Revised Dec. 12, 2009, some names modified June 6, 2013

 

Many partial sequences have been revised and completed.

This file has 90 P450 sequences including 3 alleles.

 

D. Nelson

 

There is a FASTA format version of these sequences:

Silkworm FASTA file

 

The older page can still be accessed to see changes that have occurred.

The old page has many ESTs and other accession numbers and some annotation.

 

Old Silkworm Page

 

>CYP4G22 Bombyx mori BAAB01118673.1 BAAB01085960.1 84% to 4G20

MSYTNAENVVPTSTFSAINLFYVLLVPAVILWYAYWRMSRRRLYELADKLNGPPGLPLLGNALEFVGGSA

DIFRNIVQKSADYDHESVVKIWIGPRLLVFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLIST

GQKWRSHRKLIAPTFHLNVLKSFIDLFNANSRAVVDKLKKEASNFDCHDYMSECTVEILL

ETAMGVSKSTQDQSGFEYAMAVMKMCDILHLRHTKIWLRPDLLFKFTDYAKNQTKLLDIIHGLTKK

VIKRKKEEFASGKKPSNLNETATTSEPSTGKLTSVEGLSFGQSSGLKDDLDVDDDVGQK

KRLAFLDLLLESSQSGVAISDEEIKEQVDTIMFE

GHDTTAAGSSFFLSMMGIHQDIQDKVIEELDQIFGDSDRPVTFQDTLEMKYLERCLMET

LRLYPPVPIIARQVNQEITL

SNGKKIPAGTTLVIATYKLHRRPDVYPNPNKFDPDNFLPERSANRHYYAFVPFSAGPRSCV

GRKYAMLKLKVILSTILRNFRVISDLKESDFKLQADIILKRAEGFQVRLQPRKRMAKA*

 

>CYP4G23 Bombyx mori

MTSLVDETEGYHVNSRVIFYPLLGLTTAIWILYRWQQNSHMHKLAELLPGPASIPIFGNALTLMRKNPHE

LVNLALGYAQTFGNVIRVWLGSKLIVFLVDADDIEIILNSHVHIDKATEYRFFKPWLGEGLLISS

GPKWRSHRKMIAPTFHINILKSFVGIFNQNSNNVVEKLKSEVGKTFDVHDYMSGTTVDILL

ETAMGISRKTQDESGFDYAMAVMK

MCDIIHQRHYKFWMRSEIVFKLTSFFKQQTKLLGIIHGLTNK

VIKNKKETYLENKAKGIIPPTLEEFTHHSGEILANNAKTLSDTVFKGYRDDLDFNDENDV

GEKKRLAFWDLMIESSQNGTNKISDHEIKEEVDTIMFE

GHDTTAAGSSFVLCLLGIHQDVQARVYDELYQIFGDSDRPATFADTLEMKYL

ERVILESLRLYPPVPVIARKLNRDVTI

STKNYVIPAGTTVVIGTFMLHRQPKYYKDPEVFNPDNFLPENTQNRHYYSYIPFSAGPRSCV

GRKYALLKLKILLSTILRNFRTISEIPEKEFKLQGDIILKRAEGFQMKVEPRKRVPTNVAR*

 

>CYP4G24 Bombyx mori

MSSLLNYNFEFDVPPIFHTLLLAIMIMWM

LHRWQQSSRLFRLGNKLPGPMALPLVGNSLLILGKKAEGW = BAAB01031491.1

VKYALDYSEKYG

TVVRAWAGPKLVVFLTDANDVEVILNSQIHIDKSPEYRFFKPWLGEGLLISSG = BAAB01016193.1

XKWRSHRKMIAPTFHINILKSFMGVFNENSKSVVKKLRSEVGKTFDVHDYMSCVTVDILL

ETAMGITKTTQDAASFDYAMAVMK

MCNIIHQRHYKVWLHFDAIFKLTSLFKKQRELLKTIHGLTNK

VIKKKKFMYLQNKEKGIIPPTIEELTKIKDTNDSIMEDSAKTLSDTVFKGYRDDLDFNDEQDV†

GEKKRLAFLDLMIESAQNHTCNISDHEIKEEVDTIMFE

GHDTTAAGSSFVLCLLGIHQEIQSKV

YDELFEIFGDSDRLVTFADTLQMKYLERVILESLRLYPPVPAIARKLTRDVQI

VTNNYIIPAGSTVVIGTFKIHRDPKYHKNPNVFNPDNFLPENTQNRHYYSYIPFSAGPRSCV

GRKYALLKLKVLLSTILRNYKTTSEISEDQFVLQADIILKRYDGFKIRIEPRNKNHSNTV*

 

>CYP4L6 Bombyx mori

MYLILLICLLVLVLTVSWWSMLNRICKSNVPGPFPLPIIGNAHQFVVRST

EFLGLLKSFTDKYGDVFRVHFFSYPYVLISHPKYAE

ALVSSADLITKGRSYSFLKAWLGEGLLTAS

GPRWRLHRKFLTPAFHFNILQNFLPVFCKKSEILRDKIRRLADGQPIDLFPITALAALDNVAESIM GVSVNAQQNSESEYVRAIEX

LSQITTLRMQIPLLGEDFIFNLTSYKKKQNIALEVVHGQTKKVIEARRCELEKNNKTNISGTNE

IGIKNKHAFLDLLLLAEIDGKL

MDEQSVREEVDTFMLEGHDTTTSGI

LVYTLFGLSKHPDIQEKWYEEQLTIFGEEMDRTPAY

NELAQMKVLEWVIKESLRMYPSVP

LIERWITKDAE

VGGLKLSKGTSVVLNIFQMHRNPEVFEKPLEFIPERFDSLEHKNPFSWLAFSAGPRNCI

GQKFAMMEMKVTLSTLVRNFKLVPVDIEPILCADLILRSQNGVKVGFLPRTQSNSKT

 

