHYLQLV 78733
78734 IKETLRLHPPVPIVIPRLCSKPNSKIMGYDIPQGTSVLVNVSAIGRDEKIWKDVNEFRPE 78913
78914 RFKDDIVDFSGTDFRFIPGGSGRRMRPGLTFGVSNIEIALVTLLYHFDWKLPSETDTHEL 79093
79094 DMRETYGLTTRRRSDLLLKATPSYARLGWSTNMQIYSVKCLVYE* 79228

>AP004326.2d $P genomic DNA, chromosome 1, BAC clone:OJ1294_F06, complete sequence
81031 DFFFCGLETTTTATIWAI*EFIKNPHAVEKAQSDIRKILGGKSIVEEADIEGQLHYFQMVN 81213 
81213 QETLRLHPPVPLLLPRLWSEPCKIMGYDIP 81302 
81304  KNTAIFVNTWALGR 81345 
81344 KIKNTGLMQVSSGLKY
81393 SRMGIVDFNGLDFRFLPCGAGRRICLGLMFELSDIELTLASLLYHSSWRLPTRSYSNK 81566
81567 LDMTEANGITTHRRIDIWLEATPFVPR 81647

>AC074282.1 $P chromosome 10 clone OSJNBa0049K09 93 unordered pieces 48% TO 704A2
183681 VRCFIFIKQAQRRHLVPPEEGHRQRHAFAMDIIRARRQSASVQDRDDVLSRFVASDKHNE 183860
183861 *VLRDIVLIFLIAGCETRSSGLSWFFWLLSSQPDVMARIADVVHVVRKATGACPSEL 184031
184032 FGFDALREMHYLHAVLMESMRLYPP 184106 
184111 QACAADDTLPDGTLVHAGWSVTYNAYAMGRLAAIWGEDCLEYKPER*LGEDGVFQPASPRK 184293

>AP004028.1 $F chromosome 2 clone OJ1136_C12, same as AP004048 131962137032 97A 
91296 MAATSSAAAAAPPPCRLLGSGQAHLRLPPSAAAAAASARRRLLLRCAA
      SGGNGKGGGGDGSGSDPVLEERRRRRQAELAARIASGEFTAQGPA (2) 91018  1
90920 WIAPLAVGLAKLGPPGELAAALLTKVAGGGGPEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPK (0) 
SFLIVSDPAIAKHILRDNSKAYSK 90537 (0)  3
      GILAEILEFVMGTGLIPADGEIWRVRRRAIVPAMHQK 90339 (0)  4
      YVTAMISLFGYASDRLCQKLDKAATDGED 90171
90170 VEMESLFSRLTLDVIGKAVFNYDFDSLSYDNGIVE (0)  5
      AVYVTLREAEMRSTSPIPTWEIPIWKDISPRQKKVNEALALINKTLDELIDICK 89802 (0)  6
89715 RLVEEEDLQFHEEYMNEQDPSILHFLLASGDD 89620 (0)  7
89554 VSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSK 89438 (0)  8 
      YPNVMAKLQDE (0)  9
89160 ADTVLGDRLPTIEDVKKLKYTTRVINE (0)  10
88998 SLRLYPQPPVLIRRSIEEDMLGGYPIGR 88915 (2)  11
88254 GEDIFISVWNLHHCPKHWDGADVFNPERWPLDGPNPNETNQNFS 88117 (2)  12
86884 YLPFGGGPRKCVGDMFATFE 86819 (0)  13
86584 TVVATAMLVRRFDFQMAPGAPP 86519 (0)  14
86441 VEMTTGATIHTTEGLKMTVTRRTKPPVIPNLEMKVISDSPENMSTTTS 86298
86297 MPVSAASIASGEDQQGQVSATRI* 86226  15

>AU173808.1 cDNA clone R3811. Length = 467 ortholog of aaaa01006047.1
LIKNAKETRQEADVEKLQQRDYSSLKDASLLRFLVDMRGADVDDRQLRDDLMTMLIAGHET 185
186 TAAVLTWSVFLLAQNPSKMRKAQAEVDSVLSNETINVDQLKKLEYIRLIIVEALRLYP 359
360 QPPLLIRRALRPDKLPGGYNGAKEGYEIPAGTDIFL
QFALLESTVALALLLQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRRT*

>aaaa01006047.1 (indica cultivargroup) 75% to Arab 97B3 ortholog of AU173808.1
missing Nterm exon
2172 PKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYHWFLE (?) 2327
3740 HGSVYKLAFGPKAFVVVSDPIVARHILRENAFCYDK (?) 3847
4088 GVLAEILKPIMGKGLIPADLDTWKQRRKG (?) 4174
4470 ITPGFHALFIEAMVGVFTKCSERTIFKLEELIERGEHGEKYTIVDLEAEFSNLALDII
     GLGVFNFDFDSVTKESPVIK (?) 4703
4921 AVYGTLFEAEHRSTFYIPYGNLPLTRWIVPRQRKFHSDLKVINDCLDSLIKNAKETRQ (?) 5094
5181 EADVEKLQQRDYSSLK (?) 5228
5330 DASLLRFLVDMRGADVDDRQ (0?) 5389
5486 LRDDLMTMLIAGHETTAAVLTWSVFLLAQ (?) 5560
5678 NPSKMRKAQAEVDSVLSNETINVDQLKKLEY (?) 5770
5884 IRLIIVEALRLYPQPPLLIRRALRPDKLPG (?) 5973
6783 GYNGAKEGYEIPAGTDIFLS (0?) 6842
6942 IYNLHRSPYFWDRPDEFEPERFSVPKKDESIEGWAGFDPDRSPGAMYPNE (0?) 7091
7178 ILADFAFLPFGGGPRKCVGDQFALLES 7258
7259 TVALALLLQKFDVELRGSPDEVEMVTGATIHTKSGLWCRVRRRT* 7393

>AC025783.5a $F chromosome 10 clone OSJNBa0001O14 1 ordered pieces Length = 180630 
111679 MAAAAAAAVPCVPFLCPPPPPLVSPRLRRGHVRLRLRPPRSSGGGGGGGAGGDEPPITT
111856 SWVSPDWLTALSRSVATRLGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVY 112035
112036 RLAAGPRDLVVVSDPAVARHVLRGYGSRYEKGLVAEVSEFLFGSGFAIAEGALWT  0 
113153 VRRRSVVPSLHKRFLSVMVDRVFCKCAERLVEKLETSALSGKPVNMEARFSQMTLDVIGL 113332
113333 SLFNYNFDSLTSDSPVIDAVYTALKEAELRSTDLLPYWK  0 
113582 IDLLCKIVPRQIKAEKAVNIIRNTVEDLITKCKKIVD 113692
113693 AENEQIEGEEYVNEADPSILRFLLASREE  0 
114115 VTSVQLRDDLLSMLVAGHETTGSVLTWTIYLLSK 114216  0 
114327 DPAALRRAQAEVDRVLQGRLPRYEDLKELKYLMRCINESMRLYPHPP 114467  0 
114538 VLIRRAIVDDVLPGNYKIKAGQDIMISVYNIHRSPE 114645  0 
114955 VWDRADDFIPERFDLEGPVPNETNTEYR 115038  2 
115197 FIPFSGGPRKCVGDQFALLEAIVALAVVLQKMDIELVPDQKINMTTGATIHTTNVSVPLSMLMTASRWH* 
115406

>AC025783.5b $P chromosome 10 clone OSJNBa0001O14 1 ordered pieces Length = 180630 
124692 GVGVTSRRSSSTACGDLLGGAFSLLPLLEWGRAVSSSSATTPFPG 
124557 TCYARKGLVAEVSEFLFGSGFSTA*DALW 124471

>AP003622 $P chromosome 6 clone P0633E08 related to AC025783.5 exon 1
105535 DLLGGALSLLPLLEWFRLVVGPRGFVVVCDHAFSRHVLCE 105654 frameshift and 6 aa deletion
105656 KGLVAEVSKFLFG 105694

>AP002092b $F CDS complement(60811..62349) = AP002093 comp(104342105880) 60% to 
MVESFHGLVVVDLRTAAPLLATAVALYILIEQLSYHRKKGSMPG
PPLVVVPFLGSVTHLFRDPVGFWDLQATRASKSGAGLTADFLFGRLMVFIRDSELSRR
VFANVRADAFHLVGHPFGKKLFGDHNLIYMVGKEHKDLRRRIAPNFTPRALSTYAVIQ
QRVILSHLRRWIDRSVANGGKAEPIRVPCRDMNLETSQTVFVGPYLTVETRERFDRDY
NLFNHGFITLPIDLPGSAFRRARLAVPRLKHILEDCARQSKQRMRGGGEPECLVDYLM
QETVREIDEAAAAGLPPPPHTSDMETGNLLFDFLFAAQDASTSSLCWAVSALDSHPDV
LARVRAEVAALWSPESGEPITAEMMTEMKYTQAVAREVVRYWPPGPVVPHIAGEAFQL
TEQYTIPKGTIVFPSVYESSFQGFPDAGTFDPERFFSEARREDVVYKRNFLAFGAGPH
QCVGQRYALNHLVIFMALLASLIDFRRERTEGCDVPVYMPTIVPRDGCVVHLKQRCAK
LPSF

>AP002092a $F CDS complement(80797..82311) 61% to 71A10
MVDSLLYGLLDLRMAAPLLAAAVALYVLVEQLSYHRKKGSLPGP
PLVVPFIGSATHMIRDPTGFWEMQAARARKSGVGFTADFLAGKFTIFIRDSELSNRVF
ANVRPDAFFVIGHPFGKKLFGDHNLIYLFGDDHKDLRRRMATNFTPRALSTYAAIQQR
GIVSHLRRWLDRSAANGGKAEPIRVPCRDMNLETSQTVFAGPYLTEEARERFKSDYNL
FNVGLLAFPVDLPGLAFRRARQAVARLVRMLRDCARESKARMRAGGEPECLVDYWMQE
TVREIDEAKAAGLPPPAHISDDEEIGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVL
ARVRAEVASLWSPDSGEPITADKIAEMKYTKAVAREVVRHRPPATLMPHIALQNFQLT
ESYTIPKGTLVLPSMYESSFQGFHDPDAFDPERFFSEARREDVVYKRNFLAFGAGPHQ
CVGQRYALNHLVIFMALFVSLVDFRRERTEGCDVPVYMPTMVPRDGCVVYLKQR*

>AP003575.1 $F chromosome 6 clone P0528B02, similar to 71A24 one in frame stop codon
54816 MAAVQLDSGLLIGFLFLATCLVVAVRSYLRSGGADGGRGGAA
54690 ITSPPALPVIGNLHQLGRGRHHRALRELARRHGPLFQLRLGSVRALVVSSASMAEAVLRH 54511
54510 QDHVFCGRPQQHTARGTLYGCRDVAFSPYGERWRRLRRVAVVHLLSARRVDSFRALREEE 54331
54330 VASFVNRIRAASGGGGGVVNLTELIVGLTHAVVSRAAFGKKLGGVEPAKVRETVGEL 54160
54159 ADLLGTIAVSDMFPRLRWVDWATGLDARTKRTAAKLDEVLEMVLRDHEPSRGDDDDDDGD 53980
53979 GEARDLMDDLLSMANGGDDHGYKLDRIDVKGLLIL 53875 (0)
      DMFAAGTDTVYKSIE*TMAELIKNPAEMAKVQAEVRHVVAAAHGGEGDEDA (0) may be incorrect joint
53613 LGKMTLLRAAMKEAMRLHPPLPLLIPREAIQDTVLHGHRVAAGTRVMINAWAIGRDEAAW 53434
53433 EDAGEFRPGRFADGGDNAGVEYYGGGGDFRFMPFGAGRRGCPGMAFATRLAELVVANMAC 53254
53253 WFEWELPDGQDVQSFEPSRSSSREVCRLGSSSGKIGNHVYVVQTTRM* 53110

>AAAA01007242.1 $PI (indica cultivar-group) ortholog of AP003575.1 99%
11280 MAAVQLDSGLLIGFLFLATCLVVAVRSYLRSGGADGGRGGAAITSPPALPVIGNLHQLGR 11459
11460 GRHHRALRELARRHGPLFQLRLGSVRALVVSSASMAEAVLRHQDHVFCGRPQQHTARGTL 11639
11640 YGCRDVAFSPYGERWRRLRRVAVVHLLSARRVDSFRALREEEVASFVNRIRAASGGGGGV 11819
11820 VNLTELIVGLTHAVVSRAAFGKKLGGVEPAKVRETVGELADLLGTIAVSDMFPRLRWVDW 11999
12000 ATGLDARTKRTAAKLDEVLEMVLRDHEQSRGDDDDDDGDGEARDLMDDLLSMANGGDDHG 12179
12180 YKLDRIDVKGLLILV (0)
      DMFAAGTDTVYKSIE frameshift
      MAEL 12359
12360 IKNPAEMAKVQAEVRHVVAAAHGGEGDEDAVVIVKEEQASS frameshift
12482 LGKMTLLRAAMKEAMRLHPPLPLLIPREAIQDTVLHGHRVAAGTRVMINAWAIGRDEAAW 12661
12662 EDAGEFRPGRFADGGDNAGVEYYGGGGDFRFMPFGAGRRGCPGMAFATRLAELVVANMAC 12841
12842 WFEWELPDGQDVQSFEPSRSSSREVCRLGSSSGKIGNHVYAVETT 12976

>AAAA01004200.1 (indica cultivar-group) 
16322 MAAVQLDFGLLVGFLFLATCLAVAIRSYLRSGGAAIPSPPALPVIGNLHQLGR 16480
16481 GRHHRALRELARRHGPLFQLRLGSVRALVVSSAPMAEAVLRHQDHVFCGRPQQRTARGTL 16660
16661 YGCRDVAFSPYGERWRRLRRVAVVRLLSARRVDSFRALREEEVASFVNRIRAASGGGV 16834
16835 VNLTELIVGLTHAVVSRAAFGKKLGGVDPAKVRETIGELADLLETIAVSDMFPRLRWVDW 17014
17015 ATGLDARTKRTAAKLDEVLEMALRDHEQSRGDDDDGGGGDGEPRDLMDDLLSMANDGGGD 17194
17195 HGHKLDRIDVKGLILV (1)
      NMFIA (frameshift) 
      GTDTIYKSIEWT 17374
17375 MAELIKNPAEMAKVQAEVRHVAAAAHGDEDEDTVAVVREQQLGKMTLLRAA 17527
17528 MKEAMRLHPPVPLLIPREAIEDTVLHGHRVAAGTRVMINAWAIGRDEAAWEGAAEFRPGR 17707
17708 FAGGGDAAGVEYYGGGDFRFVPFGAGRRGCPGVAFGTRLAELAVANMACWFEWELPDGQ 17884
17885 DVESFEVVESS 17917

