64 sequence fragments from purple sea urchin + 3 complete sequences

Strongylocentrotus purpuratus

 

No mito clan seqs found yet.  Only 3 different CYP3 clan seqs.

Mostly CYP2 clan as in C. elegans.  The CYP4 like sequences are most like 4V5.

 

D. Nelson August 11, 2004

 

CYP51 clan

 

>AY496941 BG786122 CYP51

MANSVNIFESVGGVFGEMTLATMILVSTIFVLGIAWAFKSLLGP

QNKDVKLPPRLPTGIPFLGQAVAFNQSPIDFLEDAYEKYGDVFSFTMVGKTFTYLIGS

EASALLFNSKNENLNAEEVYSNLTVPVFGKGVAYDVPNPVFVEQKKMLKTGLNIQQFK

RHIPLIEEETREYFNRWGDSGEKNLFVALSELIILTASRCLHGKEIRSMLDEEVAQLY

ADLDGGFTHLAWLAPSWIPFPSFLRRDRAHRKIKQIFYKAIAKRRETGVENDMLQTLI

DSKYKSGRPLSDDEIAGMCIGLLLAGQHTSSTTSAWLGFFLARDKEVQDRCNAEQIKV

CGDASTEVSYDQLKDMQLLDHCVKEALRLRPPIMTMMRVAKSPLTYKDMTIPAGHQVC

VSPTVNQRLKDNWMPGPKEFNPDRFLDESKSNSEKFSYVPFGAGRHRCIGENFAYVQI

KTIWSVMLRIFEFELVDGYFPGINYQTMIHTPLNPIIRYKRRTESL*

 

CYP2 clan

 

>CD310809 32% to CYP1B1 CYP1 like seq in the CYP2 clan

    GVVTATLALWTIVRPKRF

67  PPGPRGLPIVGSIFSMNDSPEIVFGEWAKRYGDIFGFKAGERWMVVLNRQALIKEA 234

235 VLKQGVDFAGRPDFYSLEIFTDGFKDIAFSPYSETWKLHRKLAHTALRHFATGKPLQD 408

409 LISSVYPKVDKKLAMTEGQPIDPKVLINLIMYNVLAQMCFGRSYELEDPTVAQWMDT 579

580 NDDLNEKFGLGLAADMFSXARYIPTSGPRMIXELTXKLXGFLRLQVDETREHYD 741

 

>CD319179 CD290182 CD312632 42% to CD310809 51% to 1C1

505 KSSGDEAKPLPGPWGIPVLGNMLSLGRSAPHLSLTALAKKFGSIFQIRLGSRPVL 341

340 VLNGYEAIQKALIKQAVVFSGRPDLYTFELIKSGVKSGTSLSFGNYGESWKLHRKLAESS 161

160 LRHFTAGSQVKFVESVVSTEASELVQYFKSI 68

 

>CD306283 CD306762 4 aa diffs to CD310809 (alleles?) CYP1 like

    MIDLIGAGESGFGQFNALTITATL

    GVVTATLVLWTIVRPKRFPPGPRGLPIVGSIFSMNDSPEVVFG 234

235 EWAKRYGDIFGFKAGERWMVVLNRQALIKEAVLKQGVDFAGRPDFYSLEIFTDGFKDIA 411

412 FSPYSETWKLHRXLAHTALRHFATGKPLQDLISSVYPKVDKKVAMTEGQPIDPKVLINL 588

589 IMYNVLAQ 612

 

>AZ185855 34% to 1C1

ILQEANNLVNHFEAQNEKPFDPQCDLHIASLNILCNFVFGERYEHDNPEMREILDFSAEISKLLSPMHPVNAMPWLRHFP

 

>AZ186969 42% to CYP17

DLITWSKRYCTSLRLKPSTFFIPSSQVTSVMANFCQVHHNEDAWDQPEEFLPERFLNRPR 135

AT*RNLPSCASCPSVGKRRCLGANVAKADL

 

