51 accession numbers for purple sea urchin P450s and their 
alignments from 18 searches with one P450 from each mammalian family.
These sequences have not been sorted into families yet or 
searched against each other for joining contigs.  I am still 
in the discovery phase on these sequences.  There are probably 
some false positives in this set.

The sea urchin appears to have introns large enough to prevent more 
than one exon from being found on a single GSS sequence (approximately 600-700bp 
each).  This means that all the fragments given here are single exon pieces.
It will be difficult to join them into single P450 protein sequences
since there is no evidence to show which ones belong together, except 
sequence similarity.  This may be reliable in families with single members
like CYP39, CY46 or CYP51, but pseudogenes may interfere.

6/5/01 D. Nelson

AZ136379  SP_0170_B2_F11_T7A 
AZ145256  SP_0024_B1_F06_T7
AZ147012  SP_0030_B1_F08_SP6E
AZ147906  SP_0011_B2_G02_SP6E
AZ148264  SP_0018_A1_H03_T7 
AZ158432  SP_0060_B2_E08_SP6E 
AZ159610  SP_0064_A2_F02_T7A 
AZ160312  SP_0065_B2_F03_SP6E probable CYP8A 64% in short region
AZ161847  SP_0070_B1_H12_SP6E possible heme region weak
AZ165955  SP_0083_A2_G09_T7A 
AZ166211  SP_0083_B2_G09_T7A same as AZ165955
AZ167954  SP_0103_B1_B10_SP6E
AZ170778  SP_0117_A2_G01_T7A 
AZ170842  SP_0117_B1_G01_T7A same as AZ170778
AZ174957  SP_0131_A2_C12_SP6 
AZ175303  SP_0132_A1_A08_T7A 
AZ175862  SP_0140_A1_C05_T7A
AZ176297  SP_0141_A1_F06_SP6 
AZ179521  SP_0165_B1_F10_SP6E
AZ179988  SP_0167_A1_E10_SP6E
AZ184817  SP_1003_B1_H10_SP6E possible N-term weak
AZ185450  SP_1005_A2_H05_SP6  cyp20 hit very short
AZ185855  SP_1006_A1_C03_SP6 
AZ186969  SP_1008_A2_B01_SP6E
AZ187224  SP_1008_B1_G05_SP6E
AZ188755  SP_1012_B2_C04_SP6E 
AZ189543  SP_1014_B1_D08_T7A
AZ190486  SP_1017_A2_E01_T7A
AZ191715  SP_1019_B2_F07_T7A 
AZ191886  SP_1020_A2_C11_T7A
AZ193119  SP_1022_B2_C10_T7A
AZ193978  SP_1025_A2_G12_SP6E
AZ194693  SP_1028_B2_A08_T7A 
AZ194695  SP_1028_B2_A09_T7A 
AZ195501  SP_1030_A2_A06_SP6E same clone as AZ195502
AZ195502  SP_1030_A2_A06_T7A 
AZ197884  SP_1035_B2_G04_T7A 
AZ198827  SP_1038_B1_B03_T7A 
AZ199572  SP_1039_B2_E06_T7A 
AZ200345  SP_0191_A2_A12_SP6E 
AZ200647  SP_0144_B2_B04_T7A
AZ201960  SP_0052_B2_B06_SP6E
AZ203676  SP_0084_A1_C06_SP6E
AZ203977  SP_0095_A2_E01_T7A
AZ204199  SP_0097_A1_E02_T7A 
AZ204399  SP_0096_A1_G06_T7A
AZ206702  SP_0106_B2_G07_T7A 
AZ207850  SP_0135_A2_F12_SP6E
AZ208993  SP_0138_A2_H02_T7A  weak match to CYP19 mid region
AZ209557  SP_0150_B1_B02_SP6E
AZ211455  SP_0155_B2_B04_SP6E


Alignments

>gi|8377157|gb|AZ193978.1|AZ193978 SP_1025_A2_G12_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1025 Col=24 Row=M.
          Length = 732

 Score = 69.7 bits (169), Expect = 7e-12
 Identities = 44/161 (27%), Positives = 68/161 (41%)
 Frame = -2

Query: 293 DILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIH 352
           +I++     N     D ++       +  G +T AS + W +Y L+ HP+ Q R R+EIH
Sbjct: 533 NIIIHVLQNNLKSFDDTNMIVSCFDALLGGWETVASTLRWTIYLLSKHPEAQGRMRQEIH 354

Query: 353 GLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVL 412
            L+GD    T      +P     I E +R  P VP     +++      G  +PKG  V 
Sbjct: 353 DLVGDERFPTIADRQYLPLVEATIAECMRFIPAVPIHLPHVTSQDCNIGGFDVPKGSAVA 174

Query: 413 LSIYGLHHNPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGG 453
            ++     +P  W + EVF P RF   +        P   G
Sbjct: 173 ANLLHFAKSPMFWEDPEVFRPERFLDDAGNFMRGLEPVPFG 51
2d like 38% to 2d26
533 NIIIHVLQNNLKSFDDTNMIVSCFDALLGGWETVASTLRWTIYLLSKHPEAQGRMRQEIH 354
353 DLVGDERFPTIADRQYLPLVEATIAECMRFIPAVPIHLPHVTSQDCNIGGFDVPKGSAVA 174
173 ANLLHFAKSPMFWEDPEVFRPERFLDDAGNFMRGLEPVPFGYG 47