>CYP4M5 Bombyx mori EST BP125511 BAAB01099467.1 BAAB01097680.1 BAAB01039373.1

MFVYLIFIASFFLLIHLAFNY

NSKAVMMNKVPGPKLSFILGNAPEIMMLSSVELMKLARKFASRWDGIYRIWAFPLSIINIYNPDDVEVIVSTTKHN

EKSSVYKFLKPWLGDGLLISK

GEKWQQRRKILTPAFHFNILRQFSVIIEENSQRLVESLEKCIGKPIDIVPVVSEYTLNSIC

ETSMGTQLSDKTEDAWKAYKDAIYELGPYFFQRFTRVYLYFDIIFYLTSLWRKMKKPLKSLHG FTSTVIKERKIYVEQNGVKF

GEDVNDDDLYIYKKRRKTAMLDLLIAAQKDGEIDDHGIQEEVDTFMFE

EHDTTASGLTFCFMLLANHRAVQDKIVEEINYIMGDSTRRANLEDLSKMKYLECCIKESLRLYPPVHFISRNLNEPV

VLSNYEIPAGSFCHIHIFDLHRRADIYEDPLVYDPDRFSQENSKGRHPYAYIPFSAGPRNCI

GQKFAMIEMKSAVAEVLRKYELVPVTRPSEIELIADIILRNSGPVEITFNKRTK

 

>CYP4M9 Bombyx mori BAAB01103156.1 BAAB01142776.1 BAAB01178932.1

MWMYFILILLLLLTIHFLLNYNYRARLLRRIPGPRGYFIVGNALDVILSPAELFASTRK

NAAQWPNLNRFWSFGIGALNIYGPDEIEAIISSTQHITKSPVYNFLSDWLRDGLLLST

GTKWQKRRKILTPAFHFNILKQFCVILEENSQRFTENLKDTEGKSINVVPAISEYTLHSII

ETAMRTQLGSETSEAGRSYKNAICELGNQFVHRLARLPLHNNFIYNLYTLGKQNKH

LNIVHSFTKKVIKDRRQYIRGNGGNNFDDEKDTQADEHSIYFNKKKTAMLDLLLKAERDGL

IDEIGVQEEIDTFMFE

GHDTTATGLTYCIMLIANHKSIQVGALRKYID

GESTRAADIEDLSKMRYLERCIKESLRLYPPVPSMGRILSEEI

VLDGYTVPAGTYCHIQIFDLHRREDLFKDPLVFDPDRFLPHNTEGRHPYAYIPFSAGPRNCI

GQKFAILEMKSLLSAVLRRYNLYPITKPEDLKFVLDLVLRTTEPVHVRFVKRNKV*

 

>CYP4S5 Bombyx mori 66% to CYP4S4 from the moth Mamestra brassicae

MIWAVVLLIIFIFLIWKALEDEENPLDSLPGPERKPIIGATMRFVNLNT†

GEMFIKLREYHAMYGTRYVVKIFKRRILHLSNERDVE†

VVLSHSKNIKKSKPYTFLSPWLGSDLLLST

GFKWHSRRKILTPTFHFNILKSFLEIIKDKSCDLVKRLEEYRGEEVDLMPVISDFTLFTIC

ETAMGTQLDSDKSAETSEYKMAILQIGSLLLDRLTKVWLHNDFIFRQFTVGRKFQKCLKQVHSFAHN

VIVERKRQRASGRDPTVVAEDVFG

RKKRLAMLDLLLEAEEKNEIDFEGIMDEVNTFMFE

GHDTTAVALTFSLMLVAEDDQVQ

DRIYKELQGIFGDSDRRPTISDVAEMKYLEAVVKETLRLYPSVPFIAREITEDFML

DDLKIKKGSEVAVHIYDLHRRKELFSDPEKFLPDRFLNGELKHPYSFVPFSAGPRNCI

GQRFATLEMKCVLSEICRSFRLEPRTKGWRPTLVAEMLLRPNEPIHVKFIKRKQS*

 

>CYP4S6 Bombyx mori 94% to CYP4S5

MIWTVVVLIIFIFLIWKALEDEENPLDSLPGPERKPIIGAALRFVNLNT

REMFIKLREYHAMYGTRFVVKIFKRRVLHLSNEKDAE†

VVLSHSKNIKKSKGYTFLSPWLGSGLLLST†

GFKWHSRRKILTPTFHFNILKSFLEIIKDKSCDLVKRLEEYRGEEVDLMPVISDFTLYTIC

ETAMGTQLDSDKSAETKEYKMAILQIASLLLNRLTKVWLHNDLIFDQLTVGRKFQK

CLKQVHSFAHNVIVERKRQRASGRDYSVVAEDVFGRKKRLAMLDLLLEAEEKNEIDFEGI

MDEVNTFMFE

GHDTTAVALTFSLMLVAEDDQVQ

DRIYKELQGIFGDSDRRPTISDVAEMKYLEAVVKETLRLYPSVPFIAREITEDFML

DDLNIKKGSEVVVHIYDLHRRKELFADPEKFQPDRFLNGELKHPYSFVPFSAGPRNCI

GQRFAMLEMKCVLSEICRSFRLEPRTKGWRPTLVAEMLLRPNEPIHVKFIKRKQS*

 