>BG785062 46% to 2X2 65% to CD306283 67% to CD310809

MIDLLGDSSLVQVNGLTITATLGVVAISLALWTMVRPRNFPPGPRGLPIVGSLFSLNDNLEKDFTGWIKQYGDIFGFKLGDTGWSS

 

>AZ193119 45% to 2Y2, 39% to AC149996.1

SKGIGFSNGEVWKEQRKFTHSVFRSLGVGKKSYEDTVSAEMKQLSSVIKEKKSSPFDPS TLFMQAVSNIICSIIFGTQYTYDDDAFKKV

 

>AC149996.1 CD312541, CD303995 AZ193978 CD306524 32% TO CYP2Z2 AND CYP2P seqs.

100399 MSTDFLTHNLSTLLTTGLTIILVVLFSLRRKNDSSKKLTH

       PPGPSGIPVLGNLLTVAFSKLPQHELINGWSKKYGDVFWFKIFGTGVVIINDKEVMQKTFQNTD

       VCDRAPFFASDYVLGRENN 100031 ()

98599 GIAFANGGSWKEQRKFFVSIFRKVDIGVSRLEDIVGGQVKNIVTQVKNLK 98450 (1)

97795 GEKFDPAIMVNMSIANIITRIITGVTYDWEDKAFQDIVAYSGK

      LFDISGPAGLFSLNPVFARLPLPVNFEIRRLCRT 97565

97564 IMDFIQVSIDEHRKNFDPNAPVKDFIGSYLKEMASADA 97451 (0)

96732 NNLKSFDDTNMIVSCFDALLGGWETVASTLRWTIYLLSKHPEAQGRMRQEIHDLVGD 96592

96591 ERFPTIADRQYLPLVEATIAECMRFIPAVPIHLPHVTSQDCNIGGFDVPKGSAVAANL 96418

96417 LHFAKSPMFWEDPEVFRPERFLDDAGNFMRGLEPVPFGYG 96298 ()

95966 KRQCPGELLARMEMFIFTTFLVQNFELKLP 95877

95875 AGIKDDLQGVLGLTWRPNHYFIEGHPTNANEE* 95777

 

>AC149996.1 second gene on same contig 34% to 2N10 Fugu

118097 MITELITTSYLTTTVLTCIVGYLVVQLLRRKRYKLPPGPKGWPIIGSYLTLTS 117939

117938 GKYELRDLLNMWAKEYGDLYMFSMFGSRFVILNSYDLVHEAFQSPDFNDRAPILPCNKAL 117759

117758 NRSNT 117744 ()

114398 GLISANEGHLWKEQRSFVTQYLRNVKQHNSNFEDLVAAEAAKLIKNFASQEGTFFN 114231

114230 PITDIDVTVSNVITGILTGKTYDYNDEEFVELTKRAQQVFEWMGPGSFFYHVPVLAYMPM 114051

114050 EINKMGDAAAKGMFDFLEKILKRHRQAYNPEDEPKDLIEAFLHEEANKKA 113901 ()

       NVDVGSFTHQCLKQVVWDLMLGGIDSVSTSLSWYFLFMAQYPDVQ

109823 AKVQAELDKVIGRDRLPSLSDRQNLPFTESTSVECYRFCRLINVQIPHRTRCDVKLGGYDI 109641

109640 PKGTNVGTNASWLSSSPSLWENSEEFVPDRFIDKETGLYNSKLEAGLVEFGV ()

109116 GRRVCPGEQLARTELFVIFTHILHRFTLRLPEGTPITRDGINGLTHHPKPYKITAAPRR* 108937

 

>AZ145256 92% to AC149996.1   second gene

KVQAELDKVIGRDRLPSLSDRQNLPFTESTSVECYRLCRLINVQIPHRTRCDVKLGGYDIPKGSNVGRNASWLSSSPSLWEXSKNSVPDRFIDKE

 