SVARTKFKKSCPLIVAVIAIVYKQI*STSFGIVPL**IAFPL*EEAPSIHI*FHSHSIKLVKKSTKNIIIHVLQNNLKSFDDTNMIVSC
FDALLGGWETVASTLRWTIYLLSKHPEAQGRMRQEIHDLVGDERFPTIADRQYLPLVEATIAECMRFIPAVPIHLPHVTSQDCNIGGFD
VPKGSAVAANLLHFAKSPMFWEDPEVFRPERFLDDAGNFMRGLEPVPFGYGEFPDEGILLIYFEN

QLLVPSLKKVVH*LLR*LQ*FINKFKAHLLVLYHYDKSHSLYKKKLPPFTFDFTVIR*NWLKNQRKISLFTFYRIISNRLMIQT*LLAA
LTLSWAAGRP*HPLSAGQSTSSQSTPKPRGACVKRSMTWWVTSVSRPLPIVSTFRWWRRPSPSACDSSPLSPSICLT*PLRTVTLAGST
CPRAVP*QPISCTSPRAPCSGRIPKSSGQKGFLMTLVTS*GAWNQFLSATVSFPTKEFCSFTLRT

FSCSYQV*KKLSINCCGDCNSL*TNLKHIFWYCTIMINRIPFIRRSSLHSHLISQSFDKTG*KINEKYHYSRFTE*SQIV**YKHDC*L
L*RSPGRLGDRSIHSPLDNLPPLKAPRSPGAHASRDP*PGG*RAFPDHCRSSVPSVGGGDHRRVHAIHPRCPHPSASRDLSGL*HWRVR
RAQGQCRSSQSPALRQEPHVLGGSRSLQARKVS**RW*LHEGPGTSSFRLR*VSRRRNFAHLL*EQ


>gi|8338322|gb|AZ167954.1|AZ167954 SP_0103_B1_B10_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=103 Col=19 Row=D.
          Length = 337

Score = 65.5 bits (158), Expect = 1e-10
 Identities = 39/103 (37%), Positives = 55/103 (52%), Gaps = 3/103 (2%)
 Frame = +3
37% to 4v3
Query: 351 VQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPL-FARSLSEDCEVG 409
           + ++V  ELD V GR  +P T  D   L Y D  + E +R+ P VP+      S D  +G
Sbjct: 15  LSQQVQNELDAVVGRGRQPDT-SDRPNLPYCDATLMEIMRLRPVVPISLPHMTSADASLG 191

Query: 410 GYKVTKGTEAIIIP--YALHRDPRYFPDPEEFRPERFFPENSQ 450
            Y + KGT  II+P  +A+H DP+ + DP  F P RF   + Q
Sbjct: 192 PYTIPKGT--IIVPNLWAVHHDPKEWCDPHLFNPNRFLSADGQ 314 52% to 2U1
k-helix to perf
21  QQVQNELDAVVGRGRQPDTSDRPNLPYCDATLMEIMRLRPVVPISLPHMTSADASLGPYT 200
201 IPKGTIIVPNLWAVHHDPKEWCDPHLFNPNRFLSADGQ 314

>gi|8299911|gb|AZ147906.1|AZ147906 SP_0011_B2_G02_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=11 Col=4 Row=N.
          Length = 428

70% to 4v3 tblastX of this GSS does not extend vs 4v3 probable intron after CIGK
Query: 426 PNLEVFDPSRFAPGSAQ--HSHAFLPFSGGSRNCIGK 460
           PN E FDP RF P +A+  H +A++PFS G RNCIGK
Sbjct: 2   PNSERFDPDRFLPVNAEERHPYAYVPFSAGPRNCIGK 112

>gi|8348672|gb|AZ176297.1|AZ176297 SP_0141_A1_F06_SP6 Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=141 Col=11 Row=K.
          Length = 691
Score = 67.4 bits (163), Expect = 3e-11
 Identities = 27/37 (72%), Positives = 32/37 (85%)
 Frame = +1
72% to 4v3 same as above
tblastX of this GSS does not extend vs 4v3 probable intron after CIGK 
high AT rich seq G codon = GGT probable intron start

Query: 434 PDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCIGQ 470
           P+PE F P+RF P N++ RHPYAYVPFSAGPRNCIG+
Sbjct: 1   PNPERFDPDRFLPVNAEERHPYAYVPFSAGPRNCIGK 111

>gi|8374894|gb|AZ191715.1|AZ191715 SP_1019_B2_F07_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1019 Col=14 Row=L.
          Length = 838

 Score = 46.2 bits (108), Expect = 8e-05
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = +1
59% to 4v3 tblastX of this GSS does not extend vs 4v3
S codon is AGC this could be intron end
Query: 138 STGSKWRTRRKMLTPTFHFTILENFLDVMNEQANILVNKLEKHVNQ-EAFNCFFYITLCA 196
           S G KW  RRKMLTPTFHF+IL++F+DV NEQ+ ILV KLEK   + E  N F  +  C 
Sbjct: 61  SWGQKWFHRRKMLTPTFHFSILQSFMDVFNEQSMILVKKLEKFAEKSETVNIFPLVAYCV 240

Query: 197 LDIIC 201
           LDIIC
Sbjct: 241 LDIIC 255 next codon is AGT could be intron start next exon is the ETAM exon