>CYP4AU2 Bombyx mori seq gap before I-helix includes a small exon

MIILLLLFFVASLYWLYWTNKSKRMNK

MTASLPVPPTLPILGNATLFIGDTQKILKSLEDIADIAIKHKGSAKLWLG

PKLYVAIGDPEDAQVVLENCLDKDVVYRFLRPWLGHGLFVAPVCLWKSHR

KVLLPVFHNKVVEQYLQMISVQADILVERLNEKANKGEFDVLKYITACTL

DIVFETAMGERMDVQRSPDTPYLRARHTVMTILNMRFFKVWLQPDCIFNL

TSYSKQQKDNIDLTHKFTDEV

XXXXXXXXXXXXXXXXXXXXXXXXX

GKVRPVLDMLFGREIEFTDEQLREHIDSITIAGNDTTALVIAYTLVLLGIHQNVQEKV

YLEQRTIFGDSKRGADKVDVAQMQYLERVLKESMRLYTVVPIIARNVHKD

TYLPRCGVTLPAGIGAVVGPFAIHRSKSVWGPDADEFDPDRFLPERSLNR

HPAAFLPFSHGSRNCIGRNFGMLIMKSIVSTISRSYRIEADELGPLKIEM

LLFPIRGHQIRISRRETLA

 

>CYP4AX1 Bombyx mori

MWFSLVVVAVIYALWKLFYKEDDPIDSLPGPTKLPIIGNMLDMFNMTP

GEKFKYERQLSKTYKQRYMQKIFYRRIVYVHHPDDVE†

VVLSHSKNITKNVNYDFLKPWLGTGLLLST

GSKWFKRRKILTSAFHFDILKDFASLFEEKSRRLVDQLRANNGEPISLLPVMSNYTLFTLC

ETALGTKLDTDRSVAAAEYKDAISKTAQISIYRLPRIWLYIDAIFNRTSAGREFAKNVDIIHSFADN

VIVQRKEQRLNSLDKGLVERDEFNRKKRTALLDLLLEAEAKREIDLEGIREEVNTFMFA†

GHDTTGTALTFSLMLLSDHEEAQ

ERILEEYNEVMRGKETPTLSEFAEMKYLDAVIKETLRLYPNPHRVGRVLTEDITL

GGVPIKAGTEIGVQIIDLHHREDFFPEPEKFRPERFLRGEIQHPYSFVPFSAGPRNCL

GQKF

AMLEIKSVLTHICNNFKLVPMKRNWRVETVSDIVLKPAEPIYIKFVPR*

 

>CYP4AX2 Bombyx mori

MWFSLLVVAVIYALWKLFYKEDDPIDSLPGPAKLPIIGNMLDMFNMTP

GEKFKYERQLSKTYKQRYMQKVFYRRIVYLHHPDDVE

VVLSHSKNITKNVIYDFLKPWLGTGLLLST

GSKWYKRRKILTSAFHFDILKDFASLFEERSRRLVDQLRANNGEAISILPVMNNFTLLTIC

ETALGTKLDTDRSVNTAAYKDAISKIGQICIYRLSRIWLYIDAIFNRTSAGREFAKNVDIIHSFADN

VIVQRKEQRLNSLDKGLVERDEFNRKKRTVLLDLLLEAEAKREIDLEGIREEVNTFMFA

ghdttgtaltfslmllsdheeaq

ERILEEYNEVMRGKETPTLSEFAEMKYLDAVIKETLRLYPNPHRIGRVLTEDITL

GGVPMRAGTEVCVLTIDLHYREDFFPEPEKFRPERFLRGEIQHPYSFVPFSAGPRNCL

GQKFAMLEIKSVLTHICNNFKLVPMKRNWRVETVSDIVLKPAEPIYIKFVPR*

 

>CYP6B29 Bombyx mori BAAB01105883.1 BAAB01064450.1

MAIIYILSASVVLPLLLYLYFTRHFNYWKKRNVPGPKPVPLFGNLMELALRKKNIGIVFKELYENFPNEK

VVGIYRMTTPCLLIRDLDVIKNIMIKDFDVFVDRGVELS*SGLGANLFHADGDTWRV

LRNRFTPLFTSGKLKN

MLHLMIERANKYIEHVEMLCDHQPEQDIHTLVQKYTMATIAACAFGLDIDTTDPNKDQLK

TLEEIDRLSLTANFAFELDMMYPGVLKKLNSTLFPGFVSRFFKDVVKTIIEQRNGKPTDR

NDFMDLILALRQLGDIQATKRNSEDKEYSIELTDELIEAQAFVFYIAGYETSATTMTFML

YQLALNPDIQDKVIAEIDQGLKESKGEVTYEMLQNLTYFEKAFNETLRMYSIVEPLQRNA

KIDYKIPDTDIVIEKGTTVLFSPLGIHHDEKYYPNPSKFDPERFSPANISARHPCAHIPF

GTGPRN

GMRFAKIQSRVCMVKMFSKFRFELAKNTPRNLDIDPTRLLLGPKGGIPLKIVRR*

 

>CYP6AB4 Bombyx mori 64% TO 6AB1

MLTAAIFVIIVALVYLYSTRTFRYWEKRGIKHDKPVPFFGTDSEGYLLRKSMTQTAVDAY

LKYPNEKVIGFFRSSRPELIIRDPDIIKRILTTDFAYFYPRGLNPHKKVIEPLMRNLFFA

DGDLWRLLRQRMTPAFTSGKLRAMFPLVVERAERLQSRTLEIASQPLDARELMARYTTDF

IGACGFGLDADSLNDEDSAFRKLGAAIFNITVQQAIVAALKEIFPGIFKHFKYSSKYETD

FMSLVSSILKQRNYKPSGRNDFIDLLLECRMKGEIVVESIEKMKPDGTSEVVRMELTEQL

LAAQVFIFFAAGFETSSSATSFTLHQLAFHPEIQEKVQKELDQVLAKYNNKLCYDAIKEM

RYLESAFKEAMRMFPSLGFLIRECARQYTFPELNLTIDEGVGIIIPLQALHNDPEYFDSP

NEFRPERFMPSEYNHNKTKFVYLPFGDGPRGCI

GARLGLMQSLAGLAAVLSKFTVKPAPSTKRHPVVEPKSSVVQSIKDGLPLLFIERTKS*

 