>AZ209557 8 aa diffs to AZ145256 90%

KVQAELDKVIGRDRLPSLSDRHNLPFKKSTSVECYRFCRLINVQIPHRTRCDVKLGGYDI 146

RRGTNVGTNASWLSSSPSLWE

 

>CD340707 52% to AC149996.1 second gene

452 PDRFLTEDGQXDRKREPIFFGTGRRVCPGEQLARTEIFLFITSILQRFTLSLAEGVPKDL 273

272 PCYHSITNRPDPYQIHAEKIV*

 

>CD309158 54% to CD311749 36% to CYP2K and CYP2P

MSLLTDYYGVALAILSLVLTLIWYLKNSSSWRYRNLPPGPLGLPILGILPYLDEKNPSVDVLRMSKRYGPI

GGFLGSHRAVFLNDYDTIKKTFAR

QNDVFSDRPRIAIFELYSDG

 

>CD311749   34% to 2AA1 ands CYP2Ks 54% to CD309158

    MGNRRHTTYILALISLVLATISLRIGGQGRRRRRGKL

180 PPGPMGWPIVGMLPYMDPENPAQSVWDMSKQYGSVFCGRLGSHLAVFINDYETIKE 347

348 AFSRKDDAFSDRPRITMFEVYTNGHGVATCYFDNHWKEQRRFAMKAFRHFGVG 506

    KPDSVFEEYLMRESKHLLHAYSRXHVAFNLKPFLDMGSLHIISSMTFGNRFSYTE

 

>CD289804 39% to CYP17A2 in CYP2 clan

ILADRDSVHSLVGIFSKVHTAEYEDGSERDILDHLVTSGRRYNENNNKKAGINDVMLRET

CFDYFGAGFETVSTTLEWCLLYVAAHPDTQP

 

>CD296461 55% to CD338576 41% to CYP2Y1

TVCDILEKGLFTKECEEHQKVFDPNRSPRDLIEAFLLELHKKQQEKVENNGEDMAPTGFN

HQQMLHFIADVFAAGTDTTAST

LKWSLIHLMKFEDEQRKIQEELDHVIGRDRMPSLEDKP

NLPYTQAFLAESLRYGCAGPL

VPHGAXEDTKLRGYDIPKGT RGPVIVANLYAVLYDPXVFP

EQXQFNPSRFID

 

>CD338576 51% to 2N11

337 TFTKENMYHAVADLFAAGTETTATTLKWALMYMLLHQDVQEKIHKELDDVVGRNRLPSLT 158

157 DRPNLPYTEATLLEIQRFATITPLGVPHAPVQDTVLNGYDIPEGTVILPNL 5

 

>CD330464 56% to CD306667 39% to CYP2Z2

75  LPTPGVKMVHRMRDELHRFVWDELDSHKKNFDPDNVRDVFDMLLLAQKEAADSGNQDAE 251

252 KLSDTHLVLTVSNMFAAGIQTTTETLYWALAFMVEHRDIQSRCQAEIDKAIGRKRVPVVD 431

432 DRGSLPYTEATLYEVMRY 485

 

>CD306667 45% to 2U1 89% to CD322241

DTHVFQTIADIFGAGIQTTVETLYWAMALLATYPEIQAKIRTEIDDVIGRDRLPTINDRG

KLAYTEASLYEVLRYSSIAPTALPHATTRDTEFGGYHIPKGT

VVMINTHSMHYDPQEWDQPDKFMPEHFMMGSGTIRDHPPSFLPX

GAGRRGCLGETRAKADLFLIFTW

 

>CD322241 CD337488 50% to 2U1 fugu 90% to CD318421

LVTYPESQAKIRAEIDDVIGRDRLPAINDRGKLPYTEATLYEVLRYSSILPIALP

HNTTRDTEFGGYHIPKGTVVMINTHSMHYDPQEWDQPDKFLPEHFMDGSGTVRDHPPSFL

PFGAGRRGCLGEAVAKADLFLIFTWFMQNYTFSRAPGXESEDILKMIPQTASGRILLSYE

IMINXRD*

 