>gi|8392652|gb|AZ198827.1|AZ198827 SP_1038_B1_B03_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1038 Col=5 Row=D.
          Length = 812

 Score = 46.2 bits (108), Expect = 8e-05
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = +3
Same as above
Query: 136 GQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLD 195
           GQ WF  R+MLTP FH  IL+ ++ +  +   +++ K E+   +   + +F  V+   LD
Sbjct: 120 GQKWFHRRKMLTPTFHFSILQSFMDVFNEQSMILVKKLEKFAEKSETVNIFPLVAYCVLD 299

Query: 196 TI 197
            I
Sbjct: 300 II 305

>gi|8352363|gb|AZ179988.1|AZ179988 SP_0167_A1_E10_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=167 Col=19 Row=I.
          Length = 463

 Score = 42.0 bits (97), Expect = 0.001
 Identities = 23/68 (33%), Positives = 30/68 (43%), Gaps = 8/68 (11%)
 Frame = -2
48% to 2U1 result of tblastx vs 2U1 (bottom) cannot extend
Query:   222 GTSVMANFWSVHHNEDAWDQPEEFLPERFLNDQGNLKEPSQLPHFMPFSVGKRRCLGANV 43
             GT ++ N WSVH +   W++PE+F P RFL+DQG L +      F+PF +GKR C+G  +
Sbjct:   427 GTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKET---FIPFGIGKRVCMGEQL 483

Query:    42 AKAELFLMXGSNLQ 1
             AK ELFLM  S +Q
Sbjct:   484 AKMELFLMFVSLMQ 497


>gi|8394360|gb|AZ199572.1|AZ199572 SP_1039_B2_E06_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1039 Col=12 Row=J.
          Length = 861

 Score = 41.6 bits (96), Expect = 0.002
 Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = -2
51% to 4f18
Query: 422 PKVWPNLEV-FDPSRFAPGSAQHSHAF--LPFSGGSRNCIGKQFAMNQLKVA--RALTLL 476
           P VW +  + F PSR    + +    F  +PFS G+RNCI +QFA+ +++VA  R     
Sbjct: 848 P*VWSDDHMPFRPSRXDGQNVEGGDPFVSIPFSAGARNCIAQQFALQEIQVAAIRIYDKF 669

Query: 477 RFELLPDPTRIPIPMARLVLKSKN----GIHLR 505
            F L+ D T    P+ R+V   ++    GIH R
Sbjct: 668 GFTLVRDST----PVFRIVSVPEDXILLGIHPRRET* 582

>gi|8345325|gb|AZ174957.1|AZ174957 SP_0131_A2_C12_SP6 Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=131 Col=24 Row=E.
          Length = 718

 Score = 37.7 bits (86), Expect = 0.027
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +1
58% to 4v3 tblastX of this GSS does not extend vs 4v3 V in FALV may be intron start

Query: 445 FPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILA 482
           FP  ++ RH YAY PFS G R+CIGQ+FA++    I A
Sbjct: 265 FPITTRPRHLYAYFPFSMGQRSCIGQQFALVSISIIFA 378

>gi|8396874|gb|AZ201960.1|AZ201960 SP_0052_B2_B06_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=52 Col=12 Row=D.
          Length = 858

 Score = 30.0 bits (66), Expect = 5.7
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = +2
72% to 4A11
Query: 473 LTLLRFELLPDPTRIPIP 490
           LTLL +ELLP PT  PIP
Sbjct: 740 LTLLSYELLPPPTPFPIP 793

>gi|8399228|gb|AZ204399.1|AZ204399 SP_0096_A1_G06_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=96 Col=11 Row=M.
          Length = 780

 Score = 72.0 bits (175), Expect = 1e-12
 Identities = 41/116 (35%), Positives = 60/116 (51%), Gaps = 1/116 (0%)
 Frame = -2

48% to 2U1 mouse
581 PEVRKKVQEELDTVIAPGELPSWRDRDRMPCTEATLMEIQRMANVTALTFPHKTTEDTE 405
404 LAGYSIPKDTHVFINLYSVHVDPTQWKEPEKFMPERFLSDEGGVIHNPALMPFSAG 237

AK018458 Mus musculus 16 days embryo lung cDNA, RIKEN 
Length = 1700
Mouse 2U1 sequence from Riken 

Query: 1    PEVRKKVQEELDTVIAPGELPSWRDRDRMPCTEATLMEIQRMANVTALTFPHKTTEDTEL 60
            P+V+KKV EE++ VI     PS  D+ +MP TEAT+ME+QR++ V  L  PH T+E T L
Mouse  1148 PDVQKKVHEEIERVIGCDRAPSLTDKAQMPYTEATIMEVQRLSMVVPLAIPHMTSEKTVL 1327

Query: 61   AGYSIPKDTHVFINLYSVHVDPTQWKEPEKFMPERFLSDEGGVIHNPALMPFSAG 115
             G++IPK T V INL+SVH DP  W++P+ F P RFL D+G ++     +PF  G
Sbjct: 1328 QGFTIPKGTVVLINLWSVHRDPAIWEKPDDFCPHRFLDDQGQLLKRETFIPFGIG 1492


>gi|8398897|gb|AZ203977.1|AZ203977 SP_0095_A2_E01_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=95 Col=2 Row=I.
          Length = 887