>CYP6AB5 Bombyx mori BAAB01021567.1 BAAB01206787.1 58% to 6AB3

MFFYLLIVILITLYYYGVR

TFDYWKKKGVNHDPPLPFFGNNLRQFMQKASMAMMATETYKKYPEEKVVGFYRGTSPELV

VRDPELIKRILVTDFSSFYARGFNPHKKVIEPLLKNLFFADGDLWRLIRQRFTPAFSTAK

LKAMFHIITERAEKLQMIAENEAYENFCDVRELMARYTTDFIGACGFGLNIDSLSDENSQ

FRKLGKRIFKRDLSDAVRAALKLMFPELCKHLTFLTPELEKSMTYLVQNVIREKNYKPSG

RNDFIDLMLELKQKGKLLGESIEAKNANGTPKQVELEFDDLLMTAQVFVFFGAGFETSST

ASSYTLHQLAFNPECQEKTQKEIDEVLSKHNNKITYDAIKEMTYLEMAFNEAMRLYPSVG

YLVRMCTVPEYTFPEINLTINEDVKLMIPIQAIQKDEKYFKDPERFHPERFSSGAKANLK

PYTFLPFGEGPRACV

GERLGQMLSMAGLVAVLQKYTVEPVEISLRDPIPDPTTTVSEGFVHGLPLKLRRRERRI*

 

>CYP6AB8 Bombyx mori AADK01010774.1,

MLTAAIFVIIVALVYLYSTRTFRYWEKRGIKHDKPVPFFGTDSEGYLLRKSMTQTAVDAY

LKYPNEKVVGFFRSSRPELIIRDPDIIKQILTTDFAYFYPRGLKPHKKVIQPLMRNLFFA

DGDLWRLLRQR

MTPAFTSGKLRAMFPLVVERAERLQARSLKIASQPLDARELMARYTTDFI

GACGFGLDADSLNDEDSAFRKLGAAIFNITVQRAIVAVLKQIFPRLFKHF

KYSSKYETDFVSLVSSILKQRNYKPSGRNDFIDLLLECKMKGEIVVESIE

KMKPDGTPEIIRMVLTEQLLAAQVFVFFAAGFETSSSATSFTLHQLAFHP

EIQEKVQKELDQVLAKYNNKLCYDAIKEMRYLESAFKEAMRMFPSLGFLI

RECARQYTFPELNLTIDEGVGIIIPLQALHNDPEYFDSPNEFRPERFMPS

EYNHNKTKFVYLPFGDGPRRCIGARLGLMQSLAGLAAVLSKFTVKPAPST

KRHPVVEPKSSVVQSIKDGLPLLFIERTKS

 

>CYP6AE2 Bombyx mori

MSVSALVFAAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFGNYMRYITLQSFLGDVM

QKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYFNSRENRDYNHKEVFTQNL

FFANGDRWKVIRQNLTPLFSSSKMKNMFYLVEKCNHSLEDMLDKETKDLQSIEIRSAMIR

YTLDSICSSAFGIETNTLSEGAENSPFPSMGSTIFSSSITRGLKLIGRSMWPGIFYKLGL

RCFPTEIDDFFERLLTEVFENRGYKPTNRNDFVDLILSLKQNDYLTGDG

LVPKNVDAKKVTVKVDDALLIAQCVVFFGAGFETSATTLSAALYELAKNPEAQRRAQEEV

DELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVLPNITREAVTDYTFPDGLRIDKGMR

VHVPVYAIHRNPDNFPDPEEFRPERHLGDAKNDIKQFTYFPFGEGPRICI

GMRFGKMQTIAGMVTCLKKYNFELADGMSKTVPFRSTTVLTQPSTGLFLKATPRDGWKQRIFAR*

 

>CYP6AE3P Bombyx mori

MSVSALVFSAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFGNYMRYITLQSFLGDVM

QKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYFNSRENRDYNHKEVFTQNL

FFANGDRWKVIRQNLTPLFSSSKMKNMFYLVEKCNHSLEDMLDKETKDLQSIEIRSAMIR

YTLDSICSSAFGIESNTLREGGENSPFANMGSIVFSSSITRGLKWISRSMWPGIFYKLGL

QCFPAEIDGFFER

LLTEVFENRGYKPTNRNDFVDLILSLKQNDYLTGDGLVPKNVDAKKVTVKVDDALLIAQC

VVFFGAGFETSATTLSAALYELAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEA

CMNEAMRLYPXXXXXTRETVADYTFPDGLRIDKGMRVHVPVYAIHRNPDNFPDPEEFRPE

RHLGDAKNDIKQFTFFPFGEGPRICI

GMRFGKMQTIAGLITCLKKFNFELADGMPRTLAFRSTTLLTQPSTGLFLKATPRDGWEQRIFAR*

 

>CYP6AE4 Bombyx mori

MLFLTLLFILSVCVYFIY

YRVCNRRFDYWRKKNVSFVPPVPILGNYSGYILLKESISKVVHNLCKLFP

NDPYIGAFFGTEPTLIVKDPEFIKLVLTKDFYHFNGREGSKYTHNEVVTQNIFFTYGDRW

KVIRQNLTPLFSSLKMRNMFHIIEKCSGIFENLLDEESLAPEVEMKSLMSRFTMDCIGGC

AFGVDTKAMQEPKDNIFTTMGYLFFESTTYRGIKNVLRAIWPGIFYGLGLKVFPTDLNEF

FSKLLVGIFEARDYKPSSRNDFVDLLLNLKKNRHIVGDRLQKTTTGDEGADSKFELEVDD

GLLVGQCLAFFSAGFETTSTISNFTLYELAKNPDVQKRAQKEVDEYIKKHNNKLDYDCVK

ELPFVEACIDEALRLYPVLGVLTREVMEQYTFPTGLTLDKGDRVHIPVYHLQRDPEYFPE

PELFKPERFYGEEKKNIRPFTYLPFGDGPRICI

 