>AC092749.1 $F clone OSJNBb0023M11, from chromosome 10, complete sequence
71148 MVFLLVCMCSLLLMFLISYALQLFGDARRRLPPGPTPLPLIGNLLDIASDLPHRSLA 70978
70977 RLAGRHGPLMAVRLGTVVAVVASSSSTAREVLQTHNGSLTGRVPPDAWHGVGHAANSVFV 70798
70797 LPPRRKWRALRRIGAEHLLSARQLDGRRLLPLLRDAVLDLLRRVSEMSAASGGGAGAPVQ 70618
70617 VGHAAFAAMMDMQWRAMFSAGLEDDDARVLQDAAREAVALSLKPNLSDFYPALAAV 70450
70449 DLQGLRRRFAGRVGTVYHLVDEQIERRMRRRREAAGDDGEARSEDDLLDVLL 70294
70293 DMSEHGKDDGKVAIDRDLIRTFLT (0)
67984 DIFLATVDTIASTLEWAMAELLQDRETMRKLQEELKKVLGSKTHAEYADMDRLPYLRAVIKETLRLH 67784
67783 PVVPIVPNVAEEMVEIHGHVVPRGSTILVNLWAVHRDAEAWPEPNRFLPERFMLRQHGQ 67607
67606 EAAGRALGTATTEFGLIPFSAGRRVCLGLPLATRMLHAMLGSLLHRFEWTLPLEVEENGV 67427
67426 DMSENLGLTMTMATPLQAIAKSI* 67355

>AC092749.1 $P clone OSJNBb0023M11, from chromosome 10, complete sequence
64120 LMAVRLGTVVSIVASSPSTARQILQTHNGSLTGRV 64006 
64019 AWHGVGVGHAANSVFVLPPRRKWRALRRIGAEHLLSTRQLDGACMPLLR 63874
63872 SEMSAASGGAPVQVGHAAHAVFAAMVDMQWRAMFSAG 63762

>AP003434.1 $F chromosome 1, PAC clone:P0452F10, complete 41% to 71A24 = C98812
34853 MELSSSLAAVLHSPLFLLAAL
34916 LLLPVFTLLSFSSAKKPGDGGGWRLPLPPSPRGVPFLGHLPLLGSLPHRKLRSMAEAHGP 35095
35096 VMLLWFGRVPTVVASSAASAQEAMRARDAAFASRARVRMAERLIYGRDMVFAPYGEFWR 35272
35273 QARRVSVLHLLSPRRIASFRGVREQEVAALLDRVRRRCGVRGGGETVNLSDLLMSYANGV 35452
35453 ISRAAFGDGAYGLDGDEGGEKLRELFANFEALLGTATVGEFVPWLAWVDKLMGLDAKAA 35629
35630 RISAELDGLLERVIADHRERRRLSQPDGGDGDGDGDENVDHRDFVDVLLDVSEVEEGAG
      AGEVLLFDTVAIKAIIL (0) 
36458 DMIAAATDTTFTTLEWAMAELINHPPVMRKLQCEIRAAVGVPGASGGAEVTEDHLGELR 36634
36635 LLRAVVKETLRLHAPVPLLVPRETVEDTELLGYRVPARTRVIINVWAIGRDAAAWGDRAE 36814
36815 EFVPERWLDGGGEEVEYAAQLGQDFRFVPFGAGRRGCPGAGFAAPSIELALTNLLYHFDW 36994
36995 ELPPHADGAAAATAARLDMGELFGLSMRMKTTLNLVAKPWSSDV* 37129

>AP003434.1 $F chromosome 1, PAC clone:P0452F10, complete = AA754300
39698 MELSSLAALLHSPLLLAVLLLVFSWLIVSSTKKRPPPPCGDGGRRLP
39839 LPPSPPGVPLLGHLPLLGTLPHRKLRSMAEAHGPVMLLRLGRVPAVVASSAAAAEEVMRT 40018
40019 RDLAFASRPRVRMSERLFYGRDMAFAPYGEFWRQARRVTVLHLLSPRRVLSFRGVREQE 40195
40196 VAALLDRVRRRCGGGGETVNLSDLLMSYAHGVISRAAFGHGGAHGFDGDEGGEKLRKLFA 40375
40376 DFEGLLGTMTVGEFVPWLAWVDKLTGLDAKVARTSAAMDGLLERVIADHRERRRSRGQA 40552
40553 VGDGEADADHRDFVDVMLDVSEAEEGAGAGAGGVLFDTVAIKAVIL (0) 
42074 DMMAAGTDSSFTTTEWVMAELINHPRVMRKL 42169
42170 QDEIRAVVGTSSASAAAAATGGGQVTEDHLGELPFLRAVIKEMLRLHAPGPLLLPRETVE 42349
42350 DTELLGYRIPARTRVIINVWAIGRDAAAWGDSAEEFVPERWLDGGGGGGVEYAQQLGKDS 42529
42530 RFVPFGAGRRGCPGAGFAALSVELALANLLYHFDWELPPPAASGIMATTRLDMDELFGLS 42709
42710 VRLKADLNLVAKPWSPGAS* 42769

>AP003434.1 $F AU163704.1 chromosome 1, PAC clone:P0452F10, complete like 71A
48011 MAVSLVVVVVV
48044 VIAIVVPLLYLVLLPAWKPARRDDGDGGMRRRLPPSPPWGLPLLGHLHLLGALPHRALRS 48223
48224 LAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRTRDLEFASRPRVAMAERLLYGGRDVAFA 48403
48404 PYGEYWRQTRRICVVHLLSARRVLSFRRVREEEAAALVARVRAAGGAVDLVEHLTAY 48574
48575 SNTVVSRAVFGDESARGLYGDVDRGRVLRKLFDDFVELLGQEPMGELLPWLGWVDALN 48748
48749 GMEVKVQRTFEALDGILEKVIDDHRRRRREVGRQMDDGGGGDHRDFVDVLLDVNETDMD 48925
48926 AGVQLGTIEIKAIIL 48970 (0)
51142 DMFAAGTDTTTTVIEWAMAELITHPDAMRNAQDEIKAVVGITSHITEDHLDRLPYLK 51312
51313 AVLKETLRLHPPLPLLVPHEPSSDTKILGYSIPACTRIVINAWTIGRDQATWGEHAEEFI 51492
51493 PERFLESGLDYIGQDFVLVPFGAGRRGCPGVGFAVQAMEMALASLLYNFDWETRVVDRRS 51672
51673 EFGTSSLDMSEMNGLSVRLKYGLPLIAISRFP* 51771

>AP003434.1 $F chromosome 1, PAC clone:P0452F10, complete like 71A
58119 MAVSLLPAVL
58149 VLLAIVAPLLYLVLLPAVKYTTRNGAARWEDDGGDGRRRRRLPPSPRGLPLLGHLHLLGA 58328
58329 LPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRSRDMEFASRPRMAMAELLLY 58508
58509 GGRDVAFAPYGEYWRQARRICVVHLLSARRVLSFRRVREEEAAALVGRVRAAAADVVVD 58685
58686 LSDLLIAYSNTVLTRIAFGDESARGGGGGGDRGRELRKVFDDFARLLGTEPMGELLPW 58859
58860 FWWVDALRGIDGKVQRTFEALDGILERVIDDHRRRREGGRRMDDDGGGDHRDFVDVLLD 59036
59037 VNETDKDAGIQLGTVEIKAIIM 59102 (0)
59562 DMFVGGSDTTTTMMAWTMAELINHPRAMRKAQNEIWAVVGNTSHVTKDHVDK 59717
59718 LPYLKAVFKETLRLHPPLPLLIPREPPADTQILGYTIPAHTRVVINAWAIGRDAAAWGQQ 59897
59898 PDEFSPEKFLNSTIDYKGQDFELLPFGAGRRGCPGIVFGVSAMEIALASLLYHFDWEAAA 60077
60078 TDHRRRGSQAWALPVDMSEVNGIAVHLKYGLHVVAKPRMP* 60200

>AP002092 $F CDS complement(54602..56137) 60% TO 710A1
MRTSTDPSGSIESFHGLVHLRTAAPLLAAAVALYMLIEQLSYHR
KKGSMPGAPLVVPFLGSAAHLIRDPVGFWDVQAALARKSGAGLAADFLFGRFTVFIRD
SELSHRVFANVRADAFHVVSHPFGKKLFGEHNLVYLVGEEHKDLRRRIAPNFTPRALS
TYAVIQQRVIISHLRRWLDRSASNGGKAEPIRVPCRDMNLETSQTVFVGPYLTEKARE
RFDRDYNLFNVGFITLPVDLPGFAFRRARLAGARLMHTLGDCARQSRQRMLGGGEPEC
LLDYLMQETVREI
DEATAAGL 
PPPPHTSDVEVGALLFGFLFAAQDASTSSLCWAVSAL
DSHPNVLARVRAEVAALWSPESGEPITAEMMSAMKYTQAVAREVVRYHPPATLVPHIA
VEAFQLTAQYTIPKGTMVFPSVYESSFQGFQDADAFDPDRFFSEARREDVVYKRNFLA
FGAGPHQCVGQRYALNHLVIFMALFVSLVDFRRERTEGCDVPVYMPTMVPRDGCVVYL
KQR*

>AP002093 $F CDS complement(143977..145503) 65% to 710A1
MAAVVDFLDLRAAAPFVVAALAFYFLVEQLSYHRKKGPLPGPPL
VVPFVGSVAHMIRDPTGFWDAQAARARKSGAGLAADFLIGRFVVFIRDSELSHRVFAN
VRPDAFHLIGHPFGKKLFGDHNLIYMFGEDHKDLRRRIAPNFTPRALSTYAAIQQRVI
LSHLRRWLDRSAANGGKAEPIRVPCRDMNLETSQTVFAGPYLTKEAREKFERDYNFFN
VGLMALPVDLPGFAFRSARLGVARLVRTLGECARASKARMRAGGEPECLVDFWMQETV
REIDEAKAAGKPPPAHTDDEELGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVLAGV
RAEVASLWSPESGEPITAEKIAEMKYTQAVAREVVRHRPPATLVPHIAGEEFQLTEWY
TIPKGTIVFPSVYESSFQGFPEPDTFDPERFFSEARREDVVYKRNFLAFGAGPHQCVG
QRYALNHLVLFMALFVSVVDFRRDRTEGCDEPVYMPTIVPRDSCTVYLKQRCAKFPSF*

>AP003254 $F CYP711 ortholog
MEISTVLGAILAEYAVTLVAMAVGFLVVGYLYEPYWKVRHVPGP
VPLPLIGHLHLLAMHGPDVFSVLTRKYGPIFRFHMGRQPLVMVADAELCKEVGVKKFK
NFPNRSMPSPITNSPVHQKGLFFTSGSRWTTMRNMILSIYQPSHLATLIPSMESCIER
AAENLEGQEEINFSKLSLSFTTDVLGQAAFGTDFGLSKKLASSDDDEDTRKIAADTCA
EAKASSEFIKMHVHATTSLKMDMSGSLSIIVGQLLPFLHEPFRQVLKRLRWTADHEID
RVNLTLGRQLDRIVAERTAAMKRDPAALQQRKDFLSVMLTARESNKSSRELLTPDYIS
ALTYEHLLAGSATTAFTLTTALYLVAKHPEVEEKLLREIDGFGPRDRVPTAEDLQTKF
PYLDQARQTLPRRVYIVRHEFLTAHRARMQVLKEAMRYYPSSPLIARELNQQLEIGGY
PLPKGTWVWMAPGVLGKDPKNFPEPEVFRPERFDPNGEEEKRRHPYALFPFGIGPRAC
IGQKFAIQEMKLSAIHFYRHYVFRPSPSMESPPEFVYSIVSNFKNGAKLQVIKRHI

>AP003254 $F CYP711 ortholog 82% to seq on same contig
MEIISTVLGSTAEYAVTLVAMAVGLLLLGYLYEPYWKVRHVPGP
VPLPFIGHLHLLAMHGPDVFTVLARKYGPVFRFHMGRQPLVMVADAELCKEVGVKKFK
SIPNRSMPSAIANSLINQKGLCFTRGSRWTALRNMIISIYQPSHLASLIPTMQSCIEC
VSKNLDGQEDITFSDLALGFATDVIGQAAFGTDFGLSKISASSNDDDIDKIATDTSAE
AKASSEFIRMHVHATTSLKMDLSGSLSIIIGQLLPFLQEPFRQVLKRIPWTADHEIDH
VNLALGGQMDKIVAERAAAMERDQAAPHAQQRKDFLSVVLAARESNKSWRELLTPDYI
SALTYEHLLAGSATTAFTLSTVLYLVSKHPEVEEKLLREIDGFGPHDHAPTAEDLQTK
FPYLDQVVKESMRFYFLSPLIARETCEQVEIGGYALPKGTWVWLAPGVLAKDPKNFPE
PEVFRPERFDPNGEEEKRRHPYAFIPFGIGPRACIGQKFSIQEIKLSVIHLYRNYVFR
HSPSMESPLEFQYSIVCNFKYGVKLRVIKRHTA

>AP003378.1 $F chromosome 1 clone P0047E11, Like 711A two in frame stops
82666 MDISEVLGATAEWAVTLVAMAVGLLVVAYLYEPYRKVWHVPGPVPLPLIGHLHLLAMHG 82842
82843 PDVFSVLARKHGPVFR 82890 (2)
83176 FHMGRQPLIIVADAELCKEVGVKKFKSIPNRSMPSPIANSPIHKKGLFFIR 83322 (2)
83850 GPRWTSMRNMIISIYQPSHLASLIPTMESCIQRASKNLDGQKEITFSDLSLSLAT 84014
84015 DVIGLAAFGTDFGLSKLPVTPDDSNIDKIAADTSVEAKASSEFIKMHMHATTSLKMDLS 84191
84192 GSLSILVGMLLPFLQEPFRQVLKRIPGMGDYKIDRVNRALKTHMDSIVAEREAAMEHDLA 84371
84372 ASQQRKDFLSVVLTARESNKSSRELLTPDYISALTYEHLLAGSTTTAFTLSTVLYLVAKH 84551
84552 PEVEEKLLKEIDAFGPRYCVPMADDLQTKFPYLDQVCVAYIFLCVHGFVRPIFFFLT 84722
84723 TALFTWL*MQVVKESMRFYIMSPLLARETLEQVEIGGYVLPK 84848 (0)
85342 GTWVWLAPGVLAKDPKNFPEPEIFRPERFDPNGEEERRRHPYAFIPFGIGPRVCIGQKF 85518
85519 SIQEIKLSMIHLYRHYVFRHSPSMESPLEF*FAIICDFKYGVKLQAIKRHHA* 85677