 Score = 36.6 bits (83), Expect = 0.062
 Identities = 21/58 (36%), Positives = 32/58 (54%), Gaps = 2/58 (3%)
 Frame = +3

Query: 71  AEFFQQLIYYTEEFRHLP--IIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFLYKF 126
           AE F   +   E++RH    +I++W GP+P+V +Y A + EV L     +   F YKF
Sbjct: 300 AEHFLYDVGVREKYRHQSGGVIRMWFGPLPIVLIYNAVHCEVCL----*LKFKFKYKF 461

>gi|8376298|gb|AZ193119.1|AZ193119 SP_1022_B2_C10_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1022 Col=20 Row=F.
          Length = 834

 Score = 68.9 bits (167), Expect = 1e-11
 Identities = 34/90 (37%), Positives = 53/90 (58%)
 Frame = -1
2d26 search
Query: 119 SKGVILAPYGPEWREQRRFSVSTLRDFGLSKKSLEQWVTEEAGHLCDAFTKEAEHPFNPS 178
           SKG+  +  G  W+EQR+F+ S  R  G+ KKS E  V+ E   L     ++   PF+PS
Sbjct: 360 SKGIGFSN-GEVWKEQRKFTHSVFRSLGVGKKSYEDTVSAEMKQLSSVIKEKKSSPFDPS 184

Query: 179 PLLSKAVSNVIASLIYARRFEYEDPFFNRM 208
            L  +AVSN+I S+I+  ++ Y+D  F ++
Sbjct: 183 TLFMQAVSNIICSIIFGTQYTYDDDAFKKV 94

>gi|8297159|gb|AZ145256.1|AZ145256 SP_0024_B1_F06_T7 Strongylocentrotus purpuratus, 
purple sea urchin,
           sperm genomic BAC library Strongylocentrotus purpuratus
           genomic clone Plate=24 Col=11 Row=L.
          Length = 540

 Score = 64.3 bits (155), Expect = 3e-10
 Identities = 29/95 (30%), Positives = 51/95 (53%)
 Frame = -2

Query: 333 RVHQEIDEVIGHVRHPEMADQARMPYTNAVIHEVQRFADIVPTNLPHMTSRDIKFQDFFI 392
           +V  E+D+VIG  R P ++D+  +P+T +   E  R   ++   +PH T  D+K   + I
Sbjct: 356 KVQAELDKVIGRDRLPSLSDRQNLPFTESTSVECYRLCRLINVQIPHRTRCDVKLGGYDI 177

Query: 393 PKGTTLIPNLSSVLKDETVWEKPLRFYPEHFLDAQ 427
           PKG+ +  N S +    ++WE      P+ F+D +
Sbjct: 176 PKGSNVGRNASWLSSSPSLWEXSKNSVPDRFIDKE 72

>gi|8419862|gb|AZ207850.1|AZ207850 SP_0135_A2_F12_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=135 Col=24 Row=K.
          Length = 847

 Score = 62.4 bits (150), Expect = 1e-09
 Identities = 30/64 (46%), Positives = 39/64 (60%)
 Frame = +1

Query: 437 MPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSDYGIYTMPVTPEPYQLC 496
           +P  +GRR CLG  LA ME FL FT L Q+F F +P  QP  S  G   + + PE Y++C
Sbjct: 136 LPLLSGRRDCLGMQLAMMETFLLFTNLFQQFEFKLPPDQPTHSMRGHPGLTMPPESYKIC 315

Query: 497 AVAR 500
           A+ R
Sbjct: 316 AIER 327

>gi|8373665|gb|AZ190486.1|AZ190486 SP_1017_A2_E01_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1017 Col=2 Row=I.
          Length = 572

 Score = 62.4 bits (150), Expect = 1e-09
 Identities = 30/64 (46%), Positives = 39/64 (60%)
 Frame = +2

Query: 437 MPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSDYGIYTMPVTPEPYQLC 496
           +P  +GRR CLG  LA ME FL FT L Q+F F +P  QP  S  G   + + PE Y++C
Sbjct: 152 LPLLSGRRDCLGMQLAMMETFLLFTNLFQQFEFKLPPDQPTHSMRGHPGLTMPPESYKIC 331

Query: 497 AVAR 500
           A+ R
Sbjct: 332 AIER 343

>gi|8427254|gb|AZ211455.1|AZ211455 SP_0155_B2_B04_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=155 Col=8 Row=D.
          Length = 920

 Score = 62.0 bits (149), Expect = 1e-09
 Identities = 31/89 (34%), Positives = 50/89 (55%)
 Frame = -2

Query: 128 GPEWREQRRFSVSTLRDFGLSKKSLEQWVTEEAGHLCDAFTKEAEHPFNPSPLLSKAVSN 187
           G  W + RRFS+  LR FG  K+SL   +  EA +L +        P +     SKA +N
Sbjct: 487 GEPWVDLRRFSLPALRSFGFGKQSLVPQINLEARYLSEEIRNLRGEPTDLLTTFSKATAN 308

Query: 188 VIASLIYARRFEYEDPFFNRMLKTLKESL 216
           +I  L++++R+EY D   +R+L+ + E+L
Sbjct: 307 IICQLLFSQRYEYSDGEMSRVLERMNETL 221

>gi|8417534|gb|AZ206702.1|AZ206702 SP_0106_B2_G07_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=106 Col=14 Row=N.
          Length = 828