>CYP6AE5 Bombyx mori

MILTIIFILSLCVYILYRISTRKFDYWQKKNVNYVQPTPFLGNYSGYILLKENLL

DVVYNLSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLTKDFFYFTGKECFEYTHKEVIT

QGIIFTYGDRWKVIRQNVTPLFSSSKMRSMFRIIEHCSGVFENLLD EESLAPEVEMKSLM

SRFTMDCIGGCVFGVDINAMQEPKDNIFTTMGCLFLETTTSRGIKNVVKAIWPEIFYGLG

FKVFPTDIHKFFSKLLVRIFEARDYKPSERTDFVDLLLNLKKNRHIVGDRLQKIKTGDEG

ADSKFELEVDDGLLVGQCLAFFSTGFETSSTISNFTLYELAKNPDVQKRAQKEVDEYIKK

HNNKLDYDCVKELPFVEACIDEALRLYPLFGVISRQTGERYTFPTGLTLDKGDRVHIPVY

HLQRDPEYFPEPELFKPERFYGEEKKNIRPFTYLPFGDGPRICI

11263† GMRFAKMQILAGLVTILKKYTVQLADGMPETIDIEPKAIVTQPAISLRLKFVPRNDLQKRIFA* 11069

 

>CYP6AE6P Bombyx mori

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNYSGYILLKENLLDVVHN

LSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHGREGSKYTHNEVITQGIFF

TYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLLD

EESLAPEVEMRSVMSRFT

MDCIGGCVFGVDINAMQEPKDNIFTTMGCLFLETTTSRGIKNVVKAIWPEIFYGLGFKVF

PTDIHKFFSKLLVRIFEARDYKPSERTDFVDLLLNLKKNRHIVGDRLQKIKTGDEGADSK

LELEVNDDLLVAQCVSFFIAGFETSSNSLTFTLYELAKNPDVQKRAQKEVDEYIKKHNNK

LDYDCVKELPFVEACIDEALRLYPLFGVISR

DKRERYTFPTGLTLDKGDRVHIPVYHLHHDPEYFPEPELFN

PERFYGEEKKNIRPFTYLPFGAGPRVCI

GERFAKMQMLAGLVPILKRYTVRLAEGMPETINFEPKAIASQPNIGVRLNLLPRNN

 

>CYP6AE7 Bombyx mori (old CYP6AEdd)

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNYSGYILLKENLLDVVHN

LSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHGREGSKYTHNEVITQGIFF

TYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLLDEESLAPEVEMRSVMSRFTM

DCIGGCAFGVDTNAMQEPKDNIFKTMGYLFFESTTHRGIKNVFKAIWPEIFYGLGFKVFP

TDLNEFFSKLLVGIFEARDYKPSSQNVFINLLLNLKKNRHIVGDRLLKIKTGNVRAESKI

KLEVDDELLVSQCVAFFIAGFETSSTISSFTLYELAKNPDVQKRAQKEVDEYIKKHNNKL

DYDCVKELPFVEACIDEALRLYPVLGVLTREVMEQYTFPTGLTLDKGDRVHIPVYHLQRD

PEYFPEPELFKPERFYGEEKRNIRPFTYLPFGAGPRTCI

GQRFAKMQMLAGLVTILKRYTVRLAEGMPETINFEQRAIVTQPNIGIRLNLLPRNN*

 

>CYP6AE7    Bombyx mori strain Laos

            GenEMBL EF432656

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MILTIIFILSLCVYILYRISTRKFDYWQKKNVSYVEPAPFLGNY

SGYILLKENLLDVVHNLSKLFPNDPYVGAFFGTKPTLIVKDPEFIKLVLIKDFYYFHG

REGSKYTHNEVITQGIFFTYGDRWKVIRQNLTPLFSSSKIRNMFRTIEKCSGVFENLL

DEESLAPEVEMRSVMSRFTMDCIGGCAFGVDTNAMQEPKDNIFKTMGYLFFESTTRRG

IKNVFKAIWPEIFYGLGFKVFPTDLNEFFSKLLVGIFEARDYKPSSQNVFINLLLNLK

KNRHIVGDRLLKIKTGNVRAESKIKLEVDDELLVSQCVAFFIAGFETSSTISRFTLYE

LAKNPDVQKRAQKEVDEYIKKHNNKLDYDCVKELPFVEACIDEALRLYPVLGVLTREV

MEQYTFPTGLTLDKGDRVHIPVYHLHRDPEYFPEPELFKPERFCGEEKRNIRPFTYLP

FGAGPRTCIGQRFAKMQMLAGLVTILKRYTVCLAEGMPETINFEQRAIVTQPNIGIRL

NLLPRNN*

 

>CYP6AE8 Bombyx mori Laos strain

            GenEMBL EF528486

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MSVSAVVFAAFVLLVTYIYYWSTRKFDYWKRKNVPYAKPVPFFG

NYMRYITLQSYIGDVTQKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYF

NSRENSDYNHKEIVTQNLFFANGDKWKVVRQNLTPLFSSLKMKNMFYLVEKCNHSLED

MLDKEIKDLQIIEIRSAMIRYTLDSICSSAFGIESNTLSEGGENSPFANMGSIVFSSS

ITRGLKWISRSMWPGIFYKLGLQCFPAEIDGFFERVLTEVFENRGYKPTNRNDFVDLI

LSLKQNDYLTGDGLVPKNMDAKKVTVKVDDALLIAQCVVFFGAGFETSASTLSAALYE

PAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVLPNITREA

VADYTFPDGLRIEKGMRVHVPVYAIHRNPDNFPDPEEFRPERHLGDAKNDIKQFTFFP

FGEGPRICIGMRFGKMQTIAGMVTCLKKYNFELADGMSKTVPFRSTTVLTQPSTGLFL

KATPRDGWKQRIFAR*

 