>AP003765.1 $F CYP727A1 = AQ574081 = AP003832 3770142682
140359 MASPCEHHVPYTLLGALLSGGGPHAAACGGAAFLRDYAERGTNALL
       WAALLAVTWLLVLRLAALLRLWALGARLPGPPAFPADPGLAAGDIT (1) 140634
142650 GYLSKLHGSYGPVVRLWLGPSQLLVSVKDSRVIKELLTKAEDKLPLTGKTYNLACGKLGLFISSFEK (0) 142851
143011 VKSRRESLKSFLDEKLSVGTGGSSFKIIQIVLDRVDSIMARDFLDCRYFSQHMAFNIVGSAL
       FGDAFFDWSDASAYEELMMTVAKDACFWASYAVPPFWKPDYRRYRTLCARLKLLTQGIVAKS
       RNQNGVLSLIDLSSCQRSERMIKDPCRGFSLLDGVISSRCLNEAAEGPLSSEEEICGNIMGL
       MLHGISTCANLIGNILTRLALYPNLQCQ 143652 (0)
144033 LHSEIVSGHSESSELKIDDVLRMKFLLATVCESARLLPAGPLLQRCSLQQ 144182 (1)
144578 DVNLNSSITIPAGAILVIPLHLVQMEASTWGNDACQFNPNRFLKKEINFE 144721 (1)
144825 EILAAAHKGSNGINLFTDECDKTESFLPFGSGSRACVGQKFAVLGIAMLIASLLRSYE 144992 (0)
145233 VQPHPALSQEMESLVDSNSLHHIPNPKIILKKRSI* 145340

>AAAA01000381.1a (indica cultivargroup) 
not an exact match most like AP003850.1 $F chromosome 7 36% to 716A2
18280 SPTMEFSLVVALIAVASSCVFVHFLARGATKKRRSPAAKKLPPGSLGLPVIGQSLGLLRA 18101
18100 MRSNSGERWVRRRIDRYGAVSKLSLFGKPTVLVAGAAANRFVFFSGALALQQPR 17939
17938 SVQRILGDRSILDLVGADHRRVRGALSEFLRPEMLRMYVGKIDGEARRHVAGCWSG 17771
17770 RAAVTVMPLMKRLTFDIIASLLFGLGPGAAARDALAGDFERV 17645
17644 MGGMWAVPVDLPFTAFRRSLRAAARARRLLAGITRERKAALERGAATRSSDLIACLLSLT 17465
17464 DDRGGAPLLSEEEIVDTAMVALVAGHDTSSILMTFMVRHLANDPDTLAAMVQGKKLTLSH 17285
17284 ITISICPRSNPP*QVTTPWTEHEEIARSKRDGEALTWEDLTRMKLTWRVAQETLRMVPPV 17105
17104 FGNFRRALEDIELDGYVIPKGWQVFWVASVTHMDAAIFHDPDKFLPSRFDSQSSSPSTA 16928
16927 KAAPPCSYVAFGGGPRICPGIEFARIETLVMMHHLVRKFRWKLCCKEDT 16781

>AAAA01000393.1 (indica cultivargroup) 
9741 ILALCLSALFVVVLSKLVSSAVKPRLNLPPGPWTLPLIGSLHHLAMTKSPQTHRSLRALS 9562
9561 EKHGPIMQLWMGEVPAVVVSSPAVAEEVLKNQDLRFADRHLTATTEEIFFGGRDVIFGP 9385
9384 YGERWRHLRKICMQELLTAARVRSFRGVREGEVARLVRELAASAAGAGAGAVGAAAGVNL 9205
9204 NERISKLANDIVMVSSVGGRCSHRDEFMEALEVAKKQITWLSVADLFPSSKLARMVAVAP 9025
9024 RKGLASRKRMELVIRRIIQERKDQLMDDSAAGAGEAAAGKDCFLDVLLRLQKEGGTPVP 8848
8847 VTDEII 8830
4705 EKSKYHF*DMISGASETSPTVLIWTLAELMRNPRIMAKAQAEVRQAVAGKTTITEDDIVG 4526
4525 LSYLKMVIKETLRLHPPAPLLNPRKCRETSQVMGYDIPKGTSVFVNMWAICRDSRYWEDP 4346
4345 EEYKPERFENNSVDYKGNNFEFLPFGSGRRICPGINLGVANLELPLASLLYHFDWKLPNG 4166
4165 MAPKDLDMHETSGMVAAKLITLNICPITHI 4076

>AAAA01000575.1 (indica cultivargroup
31558 LLLIVPVMIHVQLKLRRRRKNAAAGTRLPPGPWRLPVIGSLHHLAMNPKAVHRALADLAR 31379
31378 RCGGGGGVMYLRLGELPVVVASSRDAAREVLRTHDAAFATRAMSVTVRDSIGDTVGILF 31202
31201 SPYGERWRRLRGICSLELLNARRVRSFRPIREEQVARLVGAIAAAAAAPGGDQPPPVNVS 31022
31021 WQIAGALTDLTLRAIMGECGFRWREEFLETLGEAQRKASRFGVADLFPSSRLLRAVGSTA 30842
30841 VRDVRALNAKLFELVDRAIEQHREAAATTAAGGDHDDGGDDDARDDNECLLNTLMRIQKE 30662
30661 GGGTLSMSTVKAVILVSSFF 30602
28763 TCIGQDMFAGGSETTSTILEWAMSELVKNPQVMQKAQAQIRLALQGRSRITEDDLINLSY 28584
28583 PKNIIKETLRLHPVAPLLGXKECQESCKILGYNIPKGSIMLVNVWAIGRDHRYWDDAEVF 28404
28403 LPERFEEITVDFGGTNYEFIPFGGGRRICPGITFAHATLEWALTALLYHFDWHLPPSVTP 28224
28223 DGLDMEEEFGMNVRRKRDLHLHPVIHV 28143

>AAAA01000843.1 (indica cultivargroup) 
21297 SLCLVAMATLALALALMVVMGAHRRGGEKGATTGAKNLPPGPWNLPVTGSLHHLLGASP 21121
21120 PPHRALLRLSRRHGPLMLVRLGEVPTVIVSGSDAAMEGWVLKAHDPAFADRARSTTVDAV 20941
20940 SFGGKGIIFAPYGEHWRQARRVCLAELLSARQVRRLESIRQEEVSRLVGSIAGSSNA 20770
20769 AAVDMTRALAALTNDVIARAVFGGKCARQEEYLRELGVLTALVAGFSMADLFPSSRV 20599
20598 VRWLSRRTERRLRRSHAQMARIVGSIIEERKEKKASDDGVGAKDEDDDLLGVLLRLQEED 20419
20418 SLTSPLTAEVIGALV 20374
17791 DIFGAATDTTASTLEWVMVELMRNPRAMEKAQQEVRNTLGHEKGKLIGTDISELHYLRMV 17612
17611 IKETLRLHPSSALIL 17567
17558 QGNCRVMGYDIPQATPVLINTFAVARDAKYWDNAEEFKPERFENSGADIRTSTAHLGFVP 17379
17378 FGAGCRQCPGALFATTTLELILANLLYHFDWALPDGVSPESLDMSEVMGITLHRSSSLHL 17199

>AAAA01000893.1 (indica cultivargroup) Nterm
33765 MSSYVVVAAALLVFVVVVVAAIKNLGKGKLPPSPPSLPFVGHLHLVGELPH 33917
33918 RSLDALHRRYGSDGGLMFLRLGRAGALVVSTAAAAADLYRGHDLAFASRPPSHSAERLFY 34097
34098 GGRNMSFAPLGDAWRRTKKLAVAHLLSPRRARPRRRGR 34211

>AAAA01000965.1a (indica cultivargroup) midK helix
693 SWKIKKWLNVGTERRLRKAIADVHAFAMDIVRARRQSASVNDRDDVLSRFVAS 535
534 DEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSRPDVAARIADEVRAVRE 376
375 ATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPI 265

>AAAA01000965.1b (indica cultivargroup) 
15170 SVSASAPAIRVDTICMVAFGHDPRCLADGGVMEDARSEYMNTFGEAQDLVVGRFFDPIEV 15349
15350 SWKIKKWLNVGTEHRLRKAIAEVHAFAMDIVRTRRQSASVQDRDDVLSRFVAS 15508
15509 DEHSDEVLRDIVLSFLIAGRETTASGLSWFFWFLSSRPDVAARIADEVRAVRE 15667
15668 ATGTRPGEPFGFDALREMNYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSV 15847
15848 TYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQ 16027
16028 MKSIVANVLEEF 16063

>AAAA01000965.1c (indica cultivargroup) 
24384 SWKIKKWLNVGTERRLRKAIADVHAFAMDIVRARRQSASVNDRDDVLSRFVAS 24226
24225 DEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSRPDVAARIADEVRAVRE 24067
24066 ATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSV 23887
23886 TYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQ 23707
23706 MKSIVANVLEEF 23671

>AAAA01000965.1d (indica cultivargroup) 
25493 NDRDDVLSRFVASDEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSRPDV 25651
25652 AARIADEVRAVREATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSCAADDT 25831
25832 LPDGTLLRAGWSVTYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAG 26011
26012 PRMCLGKEMAYVQMKSIVANVLEEF 26086

>AAAA01000965.1e (indica cultivargroup) 
32676 SWKIKKWLNVGTERRLRKAIADVHAFAMDIVRARRQSASVNDRDDVLSRFVAS 32518
32517 DEHSDEVLRDIVLSFLIAGRETTASGLSWFFWLLSSRPDVAARIADEVRAVRE 32359
32358 ATGTRPGEPFRFDALREMHYLHAALTESMRLYPPAPIDSQSCAADDTLPDGTLLRAGWSV 32179
32178 TYSAYAMGRLAAIWGEDCLEYRPERWLGDDGAFQPASPFRFTVFHAGPRMCLGKEMAYVQ 31999
31998 MKSIVANVLEEF 31963
29861 VQDMLVGGSETAATTLHWIMAELVRNPKVMQKAQDEIRRELIGHRKVTEDTLCRLNYMHM 30040
30041 VIKEALRLHPPGSLLLPRECRRTCQVLGYDIPKGATVFVNVSAIGRDPKYWDEAEEFIPE 30220
30221 RFEHSDVDFKGTHFEYTPFGAGRRMCPGMAFGLANVELTLASLLYHFNWELPSGIHAENL 30400
30401 DMTEEMRFTTRRLHDLVLIPVVHVPLP 30481

>AAAA01001026.1a (indica cultivargroup) 
3368 RRRGACGRLPPSPWALPVIGHLHHLAGALPHRAMRDIARRHGPLVLLRLGELPVVVIASS 3189
3188 ADAARNVMKTHDLAFATRPITHMMRLVFPEGSEGIIFSPYGETWRQLRKICTVELLSARR 3009
3008 VNSFRSVREEEVNRLLRAVAAAAASATSPAKMVNLSELMSAYAADSSVRAMIGRRCKDRD 2829
2828 KFLEMLERGIKLFVTPSLPDLYPSSRLAMVVSRMPRRMRRHREEVFAFLDAIIAEHQENR 2649
2648 ASGEDEEDLLDVLLRIQREGCME 2580
2572 LSTESIRTTIG 2540
1662 DLFNGGSETTATTLQWIMAELMRNPRVMQKAQDEVQRVFIGQHKVTEENLSNLSYMYLVI 1483
1482 KEALRLHPPGPPLLPRECRTTCQVLGFDVPKGTIVLVNMWAINRDPKYWDQSKEFIPERF 1303
1302 EHVDINFKGMNFEYMPFGAGRRMCPGMAFGLVNLELVLASLLYHFDWKLSDKIKVGDLDM 1123
1122 TEERGATTRRLHDLLLVPVIRVPLPLDS 1039

>AAAA01001026.1b (indica cultivargroup) 
gene b
16441 PPGPWALPVIGHLHHLAGKLPHHHKLRDLAARHGPLMLLRFGELPVVVASSAGAAREITK 16620
16621 THDLAFATRPVTRTARLTLPEGAEGIIFAPYGDGWRQLRKICTLELLSARRVQSFRAVRE 16800
16801 EEVRRLLLAVASPSPEGTTATASVVNLSRMISSCVADSSVRAIIGSGRFKDRETFLRLME 16980
16981 RGIKLFSGPSLPDLFPSSRLAMLVSRVPGRMRRQRKEMMEFMDTIIEEHQAAREASM 17151
17152 ELEKEDLVDVLLRVQRDGSLQFSLTTDNIKAAI 17250
18075 AMIGSRFKDRN*FLAMLERGIKLFVTPSLPDLYPSSRLAMVVSRMPRRMRRHREEVFAFL 18254
18255 DAIIAEHQENRASGEDEEDLLDVLLRIQREGCMESTVSTESIRTTIG 18395
19112 YLHLVIKETLRLHPPAPLLLARECREPCQILGFDVPKGAMVLINAWSIGRDPSNWHAPKK 19291
19292 FMPERFEQNNIDFKRTSFKYIPFGAGRRICPGMTFGLANIELLLASLLYHFDWELPHGMQ 19471
19472 AGDLDMTETLAVTARRKADLLVVPVVRVPI 19561

>AAAA01001026.1c (indica cultivargroup) 
20983 MAAAASSVLAYLLVVALLAIVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGAL 21162
21163 PHVAMRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPE 21342
21343 GGEGIIFAPYGDRWRELRKICTVELLSARRVQSFRPVREEEAGRLLRAVAAASSPSPAQ 21519
21520 AAVNLSALLSAYAADSAVRAIIGSRFKDRDKYLMLLERGLKLFARHTLPDLYPSSRLAMW 21699
21700 LSRMPRRMMQHRREAYAFTDAIIREHQENRAAGAGDDKEDLLDVLLRIQREGDLQF 21867
21868 PLSTERIKTTVG 21903
22319 VQDMFAGGSETAGTALQWIMAELIRNPRVMHKVQDEVRQTLAGRDRVTEDAISNLNYMHL 22498
22499 VIKEVLRLHPPVPLLLPRECRNTCQVLGFDVPKGAMVLVNAWAISRDPQYWDEPEEFIPE 22678
22679 RFEDSNIDFKGTNFEYTPFGAGRRMCPGIAFGLANVELMLASLLYHFDWQLPDGMDTADL 22858
22859 DMTEEMVVSARRLPTAP*PSVVHVPLPVASS 22951