 Score = 57.8 bits (138), Expect = 2e-08
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
 Frame = +1

Query: 231 PMLLHIPGLPDKAFPKLNSFIALVNKMLIEHDLTWDPAQPPRDLTDAFLAEV-EKAKGNP 289
           P LL  P L  +    ++S   LV  M+ EH  T D  Q  RD+ D ++ E+ E  K   
Sbjct: 13  PFLLETP-LYSEFRNLISSLKTLVADMVDEHGETLDD-QHIRDIIDLYILEIRELIKRGD 186

Query: 290 ESSFNDKNLRIVVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRV 334
           E  FN+  +   + D+  AG  TTSTTL W +LLM  HPD   +V
Sbjct: 187 EIVFNETTVWRGIFDMISAGTGTTSTTLLWGILLMAAHPDAMEQV 321

>gi|8312233|gb|AZ159610.1|AZ159610 SP_0064_A2_F02_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=64 Col=4 Row=K.
          Length = 515

 Score = 55.5 bits (132), Expect = 1e-07
 Identities = 35/87 (40%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query: 249 SFIALVNKMLIEHDLTWDPAQPPRDLTDAFLAEV-EKAKGNPESSFNDKNLRIVVIDLFM 307
           S   LV  M+ EH  T D  Q  RD+ D ++ E+ E  K   E  FN+  +   + D+  
Sbjct: 199 SLKTLVAYMVDEHGETLDD-QHIRDIIDPYILEIREHKKRGDEIVFNETTVWPGIFDMIS 375

Query: 308 AGMVTTSTTLSWALLLMILHPDVQRRV 334
           AG  TTSTTL W +LLM  HPD    V
Sbjct: 376 AGTGTTSTTLLWGILLMAAHPDAMEHV 456

>gi|8423387|gb|AZ209557.1|AZ209557 SP_0150_B1_B02_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=150 Col=3 Row=D.
          Length = 906

 Score = 54.7 bits (130), Expect = 2e-07
 Identities = 25/81 (30%), Positives = 44/81 (53%)
 Frame = -3

Query: 333 RVHQEIDEVIGHVRHPEMADQARMPYTNAVIHEVQRFADIVPTNLPHMTSRDIKFQDFFI 392
           +V  E+D+VIG  R P ++D+  +P+  +   E  RF  ++   +PH T  D+K   + I
Sbjct: 325 KVQAELDKVIGRDRLPSLSDRHNLPFKKSTSVECYRFCRLINVQIPHRTRCDVKLGGYDI 146

Query: 393 PKGTTLIPNLSSVLKDETVWE 413
            +GT +  N S +    ++WE
Sbjct: 145 RRGTNVGTNASWLSSSPSLWE 83

>gi|8377874|gb|AZ194695.1|AZ194695 SP_1028_B2_A09_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1028 Col=18 Row=B.
          Length = 799

 Score = 54.7 bits (130), Expect = 2e-07
 Identities = 27/64 (42%), Positives = 37/64 (57%)
 Frame = +3

Query: 437 MPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSDYGIYTMPVTPEPYQLC 496
           +P  +GRR CLG  LA ME FL FT L  ++   +P  QP  S  G   + + PE Y++C
Sbjct: 162 LPLLSGRRDCLGMQLAMMETFLLFTNLSLQYECKLPPDQPTHSMRGHPGLTMPPESYKIC 341

Query: 497 AVAR 500
           A+ R
Sbjct: 342 AIER 353

>gi|8399119|gb|AZ204199.1|AZ204199 SP_0097_A1_E02_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=97 Col=3 Row=I.
          Length = 795

 Score = 51.6 bits (122), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 42/76 (54%), Gaps = 1/76 (1%)
 Frame = +2

Query: 260 EHDLTWDPAQPPRDLTDAFLAEV-EKAKGNPESSFNDKNLRIVVIDLFMAGMVTTSTTLS 318
           EH  T D  Q  RD+ D ++ E+ E+ K   E  F++  +   + D+  AG  TTSTTL 
Sbjct: 41  EHAKTLDD-QHIRDIIDLYILEIREQKKRGDEIVFDETTVWRGIFDMISAGTGTTSTTLL 217

Query: 319 WALLLMILHPDVQRRV 334
           W +LLM  HPD   +V
Sbjct: 218 WGILLMAAHPDAMEQV 265

>gi|8298913|gb|AZ147012.1|AZ147012 SP_0030_B1_F08_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=30 Col=15 Row=L.
          Length = 295

 Score = 46.2 bits (108), Expect = 7e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 1/81 (1%)
 Frame = +1

Query: 12  VVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYSFYK-LQNRYGN 70
           +VI   +  ++   V +R       PPGP   P +GNL        PY   K L ++YG+
Sbjct: 52  LVILVLVLWMVKSFVSKRYGKQYRLPPGPSALPIIGNLPVFMTGKAPYRVMKNLADKYGS 231

Query: 71  VFSLQMAWKPVVVVNGLKAVR 91
           VFSL++   P VV+N + ++R
Sbjct: 232 VFSLKIGTTPFVVLNDVDSIR 294

>gi|8370147|gb|AZ186969.1|AZ186969 SP_1008_A2_B01_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1008 Col=2 Row=C.
          Length = 529