>CYP6AE9v1  Bombyx mori strain Laos

            GenEMBL EF535809

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

MFLLINICVILFVIYYLVTKKYSYWRNRNVSHEKPVLLLGNYGD

LILQKKNFGEMARAICQKFPGEPVVGAFFGTEPVLIPQDPEVIKTILTKDFYYFNGRE

ISEHVHKELLSYNLFATYRDEWKILRQNLTPIFSTAKLKSMFTLIEKCSKSFQNLLED

ETKISKELEVRTLMQRFTIECIGSCIFGVDTDTLGNDKMNPFKAAGSQLSDFSRLVFV

KGIVRAIWPTLFYALGFKTFTTELDIFKKLVNAVFAQRKHKPTTRNDFVDLILTWKNN

NTITGDSIGSFKNSDKTKFSIDVNDDLLLAQCLVFFAAGFETSAMTSSYTLHELAKNQ

RALKKACDEVDAYLLRHGNKINYDCVTELPYLEACIEETLRLYPVLGIITREVMEDYV

LLDKIHLKKGDRIHVPVFHLHHNPEHFPNPEEYRPERFYGEEKRKVKPYTYLPFGEGP

RICIGMRFAKMQSIAGLITILKKFRLELPEGAPTKIEFKPEAFVTTPKDLIKIKFLER

EGWQQRVFV

 

>CYP6AE9v2 Bombyx mori

note: name changed fron CYP6AAE8 (old CYP6AEgg)

MFLLINICVILFVIYYLVTKKYSYWRNRNVSHEKPVLLLGNYGDLILQKKNFGEMAQAIC

QKFPGEPVVGAFFGTEPVLIPQDPEVIKTILTKDFYYFNGREISEHVHKELLSYNLFA

TYGDEWKILRQNLTPIFSTAKLKSMFTLIEKCSKSFQNLLEDETKISKELEVRTLMQRFT

IECIGSCIFGVDTDTLGNDKMNPFKAAGSQLSDFSRLVFVKGIVRAIWPTLFYALGFKTF

TTELDIFKKLVNAVFAQRKHKPTTRNDFVDLILTWKNNNTITGDSIGSFKNSDKTKFSI

DVNDDLLLAQCLVFFAAGFETSAMTSSYTLHELAKNQRALKKACDEVDAYLLRHGNKV

NYDCVTELPYLEACIEETLRLYPVLGIITREVMEDYVLLDKIHLKKGDRIHVPVFHLHH

NPEHFPNPEEYRPERFYGEEKRKVKPYTYLPFGEGPRICI

GMRFAKMQSIAGLITILKKFRLELPEGAPTKIEFKPEAFVTTPKDLIKIKFLEREGWQQRVF

 

>CYP6AE21  Bombyx mori Laos strain

           GenEMBL EF432657

           Dong Wang

           submitted to nomenclature committee Oct. 2, 2007

           94% to CYP9AE3P

MSVSALVFAAFVLLVTYIYYWSTRKFEYWKRKNVPYAKPVPFFG

NYMRYITLQSYIGDVMQKLCQQFPDRPYFGSFYGTEPALVLQNPEIIKQVFTKDFYYF

NSRDNSDYNHKEVVTQNLFFANGDKWKVVRQNLTPLFSSSKMKNMFYLVEKCNHSLED

MLDRETKDLQIIEIRAAMIRYTLDSICSSAFGIETNTLSEGGEYSPFANMASIIFSPS

IARGLKWISRSMWPGIFYKLGLQCFPAEIDDFFERLLTEVFENRGCKPTNRNDFVDLI

LSLKQNDYLTGDGLVPKNVDAKKVTVKVDDALLIAQCVVFFGAGFETSATTLSAALYE

LAKNPEAQRRAQEEVDELLLKHNNKLNYDCLAELPYLEACMNEAMRLYPVFPNITRET

VADYTFPDGLRIDKGMRVHVPVYAIHRNPDNFPDPEEFRPERYLGDAKNDIKQFTFFP

FGEGPRICIGMRFGKMQTIAGLITCLKKFNFELADGMPRTLAFRSTTLLTQLSTGLFL

KATPRDGWEQRIFAR

 

>CYP6AE22v1 Bombyx mori strain Laos

            GenEMBL EF528485

            Dong Wang

            submitted to nomenclature committee Oct. 2, 2007

            4 amino acid differences to CYP6AE22v1, probable allele

MYVLTFLLHFILFLVLVVYYITKRNHDYWKNKKVPFEKPYPILG

NYGDYILLKIFFGNVTKRLCEKFPESPYVGTFYGTEPALVVQDPDLIRLILVKDFFYF

HGREVCIYVDREITTQSIFFTYGDDWRVLRHSLTPLFTTSKMKNMFHLIKNCCRVFEN

VLEEKATVKSFEINSIIKYFIMDCVGACLFGVEINAMEKHSQNPIVKISKEIFPKSTT

RGIINVLRGIWPSLFYALRLKLFPEVITMFFTDLLECAFKDRQRNLSQRQDFIDLFMK

LRQNKYLVGDSIPDIKNGRVQKVNLEVTDELLIAQCVSFFGAAFETSSTTLSLTFYEL

AKNPKYQKRAIEEVDDYFAKHNNEIEFDIVSETPYLNACIDETLRLYPSLANLTREVM

EDYTFPTGLKVEKGTRIHIPVYHLQRNPKYFPEPNKFDPRRFLPEAKQTIYPFTYMPF

GEGHRICIAMRFAKMQMLAGFATLLKKYEVAVDDTTPQELTIDPRIIVTTPIENIQLK

LIARQHAL

 