>AAAA01001026.1d (indica cultivargroup) 
28787 AMAAFLVYVLVLVPLAVVPFVYFNRVARRRGGDVRLPPSPWGLPVIGHLHHLVGALPHVA 28966
28967 MRDLARRHGPLMLLRLGELPVVVASSAEAAREVMKTRDLDFATRPMSRMARLVFPEGGEG 29146
29147 IIFAPYGDRWRELRKICTVELLSARRVQSFRPVREEEAGRLLRAVAAASPGQAVN 29311
29312 LSELLSAHAADSSVRAIMGDRFRDRDAFLAMLERGLKLFAKPALPDLYPSSRLAMLLSRM 29491
29492 PRRMKQHHRDMVAFLDAIIQEHQENRSAAGDDDDNDLLDVLLRIQREGDLQFPLSS 29659
29660 ESIKATIG 29683

>AAAA01001626.1 (indica cultivargroup) Cterm
23249 RRRDRARQRLGEIITEVIRSRRNSSRGAAGTDENNDDMLQCLINSRYKDGCAMTDAE 23419
23420 TAGLVVALMFAGKHTSSGVSIWTGVHLLSNPNHLAAVVAEQDRLMASCPGRTDDYHRLD 23596
23597 YDTVQEMRSLHCCVKEALRLHPPVAAVSQAYKHFTVQTKEGKEYTIPGGHMVVSTILVNH 23776
23777 YLPHIYKDPHVFDPQRFAPGREEEKVAGRFSFLSFSAGRHACAGESFSYTQIKVLWSYLL 23956
23957 SNF 23965

>AAAA01001712.1 (indica cultivargroup) 
6696 AMAQDVTGYLCLFVALLVLLKVVRKASGNGAAGRLRLPPGPWRLPVIGNLHQVAMGG 6866
6867 PLVHRTMADMARRLDAPLMSLRLGEIPVVVASSADAAREITKTHDVAFATRPLSSTIRVM 7046
7047 VSDGEGLVFTPYGALWRRLRKIAMLELLSARRVQSFRRVREEEVGRLVAAVAAAAAAR 7220
7221 PGEAVNLSQLIAELISDTAARTIIGDRFEKRQELLEGLTEGIRISSGFSLGDLFPSSRL 7397
7398 ANLIGGTTRRAEANHRKNLALIECALRQHEERRAAGDEEDDEDLVDVLLRVQKEGG 7565
7566 GEVPLTMGNVKVVI 7607

>AAAA01002288.1 (indica cultivargroup) 
13548 LASLVLVLLAFVLPLLYLLLQLPGKKSGGGGGDGPRLPPSPAGCLPLLGHLHLLGPLPH 13372
13371 VALRSMAAAHGPVLRLRLGRVPTVVVSSAAAAEEVLRARDAAFSSRPRSAMAERILYG 13198
13197 RDIAFAPYGEYWRQARRVCVVHLLSAQRVSSFRRVREEEAAALADAVRAAGRGGGRA 13027
13026 FDLSGLIVAYASAVVSRAAFGDESARGMYGGADGGRAVRKAFSDFSHLFGTKPVSDYLP 12850
12849 WLGWVDTLRGRERKARRTFEALDGVLDKVIDDHRRRRDSGRRQTGDADAGHRDFVD 12682
12681 VLLDV 12667
12529 DMFVAGSDATSKPMEWAMAELVSHPRHMRRLQDEIRAVVGGGRVTEDHVDKLPYLRAAL 12353
12352 KEALRLHAPLPLLVARETVADTEIMGYHVAARTRVVINGWAIGRDTAVWGETAEEFMPER 12173
12172 FLAGGNGGGAAAADYKVQGFEMLPFGGGRRGCPGVTFGMATVE 12044
12035 VASLLYHFDWEAAAADGKGGREGTPLLDMSETSGISMGLKHGLPLVAKPRFP*P 11874

>AAAA01002645.1a (indica cultivargroup) 
949 PLMRLQLGGVPVVVASSPDAAREVTCTHDAAFASRPWPPTVRRLRPHREGVVFATYGAM 773
772 WRQLRKVCIVEMLSARRVRSFRRVREEEAASLAAAVAASLSSPPARRDAVNVSALVALAV 593
592 ADATMRVVIGDRLERREEFLESMTEAVRSFTGFSLDDLFPSSRIAAAVGGMTRRAEASHR 413
412 KGNELIESAIRQHEQVRDAMAAQGGGGAMEEDLLDTLLRIQKEGALDMPLTMDNIKAVI 236

>AAAA01002645.1b $FI (indica cultivargroup) 
2048 MEQVAYWFICACAFLALVLLVRLGAARRDVVRLPPGPWRLPVVGNLHQLMLRGPLVHRTMADLA 2239
2240 RGLDDAPLMRLQLGGVPVVVASSADAAREVTRTHDLDFASRPWPPTVRRLRPHREGVVF 2416
2417 APYGAMWRQLRKVCVVEMLSARRVRSFRRVREEEAARLVASIASSSSSSPTGHDGGAAP 2593
2594 AVNVSAPIAAAVADATMRAVIGDRFERREEFLESITEAVRSFTGFSLDDLFPSSRLAAAV 2773
2774 GGMTRRAEASIRKGHQLMDSAFRQHQQLRDAMAAQPHLDDCAMEEDLLDTLLRIQKEDNL 2953
2954 DVPLTTGNIKAVLLDIF 3133
3134 GARSDTSSHMVQWVLSELMRNPEAMHKAQTELRSTLQGKQMVSEDDFASLTYLKLVIKET 3313
3314 LRLHPMVPLLLPRECRQTCKVMGYDVPQGTTVFVNVWAINRDPRHWDEPEVFKPERFHSG 3493
3494 KIDFKGANFEYIPFGAGRRICPGMTFGHATVELMLAMLLYHFDWELPKGVAPNELDMTEE 3673
3674 MGITVGRKNALYLHPIVRVSLEQASMS* 3757

>AAAA01002713.1 (indica cultivar-group) aaaa01010047.1b ortholog to AF140486
3811 MEISQAFVFASLLLLLLLTWLLFHLLSYQAPPPNGDGGRRIPSPPALPVVGHLHLLKKPL 3632
3631 HRSLAALAARYGGGAGLLLLRFGARPVVLVSSQAATDECFTAHDAALAGRPGLASRRLL 3455
3454 TDGCPTIATAGHGARWRHLRRLATVHALCARRLAATSPARDAEARAMAARLYSSSSSSS 3278
3277 AASAVVVGVKPAAYGFVASVIMTMVAGERMAEEDVLRFKAITEAGLAAAGAANRQDFLPF 3098
3097 LRLLDFGRARRRLAGIAKERHDFGQRIVDEYRRRHRRRLAVAADDSSSSPPRRTVIGDL 2921
2920 LRQQESSPESYADEVIRTVCL 2858 (0?)
5877 SLLQAGTDTSASTIEWAMALLLNNPDVLRKATDEIDSVVGMSRLLQEPDLANLPY 6041
6042 LRCIITETLRLYPLAPHLVPHEASRDCMVAGHVIARGTMVLVDVYSMQRDPRVWEDPDKF 6221
6222 IPERFKGFKVDRSGWMMPFGMGRRKCPGEGLALRTVGMALGVMIQCFQWERLGKKKVDMS 6401
6402 EGSGLTMPMAVPLMAMCLPRVEMESVLKSL* 6494

>AL772426.1 = ortholog of AAAA01002713.1 and aaaa01010047.1b AF140486 mRNA 
99775 MEISQAFVFASLLLLLLLTWLLFHLLSYQAPPPNGDGGRRIPSPPALPVVGHLHLLKKPL 99596
99595 HRSLAALAARYGGGAGLLLLRFGARPVVLVSSQAAADECFTAHDAALAGRPGLASRRLLT 99416
99415 DGCPTIATAGHSARWRHLRRLATVHALCARRLAATS 99308 (?)
99308 PARDAEARAMAARLYSSSSSSSAASAVVVGVKPAAYGFVASVIMSMVAGERMAEEDVLRF 99129
99128 KAITEAGLAAAGAANRQDFLPFLRLLDFGRARRRLAGIAKERHDFGQRIVDEYRRRHRRR 98949
98948 LAVAADDFSSSPPRRTVIGDLLRQQESSPESYADEVIRTVCL 98823 (0?)
98238 SLLQAGTDTSASTIEWAMALLLNNPDVLRKATDEINSVVGMSRLLQEPDLANLPYLRCII 98059
98058 TETLRLYPLAPHLVPHEASRDCMVAGHVIARGTMVLVDVYSMQRDPRVWEDPDKFIPERF 97879
97878 KGFKVDGSGWMMPFGMGRRKCPGEGLALRTVGMALGVMIQCFQWERVGKKKVDMSEGSGL 97699
97698 TMPMAVPLMAMCLPRVEMESVLKSL* 97621

>AL772426.1 = ortholog of aaaa01010047.1dca hybrid 99% BE039828 similar to Jeru. artichoke CYP81B1
95445 MAGLEVATTAVTGGDASLVVVVGVLFLMVAVVVMTRLGDGGAAPSPPAMPVLGHLHLIKKPL 95260
95259 HRSLAEVAARVGAAPVVSLRLGARRALLVSTHAAAEECFTACDAAVAGRPRLLAGDVLG 95083
95082 YGHTTVVWASHGDHWRALRRLLGVELFSNARLAALAADRRAEVASLVDAVLRDAAAGGGG 94903
94902 GGTVTLRPRLFELVLNVMLRAVTARRHAGDETRRFQEIVEETFAASGSPTVGDFFPALR 94726
94725 WVDRLRGVVATLQSLQKRRDAFVAGLVDDHRRTRRAAAAAADKDQKKNGIIDALLT 94558
94557 LQETDPDHYTDNVVKGIVLVLLTAGTDTSALTTEWAMAQLVAHPEAMTKVRAEIDANVG 94381
94380 AARLVEEADMASLPYLQCVVKETLRLRPVGPVIPAHEAMEDCKVGGYHVRRGTMILVNAW 94201
94200 AIHRDGDVWGSPEEFRPERFMDDGAGAGAVTAVTAPMLPFGLGRRRCPGEGLAVRLVGLT 94021
94020 VAALVQCFDWEIGEGGAVDMAEGGGLTMPMATPLAAVCRPREFVKTVVSDCF* 93862

>aaaa01010047.1dca hybrid seq (indica cultivargroup) ortholog of BE039828
9491 MVGLEVATTAVTGGDASLVVVVGVLFLMVAVVVMTRLG
     DGGAAPSPPAMPVLGHLHLIKKPLHRSLAEVAARVG 9712
9713 AAPVVSLRLGARRALLVSTHAAAEECFTACDAAVAGRPRLLAGDVLGYGHTTVVWASHGD 9892
9893 HWRALRRLLGVELFSN
7897 ARLSALAADRRAEVASLVDAVLRDAAAGGGGGGTVTLRPRLFELVLNVMLRAVTARRHAG 7718
7717 DETRRFQEIVEETFAASGAPTVGDFFPALRWVDRLRGVVATLQSLQKRRDAFVAGLVDDH 7538
7537 RRTRRAAAAAADKDQKKNGIIDALLTLQETDPDHYTDNVVKGIVLVLLTAGTDTSALTTE 7358
7357 WAMAQLVA 
5663 HPEAMTKVRPEIDANVGAARLVEEPDMASLPYLQCVVKETLRLRPVGPVIPAHEAMEDCK 5484
5483 VGGYHVRRGTMILVNAWAIHRDGDVWGSPEEFRPERFMDDGAGAGAVTAVTAPMLPFGLG 5304
5303 RRRCPGEGLAVRLVGLTVAALVQCFDWEIGEGGAVDMAEGGGLTMPMATPLAAVCRPREF 5124
5123 VKTVVSDCF* 5094

>AL772426.1 P450 fragment
63156 PSQPVLGHLHLLKRPPLHRSX 63097
63092 AAAARAPLVSLRLGRAAGAARVDARRGAGERFTACDAAMAGRPPAARR 62949

>AL772426.1 = ortholog of AAAA01017554.1 $FI 99%
69722 MTGGLEVAMVAGGGNGGAAVLVGITVLLFVVVVVVVVLVRWWSG
69590 GEGGAAPSPPALPVLGHLHLLKKPLHRSLAAVAAGVGAPVVSLRLGARRALVVSTHA 69420
69419 AAEECFTACDAALAGRPRTLAGEILGYDHTIVLWTPHGDHWRALRRFLAVELLSAPRLAA 69240
69239 LAADRHAEAASLVDAILRDAAGGAKVTLRPRLFELVLNVMLRAATTRRRHASVDA 69075
69074 RKLQEIIEETFSVNGTPSVGDFFPALRWVDRLRGKVGSLKKLQARRDAMVTGLIDD 68907
68906 HRQWRSGSAGDGDQDKEKKGVIDALLALQETDPDHYTDNVVKGIIL 68769 (0?)
68310 SLLFAGTDTSALTIEWAMAQLVTHPETMKKARAEIDANVGTARLVEEADMANLPYIQCVI 68131
68130 KETLRLRTAGPVIPAHEAMEDTTVGGFRVARGTKVLVNAWAIHRDGDVWDAPEEFRPERF 67951
67950 VDSDAGGAVTAPMMPFGLGRRRCPGEGLAVRVVGVSVAALVQCFDWEVGDDDVVDMTE 67777
67776 GGGLTMPMATPLAAVCRPREFVKTILSTS* 67687

>AAAA01017554.1 $FI (indica cultivar-group) added 8 aa to N-term
483 MTGGLEVAMVAGGSNGGAAVLVGITVLLFVVVVVVVVLVRWWSGGEGGAAPSPPALPVLGHLHLLKKPLHR 695
696 SLAAVAAGVGAPVVSLRLGARRALVVSTHAAAEECFTACDAALAGRPRTLAGEILGYDHT 875
876 IVLWAPHGDHWRALRRFLAVELLSAPRLAALAADRHAEAASLVDAILRDAAGGAKVTLR 1052
1053 PRLFELVLNVMLRAATTRRRHASVDARKLQEIIEETFSVNGTPSVGDFFPALR 1211
1212 WVDRLRGKVGSLKKLQARRDAMVTGLIDDHRQWRSGSAGDGDQDKEKKGVIDALLA 1379
1380 LQETDPDHYTDNVVKGIIL (0) 1436
1896 SLLFAGTDTSALTIEWAMAQLVTHPETMKKARAEIDANVGTARLVEEADMANLPYIQC 2069
2070 VIKETLRLRTAGPVIPAHEAMEDTTVGGFRVARGTMVLVNAWAIHRNGDVWDAPEEFRPE 2249
2250 RFVDSDAGGAVTAPMMPFGLGRRRCPGEGLAMRVVGVSVAALVQCFDWEVGDDDVV 2417
2418 DMTEGGGLTMPMATPLAAVCRPREFVKTILSTSM* 2522