>CD318421 51% to 2AD1 zebrafish 90% to CD322241

FGGYHIPKGTTVMINTHSMHYDPQEWDQPDKFLPEHFLDDGGTIREHPPSFLPFGA

GRRGCLGEAVAKADLFLIFTWFLQNYTFSKAPGKESEDILKMIPKTASGRLLLSYEIMIN

KRD*

 

>CD322083 CYP2 clan 46% to 2K10 57% to CD318421

SVFPSLTTVEALPYTRATLYEVMRYQLHMPIAVPHATTCDVNXRGYRIXKGAVVMFNTYS

MHYDPNAWESPTSFKPEHFLEDDGSVQQHPSSFLPFGAGRRSCLGEVAAKTDLIVIFTWL

LQNYCFKKVPGTETTSLLRVIENSAVGRNLDNYELIMEMRKMKLFTNWINPQC

 

>AZ204399 46% to CD322241 45% to 2U1

581 PEVRKKVQEELDTVIAPGELPSWRDRDRMPCTEATLMEIQRMANVTALTFPHKTTEDTE 405

404 LAGYSIPKDTHVFINLYSVHVDPTQWKEPEKFMPERFLSDEGGVIHNPALMPFSAG 237

 

>AZ167954 k-helix to perf 54% to 2U1 45% TO CD322241

21  QQVQNELDAVVGRGRQPDTSDRPNLPYCDATLMEIMRLRPVVPISLPHMTSADASLGPYT 200

201 IPKGTIIVPNLWAVHHDPKEWCDPHLFNPNRFLSADGQ 314

 

>CD297375 36% to 2P4

MASSGYVASSIFLGLQEISFRECIVFVTTCLFVRLLVSRGSFKKSTPPSNPPPP

SPTGLPFFGNLFSFQEDMRHLFRKWTNEIGGIFRLRIGPVMDIVVINDVEAVREAFVEKA

DAFSDRMVPPLLGEALXKRGSLIWPAGGGWKKPRKFXHSAF

 

>CD323632 62% to CD305862

MSSSVFYYGFTPFILAGLIAFLLSFILVRSGKKKYKNLPPRGPREWPVLGGLPSL

AGTDMPHVTIADMAKKYGPIFGMKMGSFYAVILSDYSLVRQAFAKSNDEFSDRPKITMIE

NLVQGKGLIVSYFGQMQTEHRRFSLSALRSLGMGKFKMEETIVDEARQLATIFA

 

>CD305862   38% to 2K10, 91% to CD305902

    MDFGISL

166 TTFLLGMVTFLVTLMMVWSRTGRTYANLPPKGPPEWPIIGSLLSLAGEHPPHQILANMA 342

343 KKYGPIFSMQMGSFYAVVLSDYSLIKQAFAKSGDDFSDRPKIAMIEHLAEGKGLISGYN 519

520 SPAQIEQRRFTFSALRSLGMGKFRM 594

 

>CD305902 91% to CD305862

MDFGISLTTFLLGMRTFLVTLMMVWTRTGRTYANLPPKGPPEWPIIGSLLSLSGYHPPHQ

ILAIMAKKYGPIFSMQMGSFYAVVLSDYSLIKQAFAKSGDDFSDRPEIAMIDHLAEGEGL

ISVYNILAQIEQRRFTFSALQ

 

>CD304889 CYP2 clan

239 MDFRWHQLTPYHLLVTALVGLVAAWFVKHLMRLPKNLPPGPTGLPLLGVLSKFIGTSD 412

413 PLALLSEWADRYGEITSFKLGPQLVVLLNSYDAVAEAFRHPDLQGKPRSRMTEEASGFG 589

590 PNAXLLIGAGTSWKEQRKFTLSVFR 664

 