>CYP6AE22v2 Bombyx mori

note: name changed from CYP6AAE9 (old CYP6AEhh)

MYLLTFLLHFILFLVLVVYYITKRNHDYWKNKKVPFEKPYPILGNYGDYILLKIF

FGNVTKRLCEKFPESPYVGTFYGTEPALVVQDPDLIRLILVKDFFYFHGREVCKYVDREI

TTQSIFFTYGDDWRVLRHSLTPLFTTSKMKN

MFHLIKNCCRVFENVLEEKATVKSFEINSIIKYFIMDCVGACLFGVEINAMEKHSQNPIV

KISKEIFPKSTTRGIINVLRGIWPSLFYALRLKLFPEVITMFFTDLLECAFKDRQRNLSQ

RQDFIDLFMKLRQNKYLVGDSIPDIKNGRVQKVNLEVTDELLIAQCVSFFGAAFETSSTT

LSLTFYELAKNPKYQKKAIEEVDDYFAKHNNEIEFDIVSDTPYLNACIDETLRLYPSLAN

LTREVMEDYTFPTGLKVEKGTRIHIPVYHLQRNPKYFPEPNKFDPRRFLPEAKQTIYPFT

YMPFGEGHRICIAMRFAKMQMLAGFATLLKKYEVAVDDTTPQELTIDPRIIVTTPIENIQ

LKLIARQHAL*

 

>CYP6AN2 Bombyx mori BABH01029151.1, BABH01029152.1

MLLLALLLIFSIVIYLYTTRNHNYWAKRGVRHDPPVPFFGNHFRNVFGLK

SIIELSVELYNKYPNEKVVGYYRGTEPELIVRDLDIAKNILIGDFVYFHH

RGLGRNTDLEPLLRNLFHVDGDAWKLLRKRLTPAFTTAKLKAMFPLVINC

AEKMKSVAGEYAGRGGECDVRELMARFSTEFIGACGFGIQMDTINNECSL

FRELGRLIFTRQGLSLVAIGLWDLLPELRKYLRLPSSSVEATITEIYEKI

RDQRNGKPCGRNDFVDLLLELKQKGVIEGESIDRFNVDGTPVHLQLEMDT

KCIVAQMFVYFAAGFETSSSATSYTLHQLAFHQEIQKEIQCEIDE

VLSRHDNKLCYDAILE

MPLLTMAFKEALRMFPSLGNLHRVCTRSYTIPELGITIDPGVRIIIPAQAIQNDA

KYFDDPSEFRPKRFAKDSEIKKFSFLPFGAGPRNCIG ARLGEMQSLAGLA

AILHKFSVEPAPSTVRKLRVKHTQNVVQGVEGGLPLLIKERK

 

>CYP6AU1 Bombyx mori BAAB01129923.1 AADK01004964.1

MLTAYLLYVFASIVVLIYFYLNNKYKYWKNKNIAGPEPEFLFGNLKESFHRRKHIATVFK

EIYDQYPDEKVVGMFRMTSPTLIVRDLDIVKQIMIKDYAKFNERGIKFSKEGLGDNLFHA

DADAWKAVRSHLTPMFSSGKLKNMVRVLSQTGDRFVDHVTNEVRLRPEQELVSLFLKYNI

ATIMACSFSMETDINDMQVYEMLNVAVFENSYISELDMVFPGILRKTNRSIFGPTVNNFC

YEIVEFIKNERNGKPANRNDMMDMLLGVNCDKLKMKNGSEDFVEITEHVMAGQVFVFFAAG

YVNNTITLTFSLYHLAKDQSIQ

ERLMREIETVLENHNNVLTLEAINEMSYLEMIYLETLRMHPTTNTLQRSALEDYTIP

GTDIEIEKGTLVLIPPLAFHHDEKIYPEPEKFDPERFSVENHKSRHACAFLSFGIGPRTCIG

 

>CYP6AV1 Bombyx mori BAAB01020563.1 BAAB01140967.1

MLLLIIVIIILYLYTTRNHSYWAKRGVKHERPIPFFGNHLPNILLQRDNTDLGLQMYNAY

ENEKIVGYYIGNIPQLIIRDPEIIKHMLNIDFNSFSERGLNLNPKKESLLNNLFFVSG

DNWRRMRNIFSGAFTSVKLKAVFPLIVKCTDKLVKKTTMRHVSDEIKTYELMTGYTMEFIAS

CGFGVDVDTISESNMHFVDVARSFFDKTSLQTFMINLDEICSILKIIPGTFEVNSEFNSF

ILNITKKVLAERNFKPSERNDFVDHLLQMVYWNGNEKLTTEADLESDSWFVAAQVFLFLV

AGFETSAVATSVVLHQLAYNQNLQDEVRKEIDSALKKYDNKLCYEAVCEMSLLDMTLKES

LRIQPPAGFIRRRCIKEYKIPGTNIAIDPGVKILIPIKALNHDPKYFDCPSEFRPQRFSP

EAEQNIPKFVYMPFGSGPRTCP

GARLASLQSMAGLASLLHHFVVEPTPNTSRHYKIKRSAFLVQIIEGGIPLYFKPRTNK*

 