>AAAA01002827.1 (indica cultivargroup) 
12886 TTMAFFLVACLPWVCFILLSLYVFQLFADARRRLPPGPWPPKPLIGDLLALGKGDQQ 12716
12715 HRSLARLADRYGPVMSLRLGTVLTVVVSTPDAMREIFHKNKDNLAGRPTADAFNAMGHSA 12536
12535 NSLLGLEHPGVRWRAIRRFSTAELLAPRRLAALQPLCRDKVRGLVRGVSELAARGEPVHV 12356
12355 RRVALDMALSLIA 12317
8887 DLYGAGASTTSVLIEWAIADLLQNPESMRKIKEEITNVIGTNAQIQESDIARLPYLQAVV 8708
8707 KETLRLRAVAPLVPRRAEATIEVQGFTIPKGTNVILNLWAINRDARAWNDPDKFMPERF 8531
8530 IGNDINYLGQNFQFVPFGVGRRICLGLPLAQKVMYLVLGTLVHQFEWTLPEELKDTGIDM 8351
8350 TEK 8342

>AAAA01004037.1 (indica cultivargroup) 
12867 LPPGPRNLPVVGSAHRLVNTLAHRVLRDLADVHGPLMHLRVGQVPVVVVTSKELARDILK 12688
12687 THDANFATRPKLVAGGIVAYDWTDILFSPSGDYWRKLRRLCIQEILSAKRILSFEHIRE 12511
12510 DEVRMLADEIRAVGPSVAVDLSARLHRITNTIVSRAAFGNKRSNAADFLVAIKQS 12346
12345 VIMASGFYVPDLFPRFSVLLCWLTGMRRTLHGIRDTIDSILEEIISEKEEAKQ 12187
12186 QQDNNLVDVLLSLKDKGDFGFPITRDTIKAIV 12091
11880 DIFAGGSGTSANAMEWAMSELMMNPRVMNKVQAEIRDAFHGKQSIGEADLRARDLKYLKL 11701
11700 VMKETLRLHPPAPLLVPRESIDACEINGYMIPAKARVIVNAWAISRDPRYWEDAEEFKPE 11521
11520 RFAEGGIDFYGSNYEYTPFGSGRRMCPGYNYGLASMELTLAQLLHSFDWSMPDGATEV 11347
11346 DMTEAPGLGVRRKTPLLLCAAPYVASPI 11263

>AAAA01004390.1 (indica cultivargroup) 
12714 FAPSGDYWRALRRVSANHLFTPRRVAASAPRRLAIGERMLDRLSALAGGEIGM 12872
12873 RRVLHAASLDHVMDTVFGTRYDGDSQEGAELEAMVKEGYDLLGMFNWGDHLPLLKWL 13043
13044 DLQGVRRRCRTLVQRVDVFVRSIIDEHRQRKRRTGGNGGGEELPGDFVDVLLGLQGEEKM 13223
13224 TESDMVAVLWVTKDPSDEMIFRGTDTVAILLEWI 13403
13404 MARMVLHPDIQAKAQAELDAVVGRERAVSDGDVAGLRYLQCVVKEALRVHPPGPLL 13571
13622 VPAGTTAMVNMWAIAHDPELWPEPDEFRPERFAEEDVSVLGGDLRLAPFGAGRRACPGKT 13801
13802 LALATVHLWLAQLLHRFEW 13858

>AAAA01005635.1 (indica cultivargroup) 
8769 YLVVLGTLALALAFKRVLRGKETGVKLPPGPWNLPIIGSLHHLVGAHLPHRALLRVSR 8596
8595 RQGPLMLLRLGEVPAVVVSSPEAAMEFLRTRDPVFASRPRGALRSTSSASAVK 8437
8436 GSSWRHTASTGGRCARSAWWSCSAQGRCSGWSLSGRRRGGVPPRRGHRHDIA 8281
8280 CYSQHRHDPDASGAQ*RHHREGGVRRQVPTAGLRYLRVLKVVATLAGSFN 8131
8130 MVDLFPSSRLVRWLSCVERRLREHHAQTVRIVDSIIQDRKENEASASPGASAEDDDNDDL 7951
7950 LDVLLRLQREDNLTFPITAEIIGALISVSGNLF 7852
7202 DIFGAATDTTGSTLEWAMAELMRNPRTMEKAKQEVQNALGQGRAMVTGADIGDLHYLQMV 7023
7022 IKETLR 7005
7006 VRLHPSIPLIVRASEESTLVMGYDIPQGTNIFINAFAVARDPRYWKDADEFMPERFEKN 6830
6829 GDDIKATTVHMGFIPFGAGR 6770
6669 NLLYHFDWTLINGESPESLDMGEVWGISIHRRSDLRLHAALSVSS 6535

>AAAA01005655.1 (indica cultivargroup) 
12117 ASTILWLLYVSLASCLLYKVFVSTKNGHPKIAARRPPGPTPVLLLGNVFDLRGELHL 11947
11946 ALARLAEEHGPVMSLKLGTATAVVASSAAAARDALQRYDHVLAARAVCDAARALGTH 11776
11775 ERSIVWLPGSSALWKRLRAVCTNHLFSARGLDATRAVREAKVRELVEHLRGHAAGAGEEE 11596
11595 AAAVDVGRVVFSAVINLVSNVLFSEDVADLSSDRAQELEMLVRDTVEEATKPNLSDLFP 11419
11418 VLAALDLQGRRRRTAVHIRKFHDFFDEIISRRQNAGGEGERKEDFLDVLLQLH 11260
11259 SADQLSLDTIKTFLG 11215
10259 DLFTAGTDTNSITVEWAMAELLRHPAAMSRARAELRDALGAKPHPDESDIGRLPYLSAVV 10080
10079 METMRLHPPSPLLMPHEAVADGAAVGGYAVPRGTKVIVNVWSIMRDPASWPRPEEFEPER 9900
9899  FVAAGGSFRGGEMLEFMPFGAGRRACPGTPMATRVVTLVLASLLHAFEWRLPGGMRPCDV 9720
9719 DVRGRFGTSLNMVTPLKAVPVPVP 9648

>AAAA01005737.1 (indica cultivargroup) 
14167 LLSLALSMLLAILLSKLVSISKKPRLNLPPGPWTLPVIGSIHHLASNPNTHRALRALSQK 13988
13987 HGPLMQLWLGEVPAVVASTPEAAREILRNQDLRFADRHVTSTVATVSFDASDIFFSPY 13814
13813 GERWRQLRKLCTQELLTATRVRSFSRVREDEVARLVRELAGGGGAAVDLTERLG 13652
13651 RLVNDVVMRCSVGGRCRYRDEFLGALHEAKNQLTWLTVADLFPSSRLARMLGAAPRRGLA 13472
13471 SRKRIERIIADIVREHEGYMGSGGGGGDEAAAAAAGKDCFLSVLLGLQKEGGTPIPITNEII 13286
      DMFSGGSETSATVMIWIMAELIRWPRVMTKVQAEVRQALQGKVTVTEDDIV 10522
10521 RLNYLKMVIKETLRLHCPGPLLVPHRCRETCKVMGYDVLKGTCVFVNVWALGRDPKYWED 10342
10341 PEEFKPERFENSDMDYKGNTFEYLPFGSGRRICPGINLGIANIELPLASLLYHFDWKLPD 10162
10161 EMASKDLDMQEAPGMVAAKLTSLCVCPITRV 10069

>AAAA01006105.1a (indica cultivargroup) 
ALLLSVLAVALLQIIEAFLIIIRAKPAAPPLPPGPWRLPVIGSMHHLAGKLPHRALRD 3196
LAAAHGPLMMLRLGETPLVVASSREMAREVLRTHDANFATRPRLLAGEVVLYGGADILF 3019
SPSGEYWRRLRQLCAAEVLGPKRVLSFRHIREQEV 2914
VDLTAMFSFLVISNVSRASFGSKHRNAKKFLSAVKTGVTLASGFKIPDLFPTWRKVLAAV 1750
TGMRRALEDIHRVVDSTLEEVIEERRSAREDKARCGMVGTEENLVDVLIGLHEQGGC 1579
LSRNSIKSVIFDMFTAGTGTLSSTLGWGMSELMRSPMVMSKLQGEIREVFYGKATVGEED 1399
IQASRLTYLGLFIKETLRLHPPVPLLVPRESIDTCEIKGYMIPARSRIIVNAWAIGRDPR 1219
YWDDAEEFKPERFEKNIVDFTGSCYEYLPFGAGRRMCPGVAYGIPILEMALVQLLYHFDW 1039
SLPKGVVDVDMEESSGLGARRKTPLLL 958

>AAAA01006105.1b (indica cultivargroup) 
6882 ALLLSALAVAVLQIVKLAVVNRGKKQAAAAAPTPPGPWRLPVIGSMHHLAGKLAHRALRD 6703
6702 LAAVHGPLMMLQLGETPLVVVSSREVAREVLRTHDANFATRPRLLAGEVVLYGGADILF 6526
6525 SPSGEYWRKLRQLCAAEVLGPKRVLSFRHIREQEV 6421
5914 VDVSALFYDMAISIVSCASFGKKQRNADEYLSAIKTGISLASGFKIPDLFPTWRTVLAAV 5735
5734 TGMRRALENVHRIVDSTLEEVIEERRGAARECKGRLDMEDNEENLVDVLIKLHEQGG 5564
5563 HLSRNSIKSVIFDMFTAGTGTLASSLNWGMSELMRNPRVMTKLQGEIREAFHGKATV 5393
5392 GEGDIQVSNLSYLRLFIKETLRLHPPVPLLVPRESIDMCEVNGYTIPARSRIVVNAWAIG 5213
5212 RDPKYWDDPEEFKPERFEGNKVDFAGTSYEYLPFGAGRRICPGITYALPVLEIALVQLIY 5033
5032 HFNWSLPKGVTEVDMEEEPGLGARRMTPLLL 4940

 >AAAA01006105.1c (indica cultivargroup) 
12594 VDVSALFYDITISIASCASFGKKHRNVDEYLSSIKTRVSLASRFKIPDLFPSWRTMLAMV 12415
12414 TGMRRALEEVHGIVDSTLEDVIEERQGEKEDKTRPDMVDTKENLVDVLIGLHENGA 12247
12246 HLSRDSIKAVIFDMFTAGTGTLASALNWGMSKLMRNPRVMTKLQGEIRKAFHGKVTVG 12073
12072 EDDIQAANLPYIRLFIEETLLLHPVVPLLVPRESIDVCEVNGYTILARSRIVVNAWAIGR 11893
11892 DPKYWDNPEEFKPEWFEGNIVDFPGSSYEYLPFGAG*RMCPGIAYGLPVLEMALVQLLYH 11713
11712 FD*SLPNGVMKVDMEEEPGLGARRKTPLLL 11623

>AAAA01006398.1a (indica cultivargroup) 
1848 ATMVVVVVVVAIAIVVPLLYLVLLPPARRGGGDSARRRLPPSPRGLPLLGHLHLLGALP 2024
2025 HRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLY 2198
2199 GGRDVAFAPYGEYWR 2243

>AAAA01006398.1b (indica cultivargroup) 
4599 AIVAPLLYLVLLPAVKYTTSNGAARWEDDDGGDGRRRRRLPPSPRGLPLLGHLHLLGAL 4775
4776 PHRALRSLAAAHGPVLLLRLGRVPAVVVSSAAAAEEVMRARDVAFASRPRVAMAERLLYG 4955
4956 GRDVAFAPYGEYWRHARRICVVHLLSARRVLSFRRVREEEAAALVARVRAAARAPGAR 5129
5130 GAVDLVEHLTAYSNTVVSRAVFGDESARGLYGDVDRGRALRKLFDDFVELLGQEPMGELL 5309
5310 PWLGWVDAVRGLDGKVQRTFEALDSIIEKVIDDHRRRRRRHEVGRQMDSDDDGG 5471
5472 GGGDHRDFVDVLLDVNETDKDAGIRLGTIEIKAI
     DMFAAGTDTTTTAMEWAMAELITHRDAMHKVQDEIRAVVGVTG 5831
5832 CVTEDHIDRLPYLKAVLKETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIG 6011
6012 RDPVTWGEHAEKFIPERFLNNNVDYKGQDFGLVPFGAGRRGCPGMGFAVPTIEMALASLL 6191
6192 YNFSWETRPVDRRCKSGTSSLDMSEVNGISVHLKYGLPLM 6311

>AAAA01006398.1c (indica cultivargroup) 
9743  AVSLLVVLLVVLAIVVPLLYLVLLPAGNTTRNGAARWEDDGGDGRRRRRLPPSPRGLPL 9919
9920  LGHLHLLGALPHRALRSLAAAHGPVLLLRLGRVPVVVVSSAAAAEEVMRSRDVEFASRP 10096
10097 RMAMAELLLYGGRDVAFAPYGEYWRQAPRICVVHLLSARRILSFRRVREEEAAALVGRV 10273
10274 RAAAADVVDLSDLLIAYSNTVLTRIAFGDESARGGGGGDRGRELRKVFDDFARL 10435
10436 LGTEPMGELLPWFWWVDALRGIDGKVQRTFEALDGILERVIDDHRRRREGGRLMDDDGGG 10615
10616 DHRDFVDVLLDVNETDKDAGIQLGTVEIKAII 10711
11174 DMFVGGSDTTTTMIAWTMAELINHPRAMHKAQNEIRAVVGNTSHVTKDHVDKLPYLKAVF 11353
11354 KETLRLHPPLPLLIPREPLADAQILGYTIPAHTRVVINAWAIGRDPAAWGQQPDEFSPEK 11533
11534 FLNGAIDYKGQDFELLPFGAGRRGCPGIVFGVSAMEIALASLLYHFDWE 11680

>AAAA01006398.1d (indica cultivargroup) 
12924 DMFAAGTDTTTTAMEWAMAELITHRDAMHKVQDEIRAVVGVTGCVTEDHIDRLPYLKAVL 13103
13104 KETLRLHPPNPLLVPHVPLADTEILGYTVPTHTRVLINAWTIGRDPATWGEHAEKFIPER 13283
13284 FLNNNVDYKGQDFGLVPFGAGRRGCPGMGFAVPTIEMALASLLYNFSWETRPVDRRCKSG 13463
13464 TSSLDMSEMNGISVRLKYGLPLIAKSHFP 13550

>AAAA01006859.1a (indica cultivargroup) 
57  PPRLRWRSDDAVRSGDQMMPFGVGRRICPGLGLALLQLEYFVANMVREFEWGMVDGDCGG 236
237 GINLAERPEFTVIMEQPLRALVVP 308