 Score = 44.3 bits (103), Expect = 3e-04
 Identities = 30/91 (32%), Positives = 47/91 (50%), Gaps = 5/91 (5%)
 Frame = -3

Query: 371 DIVPTNLPHMTSRDIKFQDFFIPKG--TTLIPNLSSVLKDETVWEKPLRFYPEHFLD--- 425
           D++  +  + TS  +K   FFIP    T+++ N   V  +E  W++P  F PE FL+   
Sbjct: 314 DLITWSKRYCTSLRLKPSTFFIPSSQVTSVMANFCQVHHNEDAWDQPEEFLPERFLNRPR 135

Query: 426 AQGHFVKHEAFMPFSAGRRSCLGEPLARMEL 456
           A    +   A  P S G+R CLG  +A+ +L
Sbjct: 134 AT*RNLPSCASCP-SVGKRRCLGANVAKADL 45

>gi|8351896|gb|AZ179521.1|AZ179521 SP_0165_B1_F10_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=165 Col=19 Row=L.
          Length = 567

 Score = 42.0 bits (97), Expect = 0.001
 Identities = 18/53 (33%), Positives = 30/53 (55%)
 Frame = -3

Query: 145 FGLSKKSLEQWVTEEAGHLCDAFTKEAEHPFNPSPLLSKAVSNVIASLIYARR 197
           FG+ K S+EQ +  EA  LC+      E  FNP   ++ +VS++I  + + +R
Sbjct: 565 FGVGKYSMEQRIINEAKVLCETIENNQERSFNPKGCITHSVSSIICGITFGQR 407

>gi|8369083|gb|AZ185855.1|AZ185855 SP_1006_A1_C03_SP6 Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1006 Col=5 Row=E.
          Length = 688

 Score = 39.3 bits (90), Expect = 0.009
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = -1

Query: 156 VTEEAGHLCDAFTKEAEHPFNPSPLLSKAVSNVIASLIYARRFEYEDPFFNRMLKTLKES 215
           + +EA +L + F  + E PF+P   L  A  N++ + ++  R+E+++P    +L    + 
Sbjct: 286 ILQEANNLVNHFEAQNEKPFDPQCDLHIASLNILCNFVFGERYEHDNPEMREIL----DF 119

Query: 216 LGEDTGFVGEV--LNAIPMLLHIP 237
             E +  +  +  +NA+P L H P
Sbjct: 118 SAEISKLLSPMHPVNAMPWLRHFP 47

>gi|8378681|gb|AZ195502.1|AZ195502 SP_1030_A2_A06_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1030 Col=12 Row=A.
          Length = 772

 Score = 35.4 bits (80), Expect = 0.13
 Identities = 26/89 (29%), Positives = 43/89 (48%)
 Frame = -2

Query: 11  AVVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYSFYKLQNRYGN 70
           +V +   IFLL   +V R +      PPGP   P +G   +     I  ++  L  +YG 
Sbjct: 264 SVFLGVVIFLLCFWVVRRPKN----LPPGPWSLPIIGYNFKPGL--IHEAYVDLAKKYGP 103

Query: 71  VFSLQMAWKPVVVVNGLKAVRELLVTYGE 99
           +FSL+      V++N  +++ + LV  GE
Sbjct: 102 IFSLRRGSFVFVILNDRESITQALVKSGE 16

>gi|8378680|gb|AZ195501.1|AZ195501 SP_1030_A2_A06_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1030 Col=12 Row=A.
          Length = 630

 Score = 31.2 bits (69), Expect = 2.5
 Identities = 12/29 (41%), Positives = 18/29 (61%)
 Frame = +2
C-term of AZ195502
Query: 472 PDGQPRPSDYGIYTMPVTPEPYQLCAVAR 500
           P  QP PS  G   + + P+PY++CA+ R
Sbjct: 2   PLNQPNPSMRGANGITMNPQPYKICAIER* 91

>gi|8391620|gb|AZ197884.1|AZ197884 SP_1035_B2_G04_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1035 Col=8 Row=N.
          Length = 851

 Score = 34.7 bits (78), Expect = 0.22
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = -3

Query: 37  PPGPVPFPGLGNLLQVDFENIPYSFYKLQNRYGNVFSLQMAWKPVVVVNGLKAVRELLVT 96
           PPGP   P +G   + D   I  +F  L  +YG V S++      VV+N   ++++ LV 
Sbjct: 240 PPGPWSLPIIG--YRFDSGLIHEAFVDLARKYGPVSSVRRGPFLFVVLNDRASMKQALVK 67

Query: 97  YGEDTSDR 104
            GE  SDR
Sbjct: 66  SGEFFSDR 43

>gi|8345671|gb|AZ175303.1|AZ175303 SP_0132_A1_A08_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=132 Col=15 Row=A.
          Length = 677

 Score = 32.7 bits (73), Expect = 0.85
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = -3

Query: 8   DLWAVVIFTAIFLLLVDL-VHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYSFYKLQN 66
           +L A  +F  + + L+   V RR +     PPGP   P +G   +     I  ++  L  
Sbjct: 276 ELSATSVFLGVVIFLISFWVVRRPK---NLPPGPWSLPIIGYNFKPGL--IHEAYVDLAK 112

Query: 67  RYGNVFSLQMAWKPVVVVNGLKAVRELLV 95
           +YG +FSL+      V++N  +++ E LV
Sbjct: 111 KYGPIFSLRRGSFVFVILNDRESITEALV 25