>CD304828 CD339829 in the CYP2 Clan

TALPFFGNLFSLKPHDEFLDSLMGWSKEYGCIYSLYLGRKLILIV NGSEAVKELTCKTGLDFADRGESVAFLALNPNRLGLFDTLADEEWKRQRKFAYT

TLRGMGFGKVSLEPLIQTEARHVISYFKTKVGSLLDPSVAFGVTSSNIINKLVFDRRVDH

GSESGDELVRHVRNLMVGDEVAVLALFPSLWPVMRYADSKWMKLYDSWAHIESFFHQEIK

IREDRIDA

 

>CD297583 39% to 2Y2

    MSSVVNLLLSVIEYIGIVN

210 LLTTITSCLVTFWYIRMNYGASFHYRLPPGPPVIPYPFDFLMALFPSSNRFGRMIFLSKR 389

390 YGDITCLQLGRRMIIMISSPSLVKELIVKQADVTSNRSAPPFFTSVMDYKGGIIF 554

555 SDGEPWQEIRRFSLSALRNFGMGRKGIETRIQEEAXHLCNAFAHTPGRASTPCILP 722

 

>AZ195502 N-term 41% to 2P4

SVFLGVVIFLLCFWVVRRPKNLPPGPWSLPIIGYNFKPGLIHEAYVDLAKKYGPIFSLRRGSFVFVILNDRESITQALVKSGE 16

 

>AZ195501 C-term of AZ195502 54% to 2Z2

PLNQPNPSMRGANGITMNPQPYKICAIER*

 

>AZ189543 90% to AZ195502

MFELSATSVFLGVVINILCLWVVRRXKNLPPGPWS

LPIIGYNFKPGLIHEAYVDLDKKYGPIFSLEXG*IVFVILNDRESITQALXSQCK 31

 

>AZ175303 3 aa diffs to AZ195502 N-term

ELSATSVFLGVVIFLISFWVVRRPKNLPPGPWSLPIIGYNFKPGLIHEAYVDLAK 112

KYGPIFSLRRGSFVFVILNDRESITEALV

 

>AZ197884 75% to AZ195502 N-term

VRRPKNLPPGPWSLPIIGYRFDSGLIHEAFVDLARKYGPVSSVRRGPFLFVVLNDRASMKQALVKSGEFFSDR

 

>CD297323 66% to CD294563 50% to 2P4

GKRMCMGDQLAKMELFLFFTMIVQQIKFSLPPGADPLPMDGLLEIARKPKPFQVQV

SAWSD*

 

>CD294563 58% to 2U1 52% to CD295323

INILHIHHDPKIWGDPEVFRP*RFLTEDGTALIKHEAYIPFGVGRRVCLGEQLAKMELFL

FFTNILQQFKITMPPGVQPNYDFGHRALTTLGS*

 

>AZ179988 67% to 2U1 fugu 59% to CD294563

GTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQ

 

>CD295323

LWDEPEEFNPHRFLSEDGKTVIKPQDAFTVFGAGRRVCLGEQLARMEFFLFATTLMQRFR

FRLPEGESGDFGFEHCLGTIAPKNFKILAQER*

 

>AZ207850, AZ190486 AZ194693 4aa diffs to AZ194695, 48% to 2U1

LPLLSGRRDCLGMQLAMMETFLLFTNLFQQFEFKLPPDQPTHSMRGHPGLTMPPESYKICAIER

 

>AZ194695 4 aa diffs to AZ207850, AZ190486 (allele?)