>AAAA01006859.1b (indica cultivargroup) 
11419 AAEMEVILLPLVVIITSTMLLLLIISTAKNRHHGTANLPLPPAPPSVPVVGPLLWLVRAR 11598
11599 SNLEPAIRELHRRHGPILSLTFLSPRAAIFVSSREVTHRALVQRGHTFASRPPAIAPFAV 11778
11779 LTSGQCTVSSAPYGPLWRSLRRNLTSGVLGHGSRAPLYAPARRWALHLLTSDLAAASGNT 11958
11959 GGGVAVAVVDCLQFAMFSLLTYMCFGKRLDRRGVREIEAVQRELFSSYISFQVFAFCP 12132
12133 TVTKRLFFRRWQKVLSIRRRQEDIFLPLIEERRKRIKISSMDNDGSMVCCYVDTIISHK 12309
12310 LPKEAGDRRLTDGELVSLCTEFLTASVDTIVTALQWIMARVVEQPEIQAKLLDEINRV 12483
12484 VSSDKEHVDEEDIKSMAYLKALVLEGLRRHPPAHFLLSHAAVEETSLDGHRIPAGRSVNF 12663
12664 SVADVAHDENVWSRPEEFLPERFLDGGEGAGTDLTGSREIKMMPFGVGRRICPGLGLALL 12843
12844 QLEYFVANMVREFEWGMVDGDCGGGINLAERPEFTVIMEQPLRALVVP 12987

>AAAA01007044.1 (indica cultivargroup) 
6146 DMFAGGSETTSTTLEWALK*CRRHKR 6223
6196 PEVMQKAQAEIRHALQGKSRVTEDDLINLKYPKNIIKETMRLHPLASLLVPRKCQESCKI 6375
6376 LGYDIPKGTILIMNVWTIGRDHRYWDDAEVFIPERFEDTTIDFKGTHFEFIPFGAGRRMC 6555
6556 LGMTFAHATIELALTALLYHFDWHLPHGVTHDGMDMEEQFSVTVSRKRDLYLHPIQHV 6729

>AAAA01007897.1 (indica cultivargroup) 
9748 MPAMAASLAWLLLALLLASLYTATHRIAAARRRLPPGPTPLPLVGNLLSVSRTSP 9584
9583 HRSLARLAARYGPLMRVRLGVVDYVVVSSPAVADDIYHSRHNAHLSSRPPYDAWWGEKHR 9404
9403 LNSVIALPPHAVWRAQRRLAMEEVMSPGRLDALAPLRREKVRELLVRVRRVAAA 9242
9241 RGDGDGELVPVEVGQAAFEGFLSILSSTMVSVDLADSDLRDVVREAAILAATPNVSDIF 9065
9064 PAIAAADLQGYRRRMGELVARGYGIFEELLARRKGGREAGERRKDDLLDVVL 8909
8908 DREDELK 8888
7478 DLMVAGTDTSSSTIEWAMAELLQNSESMQKVKDELRRVIGTRTQIEESDISHLPYLQAII 7299
7298 KETLRLHSNVPMSYYMAEATVEVQGYTIPKGTNIIVNIWAIHHQPNVWVDPDKFMPERF 7122
7121 IGKDTNFFGKHPELIPFGGGRRICLGLPLAYRMVHVVLASLLFHFDWKLPEGAKKDGIDM 6942
6941 SEK 6933

>AAAA01008113.1 (indica cultivargroup) 
6984 TTISPVFLISLLGVPLLYLLWSKASKSPSGAPAAPPPPPGPTPFPVIGNIPDLLRGGEL 7160
7161 HRALTGLAASYGPVMSLRFGMASTVVLSSPDVAHEALHKKDGAISSRWVPDNANVLGHQD 7340
7341 VSMAWLPSSSPLWKHMRTLASTLLFTSRRLGASRGIRERKARELVDYLGARSGRPVRVGL 7520
7521 AVFGSVLNFMSNVFFSEDVVELGSETGQEFQQLIADSVAETAKPNISDFFPFLSA 7685
7686 LDLSRRRRAAAKNLKKFYDFFDDVIDRRLSSGEKPGDLLDSLLELHAKSQL 7838
7839 ERPL 7850
8303 DLFIAGSHTTTTTVEWALAELLRNPSKMAKARAELGEAFGRGAIEEGELARLPYLNAVI 8479
8480 KETLRLHPPAPLLLPHRVSSDSEPAGGVTLGGYSVPSGARVLINAWAIGRDPAAWSPEPD 8659
8660 AFSPERFLGREADYWGRTLEFIPFGSGRRACPGIPLAVAVVPMVVAAMVHSLEWRLPEGM 8839
8840 APGDVDVGDRFGAVLELATPLWAVPV 8917

>AAAA01008333.1a (indica cultivar-group) 
6911 AMVQDATGYLSLFLALLSITLVLHKVARKASGDGAGKPRLPPGPWRLPVIGNLHQIAMGG 6732
6731 PLVHRTMADLARRHDAPLMSLRLGEVPVVVASSADAAREITKTHDVAFATRPWSSTVRVL 6552
6551 MSDGVGLVFAPYGALWRQLRKIAMVELLSARRVQSFRGIREDEVGRLVAAVAAASAAQ 6378
6377 PGEAVNVSERIAVLIADSVVRALMGDRFDRRDEFLDQLAERVKITSGFSLGDLFPSSRL 6201
6200 ASFIGGTTRRAEANHRKNFELIECALRQHEERRAARAGAAAAGAVDDDEDLVDVLLRIQK 6021
6020 EGKLEVPLTMGNINAVI 5970
5378 DLFGAGSETSANTLQWVMSELILNPRVMLKLQAELRGILQGKQRVTEDDLVELKYLKLVI 5199
5198 KETLRLHPVVPLLLARECQDTCKIMGYDIPVGTIVFVNVWVICRESKYWKDAETFRPERF 5019
5018 ENVCVDFKGTHFEYIPFGAGRRMCP 4944
4945 PGVAFAEASMELVLASLLYHFDWKLPNDILPTKLDMTEEMGLSIRRKNDLYLIPTICVP- 4769
4768 PLAA 4757

>AAAA01008333.1b (indica cultivar-group) 
11117 EMFGAGSETSANTLQWLMSELILNPRVMSKAQVELSDTLRGKQTVTEDDLAGLKYLKLII 10938
10937 KENLRLHPVVPLLLPRECQKTCKVMMYDVPVGTTVLVNVWSINRDPKYWEDPETFKPERF 10758
10757 EDGHIDFKGTDFEFIPFGAGRRMCPGITFAEAIMELALASLLYHFDWKLLGNGISSTKLD 10578
10577 MTEELGATVRRKNDLYLVPTIRVPLPADS 10491

>AAAA01008340.1 (indica cultivar-group) 81-84% to aaaa01007189 (partialI)
11247 MFFPSTANMREQNN
11205 TIIVSIAMTILLLVAFFCRIKKQAAMAAKNKRKKQPKLPPGPATMPVLGNMHQMLMNKPVFRWI 11014
11013 HRLLDEMDIEILCLRLGRVHVITVASPEMAREVLRKNDALMTSRPASFAWRAFSFGYKN 10837
10836 TIGSTGDQWKKMRRALASEILSPAME 10759
10649 IIMERMHEGRALRRNGDERREVADFLDVLVSLEEAQGNPLLSLDEVKAETL (0?) 10497
7815 EIFIATVDNPSNAVEWALAEMVNNPNVMKKAVDELDVVVGKERLVEESDIQNLTYLKAC 7639
7638 IREAFRIHPYHPFNPPHVAISDTIIAGYLIPKDSHVMLSRIGLGRNPRVWVNPLEFRPER 7459
7458 HLNNATSTMVLAEPELRFVSFGASRRGCPAVSLGTSITMMLFARLLQGFTWSIPPGADKI 7279
7278 ELQESASSLQLSKPLLMQAKPRLLLHLYELDRL* 7177

>AAAA01011192.1 (indica cultivar-group) 
7545 KLMRWLNVGVERRLADAKAVLDEFVYREIANRRSRPAPAVAGGDDLLCMY 7694
7695 MASPIDPAMSDQTLRDAAVGFMFAAKDLIAAALTWLFYMICTHPHVEAKILDELRSLHT 7871
7872 TTTAGAVVFDADELRAATYLHAAVLETLRLYPSAPFEEKEAVGDDVLPGGTAVRKGTRVV 8051
8052 FCLYAMGRVEGIWGSDCREFRPERWLSTGDGDGGAGKVLQEPSYKFAAFNAGPRSCLGKD 8231
8232 LGLSNIKIAAAAIVYNFTVELVAG 8303

>AAAA01011521.1a (indica cultivar-group) 
1413 LAVVSLFVVLLAWRSRSPAAHGVGDGGLRLPPGPWTLPVIGSLHHLAGQLPHRAMRDLAR 1592
1593 RHGPLMLLRIGEVPTLVVSSRDAAREVMKTHDMAFATRPLSATLRVITCDGRDLVFAPY 1769
1770 GDYWRQVRKIAVTELLTVRRVSSFRSIREEEVAAVLRAVAAAAAVEEATPAMATVEMRAA 1949
1950 LSALVTDITARTAFGNRCKDREEYLVLLERIVEIAGGFNPADLWPSSRLAGRLKRCRAPR 2129
2130 RGVPQLGVILDGIIQEERTGAGSEDLVDVLLRIQKEGELQFPLAMDD 2270
2271 IKSIDIFNAGIETSGTTLQWAMAELIRNPTVM 2450
2451 HKATAEVRHAFAAAGDVSEDALGELRYLQL 2540
2536 NFDWEVPGMADLTKLDMTEAFGITARRKENLHLRPLLRVSVPAASS 2673

>AAAA01011521.1b (indica cultivar-group) 
6179 GDGGLRLPPGPWTLPIIGSLHHLVGKLPHHAMRDLARRHGPVMLLRIGQVPTLVVSSRDA 6358
6359 AREMMKTHDMAFATRPLSATLHVITCDGRDLVFAPYGDYWRQLRKIAVTELLTARRVNS 6535
6536 YRAIREEEVAAMLRAVAAAAEGSGAAAGTVEMRAALTALSTDITARAVFGNRCKDREEYL 6715
6716 AQVDHTIELTAGFNPADLWPSSRLAGRLSGIVRRAEECRDTAFKILDRIIQERLE 6880
6881 MARSDGAAGEYLIDVLLRIQKEGGLQFPLAMDDIKANI 6994
7066 DIFGAGSETSGTALAWAMAELIRNPTVMRKATAEVRRAFAAAGAVSEDGLGELPYLHLVI 7245
7246 RETFRLHPPLPLLLPRECREPCRLLGYDVPRGTQVLVNAWALGRDERYWPGGSPEEFRPE 7425
7426 RFEDGEATAAVNFRGADFEFLPFGGGRRMCPGIAFALATVELPLASLLFHFDWEVPGMAD 7605
7606 PTKLDMTEAFGITARRKADLHLRPLLRVSVP 7698

>AAAA01011645.1 $FI (indica cultivar-group) continues on AAAA01039014.1
1329 MEARELWVLAAALAVSLLYYLTVLMRYAGGGSSRSSRPRLPPGPTPLPLIGNLLSLR 1159
1158 GVLHHRLASLARVHGPVMALRLGLTTAVVVSSRDAAAEAFTKHDRRLAARVVPDSNRA 985
984  HGFSDRSVIWLPSSDPRWKTLRGIQATHLFSPRGLAAVRAVRESKVRDIVAYFRSRAGEE 805
804  VVFGEAIYSGVLNLVSSSFFSVNMAGVGSEEAHGLRELVEDLVEAVAKPNVSDLFPFLR 628
627  QLDLQGLRRRTEERMARAFGILDGIIDRRLANRTHGDRHGDFLDALLDLVSEG 469
468  KMARDHVTIMLFEVFGAGSDTMSISLEWAMAELLRNPRAMRKARAELEDAAAV 310
309  VEESDAARLPYLQAVVKEAMRLHPVGPILLPHRAVEDGVEIGGYAVPRGAMVI 151 (fs)
149 FNAWAIMRDPAAWERPDEFVPERFMETTTAIDFRGKEYEYLPFGSGR 3
RLCPGLPLAERVVPFVLASLLRAFEWRLPDGVSAEDLDVSERFNTANVLAVPLKVVPVIVN*

>AAAA01011852.1 (indica cultivar-group) 
8017 VVLTGLLPVIVSLVLLARKGRL-KMPPGPEQVPLLGNLHQLAGPQPHRALRDLARVHGPV 7841
7840 MRLRLGKASAVVLTSAEAAWEALRGHDLDCCTRPVSAGTRRVTYGMKNVAFAPYGAYWR 7664
7663 EVRKLLMVELLSARRVKAAWYARHEQV 7583
6330 VQSTFVAGIDTNAATILWAMSELARKPRVLKKVQAEIRAAVGVNGRVQPDDITKLSYLRK 6151
6150 VVKETLRLHPPTPLLLPRETMRHIQISGYDVPAKTRIYVNAWAIGRDPASWPDEPEEFNP 5971
5970 ERFEANEIDFKGEHPELMPFGTGRRICPGMAMAMANVEFTLANLLFAFQWSLPEGTTPDN 5791
5790 VCMEEEGRLVCHRKTPLVLVPTVY 5719

>AAAA01012419.1 (indica cultivar-group) 
2867 ATFFAVMLATVVFVFLLQAVLLRRRGAYKLPPGPKPWPIIGNLNLIGALPHRSIHEISK 3043
3044 RHGPIVQLWFGSCPVVVGSSVEMAKLFLKTNDAVFADRPRTAAGKYTAYDCADIVWSPY 3220
3221 CAYWRQARKMCIAELFSARRLESLEHIRHEEVRALLRDLNSAGVAGNAVQLGDHLS 3388
3389 MVTLGVISRMVLGKKYVEKQPAGAETASSPPTTPEEFKWMMDELFLMSGVLNIGDFIP 3562
3563 WLDWLDLQGYVRRMKKVNRLMHRFLDRVLDEHDERRRLQGDGFVARDMVDVLL 3721
3722 QLADDPNLDVQLTRNGVK 3775
5138 VEWAMSEVLKNPAILAKATKELDNVVGSGRLVTESDIPHLPYVDAIMKETMRMHPVAPLL 5317
5318 IP 5323
5323 RMSREDATVAGYDVPAGTRVLVNTWTINRDPSLWDSPEEFRPERFVGSGIDVKGRDFELL 5502
5503 PFGTGRRMCPGYSLGLKVIQLTLANLLHAFSWNLPDGIAAGELSMEEIFGLTMPRKIPLL 5682
5683 AV 5688

>AAAA01012551.1 (indica cultivar-group) 
5816 FMGSGIDVKGWDFELLPFGSGRQMCPGYSLGLKVIQLTLANLLHAFSWSLPDGVAAGELS 5995
5996 MEEIFGLTTPRKIPLLPIVKTRLP 6067