>gi|8311035|gb|AZ158432.1|AZ158432 SP_0060_B2_E08_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=60 Col=16 Row=J.
          Length = 436

 Score = 29.6 bits (65), Expect = 7.2
 Identities = 13/29 (44%), Positives = 18/29 (61%)
 Frame = +2

Query: 239 LPDKAFPKLNSFIALVNKMLIEHDLTWDP 267
           LP+K FP  N +  + NK+L+E  L W P
Sbjct: 62  LPEKMFPG*NLYRYMENKVLVEEWLVWFP 148

>gi|8371934|gb|AZ188755.1|AZ188755 SP_1012_B2_C04_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1012 Col=8 Row=F.
          Length = 548

 Score = 29.6 bits (65), Expect = 7.2
 Identities = 14/38 (36%), Positives = 20/38 (51%)
 Frame = +3

Query: 391 FIPKGTTLIPNLSSVLKDETVWEKPLRFYPEHFLDAQG 428
           F+ +GTTL P           WEK + F+P +FL  +G
Sbjct: 306 FLQRGTTLSPPRGKTPGFLGFWEKKIFFFPFYFLKKRG 419

>gi|8377872|gb|AZ194693.1|AZ194693 SP_1028_B2_A08_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1028 Col=16 Row=B.
          Length = 798

 Score = 29.3 bits (64), Expect = 9.4
 Identities = 13/28 (46%), Positives = 16/28 (56%)
 Frame = +1

Query: 437 MPFSAGRRSCLGEPLARMELFLFFTCLL 464
           +P  +GRR CLG  LA ME F  +   L
Sbjct: 154 LPLLSGRRDCLGMQLAMMETFCSYPSFL 237

>gi|8348276|gb|AZ175862.1|AZ175862 SP_0140_A1_C05_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=140 Col=9 Row=E.
          Length = 831

 Score = 43.9 bits (102), Expect = 4e-04
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = -3

Query: 175 VLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLL-RFDFFDPLLFSVVL 225
           + GAY MD I   +FG+NVDS  N +DPFV  AK+     DF  P +   +L
Sbjct: 568 LFGAYIMDTIGLCAFGLNVDSQKNKDDPFVLNAKRFFSSLDFTSPAMIISML 413

>gi|8398594|gb|AZ203676.1|AZ203676 SP_0084_A1_C06_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=84 Col=11 Row=E.
          Length = 730

 Score = 35.8 bits (81), Expect = 0.099
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = +2

Query: 303 FIFAGYETTSSTLSFTLHSLATHPDIQKK 331
           F  +G ETTS+ L+FT+  L  HPD+ KK
Sbjct: 176 FCISGQETTSNLLAFTILQLGRHPDVAKK 262

>gi|8375065|gb|AZ191886.1|AZ191886 SP_1020_A2_C11_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1020 Col=22 Row=E.
          Length = 740

 Score = 34.3 bits (77), Expect = 0.29
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = -1

Query: 112 GIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMF 146
           G    A+ + +D +WKR   +++PTFT  K+K +F
Sbjct: 467 GSFDNALFLLRDAQWKRVHDIMTPTFTGKKMKMVF 363

>gi|8341210|gb|AZ170842.1|AZ170842 SP_0117_B1_G01_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=117 Col=1 Row=N.
          Length = 552

 Score = 32.7 bits (73), Expect = 0.84
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +2

Query: 306 AGYETTSSTLSFTLHSLATHPDIQKK 331
           +G ETTS+ L+FT+  L  HPD+ K+
Sbjct: 149 SGQETTSNLLAFTILQLGRHPDVAKR 226

>gi|8341146|gb|AZ170778.1|AZ170778 SP_0117_A2_G01_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=117 Col=2 Row=M.
          Length = 503

 Score = 32.7 bits (73), Expect = 0.84
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +1
Same as above
Query: 306 AGYETTSSTLSFTLHSLATHPDIQKK 331
           +G ETTS+ L+FT+  L  HPD+ K+
Sbjct: 145 SGQETTSNLLAFTILQLGRHPDVAKR 222

>gi|8335730|gb|AZ165955.1|AZ165955 SP_0083_A2_G09_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=83 Col=18 Row=M.
          Length = 477

 Score = 30.4 bits (67), Expect = 4.2
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +3

Query: 268 RVDFLQLMMNSHNNSKDKVSHKALSD 293
           R DFLQLMMN+HN+ +     K + D
Sbjct: 255 RRDFLQLMMNAHNDDEHDSRSKVIKD 332

>gi|8336255|gb|AZ166211.1|AZ166211 SP_0083_B2_G09_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=83 Col=18 Row=N.
          Length = 476

 Score = 30.4 bits (67), Expect = 4.2
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +2
Same as AZ165955
Query: 268 RVDFLQLMMNSHNNSKDKVSHKALSD 293
           R DFLQLMMN+HN+ +     K + D
Sbjct: 254 RRDFLQLMMNAHNDDEHDSRSKVIKD 331

>gi|8314527|gb|AZ161847.1|AZ161847 SP_0070_B1_H12_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=70 Col=23 Row=P.
          Length = 416

 Score = 30.0 bits (66), Expect = 5.8
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = -1