LPLLSGRRDCLGMQLAMMETFLLFTNLSLQYECKLPPDQPTHSMRGHPGLTMPPESYKICAIER

 

>AZ211455 42% to 2N1

GEPWVDLRRFSLPALRSFGFGKQSLVPQINLEARYLSEEIRNLRGEPTDLLTTFSKATANIICQLLFSQRYEYSDGEMSRVLERMNETL

 

>AZ206702 93% to AZ159610

PFLLETPLYSEFRNLISSLKTLVADMVDEHGETLDDQHIRDIIDLYILEIRELIKRGDEIVFNETTVWRGIFDMISAGTGTTSTTLLWGILLMAAHPDAMEQV

 

>AZ159610 6 aa diffs to AZ206702 (allele?)

SLKTLVAYMVDEHGETLDDQHIRDIIDPYILEIREHKKRGDEIVFNETTVWPGIFDMIS 375

AGTGTTSTTLLWGILLMAAHPDAMEHV

 

>AZ204199 5 aa diffs to AZ206702

EHAKTLDDQHIRDIIDLYILEIREQKKRGDEIVFDETTVWRGIFDMISAGTGTTSTTLL 217

WGILLMAAHPDAMEQV

 

>AZ147012 N-term

LVILVLVLWMVKSFVSKRYGKQYRLPPGPSALPIIGNLPVFMTGKAPYRVMKNLADKYGSVFSLKIGTTPFVVLNDVDSIR

 

>AZ179521 39% to 2X2

FGVGKYSMEQRIINEAKVLCETIENNQERSFNPKGCITHSVSSIICGITFGQR 407

 

>AZ200345 32% to 2Y1

ESVIASQADILVEDIRKRGTFDPLLCLQSNVCSVICGVVFGKQYGLDNPRFTDLLETMYNALRAIEYAAVSSLVPGLHYLPGCSYQKFYACMDKLMRFFREEINAHDETLDPDS 91

 

CYP3 clan

 

>CD305284 41% to CYP5A1 fugu (N-term)

MEVELMGISMSLTWLLAMITLGFSVLYVAYECWSRTYWWRRGVPYEPSLPIIGNP

LFTSKIPENFVEWNKKYGKVYGTYSFRDPVLVVGDPEML

RHLLVKSFNSFHNRVSFPQIPEELAGMVSLLEGERWKEVRNVLTPSFSGA

 

>CD304823 35% to 5A1

YDIWCRRYWIRHGISSPPSQPVLGNTYEW

GERVYNFNRPILVISDLDA

ARNILVKDFHHFYNRLNAPLANRPMDKALFFLKDARWKAVRNISSPTFSAS

KMKLMSTLV

NEKADRLVENIGREQQKHGFVECRELYGSYIMDSTTRCAFGLDVDSQGDPEHPFVAHAKK

TFQVXXCLQPSDCACGTFPLAVPHISLL

 

>AZ191886 C-helix 50% to 5A1

GSFDNALFLLRDAQWKRVHDIMTPTFTGKKMKMVF

 

>AZ175862 51% to CYP5A fugu

LFGAYIMDTIGLCAFGLNVDSQKNKDDPFVLNAKRFFSSLDFTSPAMIISML 413

 

>CD291340 CD319443 50% to 3A27 trout (C-term)

RGGSKMKDFLQLMLNAAQENKSEKEKPQDEKVEGDLHALIEDQDNKSYFDLKKSKKTTLT

KDEIYGQAIIFFLAGYATIHTTLGFVT

YCLATNPEVQDKLIEEIDNETPTRDDVGYNSIAKMSYLDNVVCEILRLYPASVLVERQCNETHVCN

GITIPKDSQVMFPVFAIHRDPALWPDPEKFDPERFTKE

NREGRHPLAWMPFGAGPRNCIGMRFALMEIKMATVRLLQK

 

>CD304734 46% to 3A49 fugu 51% to CD291340

    LTFGLHVIPADTLDFFRDVNKKTIALRKSSSSGPN ???