>AAAA01012992.1 (indica cultivar-group) 
169 IQDIFGAGSDTSSNIIQWAMSELMRNPKVMQKAQVELRNTLQGKHPVKEDDLVNIKYLKL 348
349 IIKETLRLHPMVPLLLPRECLHACKVMGYDVPKGTTVFVNIWAINRDPKHWDDPEVFKPE 528
529 RFDDGKIDFKGANFEYIPFGAGRRSCPGVTFGHATVELMLATLLYHFKWELLEGVAPNEL 708
709 DMT 717

>AAAA01014014.1 (indica cultivar-group) e
2841 LLVRHIIPLSLWKLARRLGVGFERKMAEALRTINQFIYETIVKRRAKKATE 2689
2688 GIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDTIGSALSWFFYLLTKNP 2527
2526 HVASKILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVA 2347
2346 ADVMPSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISDHGKLRYVPSYKFTPF 2167
2166 ITGPRTCLGKDMALVQLKVVAATVVKNFEAEAVPG 2062

>AAAA01014217.1 (indica cultivar-group) 
4524 LTAASASTLLYAALAAAAFLYITIVRHRRGGDLPPGPAGLPLIGCLPFLEPNL 4366
4365 HAYFARLAEKHGPVFSIRIGSKLEVVVTSPEVAREVLRDQDHVFANRVIPEAGRAIAFGE 4186
4185 EDNIVGNPAGPKLRLLRRICVSEMLGPSGLSKMYGLRRREFRSTLRHLYTQSLCGTPVCV 4006
4005 GAQMFLTAMNTITNSLWGGKIGSESERTAVGQEFRALIAEITELLGRPNVSDFFPVLAP 3829
3828 LDLQGVQKRMRGIRTQFEHMFARIIQTRAKAEQDGGEASSDFLEYMLKLEKEGGD 3664
3663 GKTPFTMINVKALDMVVGGT 3484
3483 ETISNTVEWAMAEMILNPRILEKVQQELDQVVGRDSLVEESHIGQLHYLRLVFKETIRL 3307
3306 HTPLPLMVPHCPSSTSTIGGYRVPKGTRVFVNVWAIHRNPRVWKAPQEFIPERFSGDDGQ 3127
3126 KWDFSGKEFDYFPFGSGRRMCAGIAMAERMTIYSLALLLQAFDWKLPEGTQLDMDEK 2956
2955 FGVVMKKAKPLVVIPTPRLTKP 2890

>AAAA01014272.1 (indica cultivar-group) 
6274 KSRGAGDTAGEWKRSARAAARPLPPHSPVEIIKLCSEFLNTDTDTTSTTLWWI 6116
6115 MAKLVKNPSIQSNIHDKITAKTGDEKVEVSEENVHGMPYLRAVVLEGLRKHPPGHFVLPQ 5936
5935 KAMEDMEVGGYLIPKGATVNFMVAEISRDEQEWAKPMEFIPKRFLPDGNSEGVDVTGSKG 5756
5755 IRMMPFGVKRRICVGLNFAMHHLEYFVANMVREF 5654

>AAAA01014333.1 (indica cultivar-group) 
4175 LLLRHIVPLSWWRLARRLGIGYERKMPVAWRTMDRFVADTIAKRRAEKART 4023
4022 GIDDSADLLSSYINDDEEDAGTVDAFLRDTTINLMLAGRDTTGSALSWFFYLLTKNP 3852
3851 RVLHKLLQELDSVKSTTTADGMVIFDPDETGRLVYLHAALCESLRLYPPVPMEHKGPAAA 3672
3671 DVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISDDGKLRYV-PSYKFMSF 3495
3494 NSGPRTCLGKDMAFVQLKTAAAAVMKNF 3411

>AAAA01014464.1 (indica cultivar-group) 
4153 LAMAASLAWLLVAIVLASLYLAMQHRSVAAARRRRLPLGPTPLPLVGNLLSVSR 3992
3991 SSPHRSLARLAERYGQLMRVRLGAVDYVVASSPAAAGDIHHHSHNAHLASRPLFDAWRGA 3812
3811 QHHRNSVIALPPHGEWRAQRRLATEEVMSPGRLDALAPLRREKVRELVRRVAGRAARGG 3635
3634 EPVEVGREAFEAFLGILSRTAFSADLVDPDLRDAVQEATKLAATPNVSDFFPAV 3473
3472 AAADLQGLRRRMGKLVARAYGIIDELLARRKGGREAGEPRKDDLLDVVLDNQDE 3311
3048 DLFVAGTDSGSTAVEWAIAELLQSPQSMQKVKNEFRRVMCTRTEIEESDISQLPYLQAVL 2869
2868 KETLRLHPSVPMTYYKAEATVEVQGYTIPKDTNIILNIWAIHRKPDVWADPDRFMPERF 2692
2691 METDTNFFGKHPEFIPFGGGRRICLGLPLAYRMVHMVLASLLFHFDWKLPEGAEKDGVDM 2512
2511 REK 2503

>AAAA01014899.1 $FI (indica cultivar-group) 
223 MVTTHLAYVLLFLVTAVLLFHLRRGG
    RSAPAKLTTAHRPHPNPVLGNTVEFIRNRRRFFDWYTDLLRASPS
    GAIEAWGPFGAGHAVTTACPAAVEHLLRGNFGNYVRGASFRAAMSELIGDG
589 LFAADGRLWSVQRKVASYAFSSRALRRFSDDVLAVHLRGGLLPFLDAAAASGEAVD 756
757 LQDALRRFAFDSICHVAFGVESSTLIETAREDSGRHEALFAAFDAAVEISFRRALAPFTL 936
937 VRKLTGLVNVGSSRRLREAIGVIDDYAMSVVESKEAACRDRDSEDVDPDLLSRFMAA 1107
1108 MDEEDGGELGAMFPTPEGKRRLLRDVVVSFVLAGKDTTSSALTWLFWLLAANPRCERRVR 1287
1288 DEVSRSPDGDGGGDAKGMHTHYLHAAITEAMRLYPPVPFNGRVAVGDDVLPG 1443
1444 GAAVRAGWFANYSAYAMGRMERLWGEGCLQFSPERWLRDGGEFVAVDAARYPVFHAGPRA 1623
1624 CLGKEMAYVQMKTVAAAVLRRFSVEVAAPAPAMESPPAYEMTATMKMKGGLWVRLRKRE* 1803

>AAAA01014982.1 (indica cultivar-group) 
4380 ANVLYAALLVPMVLYLAVTRRRSRRLPPGPAGLPLVGSLPFIDPNLHTYFAGLAA 4216
4215 KHGPILSIRLGSKVDIVVTSPELAREVLRDQDSVFANRVMPDAGNAVSFGGVQNIVGNPV 4036
4035 GPMWRLLRRLCVHEMLSPSGLANVHDLRRREFRSTLRYLHTKSGEPVDLGAQMFLNTMNV 3856
3855 ITSAMWGGTIGSESERAAVGSEFRGLVAEVTELLGTPNVSDFFPALAPFDLQ 3700
3699 GIRGKMERFRSRFDLMFAKIIQQRMKAQQDGGETATDFLECMLKMEKEGGDGKAPF 3532
3531 TMDNVK 3514
3404 DMVVGGTETTSNTVEWAMAEMLQNPQVLKKAQQELDSVVGRDEVVEEWHLPQLHYLRMV 3228
3227 IKETLRLHPALPLMVPHSPSAASTVSGYHVPEGSRVFVNVWAIQRNPLVWNEPLEFNPER 3048
3047 FAGDEGHKWDFTGSQFDYFPFGSGRRICAGIAMAEKMTAYSVAMLLQAFDWKLPQGVQP 2871
2870 DLSEKFGIVMKKAAPLVAIP 2811

>AAAA01015239.1 $FI (indica cultivar-group) 55% to AC090873
MALLLLLVSSSCLVV
ATSIAVLCYVNNDADERLPPGPRVRLPLIGNLFLHAPTMAFLPSALRRLRRSHGPVVTLW
AGNRPAVFVIGRDFAHRTLVRAGAALAHRPPSPFASSRALSFNRHGVNAAEYG frameshift
RRSLRRLRSNICSCLAATEALQRRSVDRLVATLELEARAGAGATGVVAPTDAFRHGVFSFFAVLCFGE
WVRDGEHDAVLRDLRRAHAD
5420 ILALTVELGAFHLVPAVLMVPYLHRWWKLSGLQRSHRDIVAALISVRRLRREK 5262
5261 ADGDVADSATFCYVDTLLELELGEDEMVSLCWEFMNAAAKTTSTALEWTM 5112
5111 ARLVHHSDIQRKLRHDIAKTTNSGGVGVSPSPYLKAVVQESLRLHPPAHYLLAHTV 4944
4943 DRDVPLGAGGYVIPKGAIVNYAVAEIGRDATAWTDPDEFLPERFMEGGEGAMVDAASCGG 4764
4763 TDIRMMPFGAGRRACPCASFAVSVLHLFVGRLVEQFEWWPMAEDDKAPVDFSEK 4602
     TGLVTVMKTPLRALFVPTTSS*

>AAAA01015583.1a (indica cultivar-group) 
709 RGGGCRVPPGPLAVPVLGNLLWLWHSPADLEPLLRRLIARHGPVVSLRVGSRLSIFVA 882
3767 GADTMSTTLQWIMAELVKNPSIQAKLYDEIKVTVGDDHEGVSEEDTQKMPYLKAVILEGL 3588
3587 RKHPPGHFALPHKAAEDMDVGGYLIPKGATVNLMVAEMGRDEREWENPMQFIPERFFAGG 3408
3407 DGEGVDITGSKRIRMMPFGVGRRMCAGINTAMLHLEYFVANMVREFEWKAVAGDEVDFAE 3228
3227 KFEFTTVMAKPLRAQLV 3177

>AAAA01015583.1b (indica cultivar-group) 
6384 GTDTMSTALQWIMAELVKNPSIQSKLYEEIKATVSDDHDEITEEDTKKMPYLKAVILEGL 6205
6204 RKHPLGHFVLAHKAAEDIEVGGYLIPKGATVNFMVAEMGRDEREWENPMQFMPERFLPGG 6025
6024 DGEGVDMTGSKRIRMMPFGVGRRMCAGLNTAMLHLEYFVANMVRAFEWKEVAGDEVDFAE 5845
5844 KAELTTVMAKPLRAQLVL 5791

>AAAA01015785.1 (indica cultivar-group) 
1891 LLVVFLVAFLFTLLAKHGAVKRKHGVRVPPGPLAVPVLGSLVWLTHSSSANLEPLLRRLI 1712
1711 ARHGPVVSLRVGSRLSIFVADRRVAHAALVGCGAALADRPPDVTHSLLGESRNTITRSG 1535
1534 YGPVWRLLRRNLVVETTHPSRVRLFAPARSWVRRVLVDKLADAGAHPASPPRVLEVFRYA 1355
1354 MFSLLVLMCFGERLDEAAVRAIGAAQHDFLLYLGRKTSVFMFYPAITKHLF 1202
1201 RGRVHLGLAVRRRQKELFMPLI 1136
1035 VDTLLTIRLQDVDGDGDRALTDDEMVSLCSEFLSAGTDTTATALQWIMAELVKNPSIQSK 856
855  LHDEIKSKTSDGDDHDEITEDDARNNLPYLKAVILEGLRKHPPMHLLLPHKAAEDVEVGG 676
675  YLIPKGATVNFMVAEMGRDEKEWEKPTEFIPERFMAGDGDGEGVDVTGSREIRMMPFGAG 496
495  RRICAALSVAMLHLEYFVANMVKEFEWKEVAGDEVDFAERLEFTTIMAKPLRVRLI 328

>AAAA01016714.1 (indica cultivar-group) 
4425 RRRGVVVAAPPQESASGLPGPPRRRPHPRPAPRPPLQRRRAAAYGPVSTISLFGRPTAFL 4604
4605 AGASCNKLLFSSDKLAAMSSASFLRMVGRRNIREVAGDDQRRVRAMMARFLRL 4763
4764 DAVKNYVSAMDDEVRRHLRAEWGGRAAVAVMPSMKSLTFDVMCTVLFGLERRGDHAAVRR 4943
4944 ELSSEFQQLVRGIWAVPVNLPFTTFGKCLAASRRGRRAVARIVE 5075
5076 ERRRAMPRGGGGGGSAGDLVTHMLAEGMDEEEIIDNVVFLMVAAHDTTAV 5225
5226 LLTFLLRHLDGNRAAYERVAAEQEAIATQRRRRGGSGSGSGSALTWDDLAGMRYTWAAAM 5405
5406 ETLRMVPPTFANMRKAVADVEVGGYVIPKGWQVITAATMTHLDPTIFPDPGRFEPARFE 5582
5583 AAAAKSAPPPFSYVPFGGGARACPGNEFARAETLVAMHYIVTGFRWRLAAGCD 5741

>AAAA01017255.1 $PI (indica cultivar-group) 81% to AP003232.1 
2147 MELSSTSTSLFFILIPFLPLLYFLYLH frameshift
     LDPRKQPHAHGLKSYPVVGTLPHFVKNRDRFLEWSTG 2342
2343 VMKRSPTHTISFKGLGLTAGAITANPANVEH frameshift
     VLKTNFDNYPREGL 2479
2480 ISLAEDFLGRGIFSSDGEQWLWQRKAASYEFNKRSLRNF 2596 frameshift
     VVDSVRFEVVERLLPLLEQAAGRDGRTLDVQDVL 2699
2700 ERFAFDNICRVAFDEDPACLTEESMATPQSAEFMRAFND 
2817 AQNTILSRFLSPAKSLWRAKRLFNMEPERRMREAINTVHTYTERIVRERREREEAGLARR 2996
2997 DDFLSRFAAGGEHSDESLRDVVTNFLMAGRDSTSSALTWFFWLLSDRP 3140
3141 DVEGKIVHEIRAVRSASISGGMGSTTFSLDELRDMHYLHAAITESMRLYPPVPINARTC 3317
3318 KEEDSLPDGTFVGKGWHVTYCAYAMGRMEDIWGADCEEFRPERWLD 3455
     EAGVFRPESPFKYPI frameshift
     FHAGPRMCIGKEMPYIQMKSIVAXXXXXXX frameshift and small deletion
     LRYAREEGHPGLVLSLTLRMEAGLPMKVTSRE*