Query: 456 FTAEARLQRRPFTYLPFGAGPRSCL 480
           FT   R++RRP   LPF  GP +CL
Sbjct: 350 FTFRGRVRRRPRQGLPFEPGPANCL 276


>gi|8395547|gb|AZ200647.1|AZ200647 SP_0144_B2_B04_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=144 Col=8 Row=D.
          Length = 603

 Score = 32.0 bits (71), Expect = 1.4
 Identities = 15/29 (51%), Positives = 17/29 (57%)
 Frame = -1
Like 7a1
Query: 57  RAKQRKHGHVFTCKLMGKYVHFITNSLSY 85
           RAK   H     C  + KY+HFI NSLSY
Sbjct: 555 RAKMLMHVESDRCHCIIKYIHFILNSLSY 469

>gi|8312956|gb|AZ160312.1|AZ160312 SP_0065_B2_F03_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=65 Col=6 Row=L.
          Length = 488

 Score = 30.4 bits (67), Expect = 4.1
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = -1
cyp8a
Query: 233 SVKNRLWKLLSPARLASRADRSSWL 257
           SVKN + K+LSPAR ASRA  S +L
Sbjct: 77  SVKNPVLKVLSPARRASRASSSIFL 3

>gi|8372722|gb|AZ189543.1|AZ189543 SP_1014_B1_D08_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1014 Col=15 Row=H.
          Length = 521

 Score = 31.6 bits (70), Expect = 1.9
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = -3
N-term
Query: 34  LPLVGSLPFLPRRGHMHANFFKLQEKYGPIYSLRLGTTTAVIVGHYQLAREVLVKKGK 91
           LP++G   F P  G +H  +  L +KYGPI+SL  G    VI+   +   + L  + K
Sbjct: 195 LPIIG-YNFKP--GLIHEAYVDLDKKYGPIFSLEXG*IVFVILNDRESITQALXSQCK 31

>gi|8288282|gb|AZ136379.1|AZ136379 SP_0170_B2_F11_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=170 Col=22 Row=L.
          Length = 948

 Score = 29.3 bits (64), Expect = 9.4
 Identities = 10/19 (52%), Positives = 16/19 (83%)
 Frame = +2
N-term 
Query: 21  KTPNAKFPRSLPFLPLVGS 39
           + P+A+FPR LP+ P++GS
Sbjct: 773 RPPSAQFPRKLPYTPVLGS 829

>gi|8357192|gb|AZ184817.1|AZ184817 SP_1003_B1_H10_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1003 Col=19 Row=P.
          Length = 753

 Score = 29.3 bits (64), Expect = 9.4
 Identities = 15/35 (42%), Positives = 20/35 (56%), Gaps = 2/35 (5%)
 Frame = -3
Possible N-term
Query: 32  PFLPLVGSLPFLPRRGHMH--ANFFKLQEKYGPIY 64
           P  PL GS PF P+RGH H    F++     GP++
Sbjct: 706 PSPPLGGSPPFSPQRGHPHFFGGFYQGIFSRGPLF 602

>gi|8422222|gb|AZ208993.1|AZ208993 SP_0138_A2_H02_T7A Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=138 Col=4 Row=O.
          Length = 764

 Score = 30.4 bits (67), Expect = 4.2
 Identities = 14/49 (28%), Positives = 31/49 (62%)
 Frame = -1
Searched with CYP19
Query: 232 NIFFKISWLYRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCMDFAT 280
           NI FK+S+L+R+Y R+ +D +    ++ E+   + +   +++D +D+ T
Sbjct: 560 NIAFKVSYLFREYYRNQRDDRRLHYLIRERLNDQFAMDLQVQDRVDYTT 414

>gi|8357927|gb|AZ185450.1|AZ185450 SP_1005_A2_H05_SP6 Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=1005 Col=10 Row=O.
          Length = 751

 Score = 31.2 bits (69), Expect = 2.2
 Identities = 11/19 (57%), Positives = 14/19 (72%)
 Frame = +3
Searched with CYP20
Query: 274 SLASCIITARLCTWTIHFL 292
           +LA C +T RLC W +HFL
Sbjct: 621 TLARCFLTLRLCFWPLHFL 677

>gi|8395245|gb|AZ200345.1|AZ200345 SP_0191_A2_A12_SP6E Strongylocentrotus purpuratus, 
purple sea
           urchin, sperm genomic BAC library Strongylocentrotus
           purpuratus genomic clone Plate=191 Col=24 Row=A.
          Length = 473

 Score = 55.5 bits (132), Expect = 1e-07
 Identities = 37/126 (29%), Positives = 57/126 (44%), Gaps = 2/126 (1%)
 Frame = -3
Searched with CYP1A1
Query: 164 EEHVSKEANYLVSKLQKVMAEVGHFDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVN 223
           E  ++ +A+ LV  ++K     G FDP   L  +V +VIC + FG++Y  D+     +  
Sbjct: 432 ESVIASQADILVEDIRKR----GTFDPLLCLQSNVCSVICGVVFGKQYGLDNPRFTDL-- 271

Query: 224 LSNEFGEVTGSGYPA--DFIPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGH 281
           L   +  +    Y A    +P L YLP  S   F    DK   F ++ I  H  T +   
Sbjct: 270 LETMYNALRAIEYAAVSSLVPGLHYLPGCSYQKFYACMDKLMRFFREEINAHDETLDPDS 91

Query: 282 IRDITD 287
            RD+ D
Sbjct: 90  PRDVID 73