    SKRVDFLQLLLDA

161 QKQENIDKESKPEEEEEEDDDDIHADLDKHHDVQYHSRGLGKKATLTDNEVFAQGLIF 334

335 FTAGSETTTTLLGFIAYSLATNPEAQEKLIDEIDRVTPSRDSVGYKSVATMPYLDQVVCE 514

515 TLXIFP 532

 

>CD295691 70% to CD304734, 43% to CD291340

ARVRSDSSLGRLMANFRISMLIPAEVLDFFNDVTKKTINLRKEAVAGSNFKRVDFLQLLL

DAQKQETVDKAVDHVEDDDENDIHDDLDKHHDVHYHTKTLGKRAPLTDEEVFAQVLIFFT

AGAETTTTLLGFIFYALSMNPDIQEKLISEVDEVTPSRDSVGYSSIATMPYLDQVVCETL

XLYPPAGISNRMXYETFVHXGLMIEKGN

 

CYP4 clan (CYP4V5 like)

 

>CD296197 54% to 4V7 N-term AZ191715 AZ198827

MEYGIVLPIILILVSVVVTFLLAKAIRIFVLISRFDGPPALP

LVGNAHEFKSDQREFFVDMTTLMEEYRARSGGLLRMWLGPVPSLTLYKAKHVEVILNNSR

HIKKGYLYKFLEPWLGLGLLTSWGQKWFHRRKMLTPTFHFS

ILQSFMDVFNEQSMILVKKLEKFAEKSETVNIFPLVAYCVLDIIC

 

>BG786093 57% to 4V5 like frag, 45% to 39 like seq 180 Ciona, like CYP26B

DSADLVHDVASLATTHWHGVISVPMNWSVSYWSSSCKRAVEAKDKLLERI

RDRLASQTDEGSFLTRAREAGFKNHAELEQHILPFVSALVPKAIASLLASFTLALCSENQ

EDMQEKARESSDYLDWCLLETERLWPPVLGGRRLVREDFVLDGYKVPKGYAVIYVSSIAH

RDPNVFKNPNSFDPTRWANKRTEKEKLLFCYGDGPRCCVGTFLMKNLIKKVSQYLVGHYN

WTLXDQEEDLDYN

 

>CD335085 short piece like CYP2 or CYP4V

ETLRGYPGVPANNRGWGKDVTIGGYHIPKGS

HDGVSYVRGRD

PEIYPEPDTFLPXR

 

>CD311709  56% to Cs4v5b 41% to CD291340

VQTRLHEELDEVFG

XXXXXXXXXXX

LQKLQYLNCVSKETLRLCPSVPMIGRDLEEDC

XXXXXX

VPKGTLVVLGIYALHRDPEQFPDPEKFDPDRFLLENSTKRHPYAYVPFSAGPRNCIGQKFAM

X

EDKVILANLMRKFSV

 

>AZ147906, AZ176297 75% to  CD311709 64% to 4V5

PNSERFDPDRFLPVNAEERHPYAYVPFSAGPRNCIGK

 

>CD320455 41% to CYP46 fugu 38% to 4V5

HASEPPVSGASRELASDVQSCGYVIPKGASVLFLSYLTSRLEEYFDDPLLFNPDRFIPTDETPRHFFAYFPFAIGQRNCIGQQLALIESKVILAKLLQSFDFRLEQSQRHIIVSQVTNKP

IDGCKNYISLRD*

 

>AZ198877 62% to CD320455

GILVCFFAWFGFPMGPRNCLG

 

>AZ174957 57% to 4V5 56% to CD320455

FPITTRPRHLYAYFPFSMGQRSCIGQQFALVSISIIFALS

 

>AZ199572 37% to 4V5

P*VWSDDHMPFRPSRXDGQNVEGGDPFVSIPFSAGARNCIAQQFALQEIQVAAIRIYDKFGFTLVRDSTPVFRIVSVPEDXILLGIHPRRET*

 

>AZ203676 AZ170842 AZ170778 I-helix 58% to CYP46

FCISGQETTSNLLAFTILQLGRHPDVAKK 262