>AAAA01017257.1 (indica cultivar-group) small seq gap of about 3 aa
MATPEDTGSWLLYLSLAAKCSGDGDGQPHRLLGFVVVCAVAGLVTCLLHWSFPGGPAWGRW
3808 WWTRRRRRGSPCGVAAVPGLRGLPVIGSMWLMTGLAHRKLAAAAEAAGAGRLMALSLGE 3984
3985 TRVVVAAHPDVAREILHGAAFADRPVKESAYGLLFHRAIGFAPHGAYWRALRRVA 4149
4150 STHLFSPWQVAASAPQRAVIARQMVRAIKLQQRSRSGDSAAGA 4278 small seq gap
     RRASLHNVMWSVFGRRYELQLDPGKESDEVRELRALVDEGYDLLGQLN
     WSDHLPWLARFDLQSTRARCSRLVPRVNRFVTRIIDEHRSSAPVAAAI
     DFTDVLLSLQGSDKLADSDMVAVLWVRH (0)
4829 EMVFRGTDTVAVLIEWVLARLVLQQDVQARVHDELGRVVGLDRDVTESDTASLVYLH 4999
5000 AVIKETLRLHPPGPLLSWARLATSDVHVDGYLIPAGTTAMVNMWAIAHDPDVWAEPMEFR 5179
5180 PERFIGKAAEFSVMGSDLRLAPFGSGRRSCPGKSLAMATVAFWLATLLHEFALLPSPDP 5356
5357 AHGVDLSEVLRLSCEMATPLAVTAWPRRVV* 5449

>AAAA01019060.1 (indica cultivar-group) 
4015 LPLLLLLHYALATFTASRARKNNKDRLPPSPLALLVIGHLLHLMGSLPRTSPSAASPHG 3839
3838 TGPTCSSGLAPCRCSLRRRRVPAAEAILRTHDHVFASRPRTVLLANIVFYRSRDVRFAPY 3659
3658 GDHWRQARKLVTTHLLSAKKVRSLRLAREEEVN*LATIDANLACTPS 3518
1622 DVFFGGIDTSALVLEFTIAELMQRPRMLKKLQDEVRACIPKGQKIVSEVDINNMAYLRAV 1443
1442 IKEGIRLHPVAPVLAPHISMDDCNIDGYMIPSGTRVLVNVWAIGRDPRFWEDAEEFVPER 1263
1262 FIDSMSSAAANVNFTENDYQYLPFGYGRRMXPGMKFGIAVVEIMLANLMWKFDWTLPPG 1086
1085 TEIDMSEVFGLSVHRKEKLLLVP 1017

>AAAA01023722.1 (indica cultivar-group
77  LTTLLLLALISFFFLVKLIARYASPSGRESALRLPPGPSQLPLIGSLHHLLLSRYGDL 250
251 PHRAMRELSLTYGPLMLLRLGAVPTLVVSSAEAAAEVMRAHDAAFAGRHLSATIDILSC 427
428 GGKDIIFGPYTERWRELRKVCALELFNHRRVLSFRPVREDEVGRLLRSVSAASAEGGA 601
602 ACFNLSERICRMTNDSVVRAAFGARCDHRDEFLHELDKAVRLTGGINLADLYPSSRLVRR 781
782 LSAATRDMARCQRNIYRIAESIIRDRDGAPPPERDEEDLLSVLLRLQRSGGLKF 943
944 ALTTEIISTVI 976
1125 DIFSAGSETSSTTLDWTMSELMKNPRILRKAQSEVRETFKGQDKLTEDDVAKLSYLQLVI 1304
1305 KETLRLHPPAPLLIPRECRETCQVMGYDVPKGTKVFVNVWKIGREGEYWGDGEIFRPERF 1484
1485 ENSTLDFRGADFEFIPFGAGRRMCPGIALGLANMELALASLLYHFDWELPDGIKSEELDM 1664
1665 TEVFGITVRRKSKLWLHAIPRVP 1733

>AAAA01024345.1 (indica cultivar-group) 
1816 MDTPALLPLALALVAIPIVILLFNRIRPGRLPPGPRAWPVVGNLFDIHPVRCRCFMEWAGKYG 1628
1627 PIMTVWLGTSPTVVVSTSELAREVLKNNDQQLADRPRNRSSERFSRGGVDLIWADYGPH 1451
1450 YIKVRKLCNLELFAPRRMEALRPIREDEVTAMVESIYRAITAPGR*YSTMN 1298

>AAAA01028263.1 (indica cultivar-group) 
8   GQHTSSSTSTWTGARLLTNPDHLRAAVEEQARLLRRHGGDRVDHAALAAMDTLQRCVKET 187
188 LRLHPPALMLLRHARRSFVVHSEDSGGGEREYEVPEGHTMASPLLLHNALPRVYRDPGE 364
365 FDPGRFGAGREEGAGGLAYTAFGGGRHACVGEAFAYMQIKVIWSHLLRNFELQL 526
    VSPFPETDWTVVMPGPKGKVMVTYKRRKLT*

>AAAA01028453.1 (indica cultivar-group) 
365 GVTFIDAAGELDEQGCELKA
425 IVKDGIKIGASVPIAEHIPVLRWLNLVDEELYNAHSARRDRFTRRIMDEHARELERH 595
596 GAKQHFVDALFTLRDQYDLSDDTVIGLLWDMIAAGSDTAVITAEWAMAE 742
743 LARNPRVQAMAQEELDRVVGRGRLMLEVDIPNLPYLQAIVKESLRLHPPAPLMLPHKASA 922
923 GVKIAGYDVPKGANVIVNVWAVGRDPSVWDSPLEYRPERFLEESIDIKGSDYRVVPFGAG 1102
1103RRVCPGAQVGISLVASMIGHLLHQFTWALPDGTRPEDLDMME 1228
SPGLVTFMATPLQVVAMPRLDKEELFKRVPVDIS*

>AAAA01029060.1 (indica cultivar-group) 
VEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEEFMPE 190
191 RFIGSKIDVKGQDFQLLPFGSGRRMCPGHSLGLKVIQLSLASLLHGFEWRLPDGVSAGEL 370
371 SMEEVFGLSTPRKVPLEVVVKPKLPAHLYTGP*

>AAAA01032609.1 (indica cultivar-group) 
138 VKIVMEKISKAAFAREAVDIGQILCSFTNDLACRVVSRKLVGDDRQKKLLQELVNKTIKL 317
318 LSIFNVEEYFSILARIGVIGKVMCARAERLKKKWDMLLKKLIADHESKCDSYLVCGRNK 
    DDFVDILLSVRKEYGLTEEHVKAILE
1064 DVFIAGTQSSARVIEFTFAELMRKPHMLKKVQDEVRACIPNGQAIVSEVQVNNMTYLRAV 1243
1244 VKEVLRLHPVAPLLATHVSMADCNINGYMIPSGMRVLVNAWAIGRDERFWYDPEKFMPER 1423
1424 FVESVNGSATASVNFWVNNYQYLPFGSGRRMCLGMNFAMAVIEITLANLLWKFDWALP 1597
1598 AHAMEVDMSEEFGLSVRLKEKLLLVPKQHV* 1690

>AAAA01034116.1 (indica cultivar-group) 
TIATAMLTQYARSKSKSTVKPRKIHSLGTK
92  IPIVGDLLESLKHKARHDWISDTSLRFQNEPWQINVPGGAKTIVLSDPATIEDVMVT 262
263 QSDVFVRGVQIRDIMHDLIGDGIANADGEQWFHQRKTAAKFFSARTLRLCMTQ 421
422 TMQRNIEQVHQHLDAQCGTGRLADLTDLFQQFTLQTFLDVGVGIDARIIGKSEPEAFRAL 601
602 DEATILLMRRLALPTFVWKLQRWLNVGREKELKELLVTVRTYVNRLVTQCLSKKNNEA 775
776 GGDDEGEKIRTAVELFVEHSADDKAGLRPRDLVDFLLGFLFAARDTSAVTTMWFFYEL 949
950 GQHPEIEAKIRQELAVKLPQLGVGRGGYITADHVKQLVYLEAVIKETLRFRPAAANTTRL 1129
1130 ANQDTVIDGDIYVRKGEIVNLSTYALARNPRVWGPDAGEFKPERWIDTKTGELLSFPATK 1309
1310 FFSFGAGPRSCLGMKLAMLNLRVLIANLLHRYKFEIDPSCDGRHTAAMVMSPKHSVLA 1483
1484 QGRAGVSFRPPFSQGGATLPNVIEYIALHE 1573

>AAAA01035499.1 (indica cultivar-group) 53% to AP005114.1b (partialI)
TMPTTIQGYHIPAKTIAFINVWAIGRDPAAWDTPDEFRPERFMGSAVDFRGNDYKFIPFGAGRRL 197
198 CPGIILALPGLEMVIASLLYHFDWELPDGMDVQDLDMAEAPGLTTPPMNPVWLIPRCRTI*

>AAAA01051575.1 (indica cultivar-group)
855 DVFAAGSETTATATIWAMSELVRTPRLMERAQAEIRQLLQGKTRVAEEDIQGRLPYLQMV 676
675 IKETLRLHPPAPLILPRLCAESTKILGFDVPEGTTVFVNAWALGRDDKSWVDANEFKPER 496
495 FEDDDRVDFSGADFRFIPGGSGRRMCPGLTFGLANIETTLANLLYHFDWKLPGGANPYEL 316
315 DMAESYGITARRTTDLLLEATPYVPHGSVS* 223

>AAAA01059584.1 (indica cultivar-group) 
596 VAAKTRVIINTWAIGRDSIIRENAEEFLPERFIDNGIDYNSKDFSFIPFGAGRRGCPGIAFATRLA 793
794 ELALANLMYHFDWELQEGQDLESFQLVSPSVIQTWGSS 907

>AAAA01060623.1 (indica cultivar-group) 
RRLVPTYVWKLQRWLNIGSEKKIKELMEHVNTYVTEKINQSLSKTNGEASGQGESDSI
RTAIELFVEHSGDDKAGLRPRDLVDFVLNFMVGARDTSAVTTQWLFYELSRHPEIEAKIR
EELASKL
    SQLGVGPDGYITADHVKELVYLEAVIKETLRLHPAAPLLMRVAKQDAV 526
527 VAGDIFIRKGQSVNMSVYAMARNPRVWGPDAAEFKPERWIDATTGTLHSFPATKFFTF 700
701 GAGARACIGMKLAMLNLRVLTANLLLRYKFEIDPANDGSHVSAIVLAMRHELLAKVERV* 880

>AAAA01066426.1 (indica cultivar-group) 
803 RKASVRHLLSPPRVRAYRAVREQEVAALLRRVTEQACGGGVVRLSELLSGFAKDVA 636
635 GRIVLGVRAGAGGDGGGWRARMDALLEESNVLLGAFHAGDYVPWLSWVSAVDGT 474
473 DARVRTAFEKIDRILDEIVDAAAARDTPSSSPGPGNGTDGDSDAFIHLLLSLQREGTEEW 294
293 RLTRDNVDLFGAGTEATIIVLEWA 114
113 MAELLRDKGAMGNLQREVRQQQA 45

>AAAA01081177.1 (indica cultivar-group) 
SDEDKAGMTARDLRDFILQFILGARGTSALSLAWIFLLIAKHPEVEQRIRDEMAVRLPEVMANDEAYVTSDHIQDLVYLEAT 452
451 IKEVLRLYPTIPMNRREAVKDTVIGDGIPVKKGEYVVLHPYAMARLPSLWGPDAAEFKPE 272
271 RWIDPTTGELLKVSSTKFLLFGSGPRTCIGMKLAMLEMRVVTANLIKRYRFSLAQPNDCS 92
91  HIVSMDLMLANPLVMSAKRTTKETPNE* 8

>AAAA01085971.1 (indica cultivar-group) 45% to AC021892.5 48% to 75B1
AAAA01009188.1 (indica cultivar-group)
598 LASLARKYGPVMYLKMGTCGVVVASSPCAARSFLKALDARFANRPAVASAVDITYNYQN 422
421 MVFANYGARWKLMRKLASVHLLGARALADWAAVRRDEARRLLRGVAEASAAGRP 260
10552 YKDMIVSLLTGAGLFNISDFVPALAWLDLQGVQAKLRRIHDQFDVLITKLLADHAATNAD 10373
10372 RARAGRTDFVDRLRAAVGVDDEDGETISEVNIKGLIF 10262
6592 FRPERFMPGGAAERVDPLGNYFELIPFGAGRRICAGKLAGMVFVQYFLGTLLHSFDWR 6419
6418 LPDGEDKVDMSETFGLALPKAVPLRALVTPRLAPAAYA 6305

>AC125784.1 $F ortholog of AAAA01085971.1 100% AAAA01009188.1 1 aa diff
AU071096 BI796894 BI796059  50% to C99304 like 75B1
93834 MELAALCTDPVVLSAAFLCLLLHLSLRSYRPPSPGGGRRLPPGPPGLPVLGALPLVGPAP 94013
94014 HAGLASLARKYGPVMYLKMGTCGVVVASSPCAARSFLKALDARFANRPAVASAVDITYNY 94193
94194 QNMVFANYGARWKLMRKLASVHLLGARALADWAAVRRDEARRLLRGVAEASAAGRP 94361
95165 YKDMIVSLLTGAGLFNISDFVPALAWLDLQGVQAKLRRIHDQFDVLITKLLADHAATAAD 95344
95345 RARAGRTDFVDRLRAAVGVDDEDGETISEVNIKGLIF 95455
99273 DMFTAGTDTSSIIVEWAMAEMMKNPAVMARAQEEMDRVVGRGRRLEESDIASLPYLQAVC 99452
99453 KEAMRLHPSTPLSLPHFSFDECDVDGYRIPANTRLLINIYAIGRDPSAWEDPLEFRPERF 99632
99633 MPGGAAERVDPLGNYFELIPFGAGRRICAGKLAGMVFVQYFLGTLLHSFDWRLPDGEDKV 99812
99813 DMSETFGLALPKAVPLRALVTPRLAPAAYA 99902

>AAAA01092069.1 (indica cultivar-group) 
AIAMAFRQTSVLTLADLFPSSRLMQALGTAPRKVLACRDKIQRILEQVIQEKAQEMGRGDEATAGNEGFV 414
413 GVLLRLQKEGSTPVQLTNDTI 351
207 DMFSAGSETSSTTLNWCMTELVRSPVVMAKAQAELRDAFKGKNTITENDLEGLSYLKLVI 28
27  KEALRMHAP 1

>AAAA01093055.1
1   KIFKKLKDELRTACRTEADLNMDILGSLPYMNACIEEGLRIFPPVPIGLLRTVPKGGSLI 180
181 DGHAVPGGTSVCVSSWGASHSATNFVDPDSFIPERFLDSPECKDKYGKDVKKAAQPFSTG 360
361 PRGCIGRNLTYVELRLILGALLWNFDIEFADG 456
APLWNPKNEFEGLRAYNTWEKSPLMVRLTDIRKTPA*