>CYP6AW1 Bombyx mori BAAB01195862.1 BAAB01153386.1 CK496233 EST

MWLSVLLVVILLFLILLLTVFHYTTKGRKYWLLRNVPYREPCPLFGNFGATFTMRRSYTK

MLQFFYDNYYNEKYVGIFQARRPTLMLIDLELVKNVLSKEFPNFSDRISVTTDTQREPL

LRNLANMSGAEWKAMRQIVTPTFSSAKMKAMFPLIAECAQTLKNSLLKESLAEVNVPDFMTRFTTD

VIGSCAFGVDPGSLKDPESPFLKMSQKMFKIDRSTVLKRYCRTFFPKLFKFLNLRTYSKD

VETFFTTIIKKVLDERRATGVQRHDFLQLMLNVQKTETSFVMTDTLIISNSFIFMLAGLE

SSSTTLSFCLYEWAKDKHIQDDLRTEMVDCLERYGGINYEAVCSMRWVN

QAVLETLRLHPPTPLTTRLGTSACTLNGTDLSVRVRDPVLIPLYCIQRDAQHFPNPDKFNLERFKETNPPG

FLAFGEGPRSCPGARFAQLTVAAALAALLSSFEIEPCSMTTSTIVYDPRSVMLKNKGGIW

LKFVPL

 

>CYP354A1 Bombyx mori

MNFSPGTVQILQFIQNDWKL

ILILTLLIFIYYYYTNTFDYFEKRGVPFKKPIIFLGNLGPRLKAVKSFHQYQLDIYQYFKGHPYG

GTFDGRRPVLHILDPELIKAIMIRDFDHFTDRNTLNSMEPRYLSRSLLNLK

GLEWKGVRSTLTPAFSSSRLKNMIPLIQQCSKQMVEFLKKF

DGKEIEMKQTMGHFTLEVIGACAFGIKCDALSNENSRFVK

VAEKFDYMPKYKRVILLMLLVFMPKMIR*LRLSFLNIEYTG

ELVRMLQAAKAERRSSESK

KGDFLQILIDFAAKETAQNDTAKREI

LLDDDTIDAQSLLFLIAGY

ETSSTLLSFAIHVLATKPDLQETLRAHVQEMTKGKEMSYELLAQMDYLEAFLQ

ETLRIYPPVARVDRICTKPYIIPGTTVHVGV

GDAVAIPVYGLHMDEDIYPEAREFKPERFMDDQKKDRPSHLYLPFGAGPRNCI

GLRFAMISAKIAMVALMKNFKFSVCSKTMDPIDFDKRAVLLKSAKGLWVRIELIDLS*

 

>CYP9A19 Bombyx mori

MIIIIWTLVIGLALLLYLKQTYSYFSKHEIKSVTPLPILGNMGKIVFKFNHLVDDISQLYNNFPEER

FVGRYEFVNPVIYIRDIEIVKRITIKDFEHFLDHRTIVNEDSDPMFGRNLFSLK

GQEWKDMRSTLSPAFTSSKMKLMMPLIVEVGEQMINAIKENIKNS

GVGYVDIDTKDLTTRYANDVIASCAFGLKVDSLTEENNRFYAMGKAATNFSFKQILMLLGFISFPKLMK

MTKFRLFSEETSGFFKELIMGTMKDREMRKIIRPDMIHLLMEAKK

GKLVHDNKSSKDTDAGFATVEESAVGKKQIDR

VWTDDDIIAQAVLFFIAGFETVSSAMTFLLHELALNPEVQEKLVEEIKENKERNNGKFDYNSIQNMAYLDMVVS†

ELLRLWPPAVSMDRICVQDYNLGKPNDKAKRDFI

LRKGTGVAIPVWAFHRNPEFFPDPQKFDPERFSEENKHNIKPFTYLPFGVGPRNCI

GSRFALCEVKVMAYQLLQHMEISPCEKTCIPSKLSKEIFNLRLEGGHWVRLKIRD*

 

>CYP9A20 Bombyx mori

MILLIWAVVLIAAFVLFYKQAYSLFSKHGVKGFTPLPFFGNMGRIVIKMDHFSDHIQSLYDSFPEER†

FVGRYEFLNPMVIIRDIELLKKITVKDFEHFLDHRTIINKDTDPFFGRSLFFLR

DQDWKDMRSTLSPAFTSSKMKLMMPFIVEVGEQMNKALKQRIQEAG

VGYVDIDSKDLTTRYANDVIASCAFGLKVDSITEENNQFYAMGKAASTFNFRQLLIFFGLASVPKLV†

KILRITLFQKEIKTFFRELILGTMKNREAQNIIRPDMIHLLMEAKK

GKLRHDEKSTKDSDAGFATVEESSVGKKDINR

VWTDDDLVAQAVLFFVAGFETVSSAMTFL

LHELALNPEVQEKLVEEIRENEKNNNGKFDYNSIQNMVYLDMVV

SEVLRLWPPVIALDRMCVKDYNLGKPNDKSKEDFI

IRKDVAVGIPVWGLHRDPEFFPNPLKFDPERFSEENKHNIKPFSYMPFGLGPRNCI

GSRFALCEVKVMTYQLLQHMEISPCEKTCIPSKLSKETFNLRLEGGHWIRLKIRN

 

>CYP9A21 Bombyx mori

MIIIIWTLAIGLAFLLYLKQIYCYFSKHEIKSITPLPILGNMGKIVFKINHFVDDISQLYNKFPEER

FVGRYEFVNPVIYIRDIEIVKRITIKDFEHFLDHRTIVNEETDPIFGRNLFSLK

GQEWKDMRSTLSPAFTSSKMKLMMPLIVEVGEQMINALKKNIKNSG

VGYVDIDTKDLTTRYANDVIASCAFGLKVDSLTEENNQFYAMGKAASNFSFKQILLLLGFISFPKMMK

MTKFTLFSEETSGFFKELIMGTMKDREMRKIIRPDMIHLLMEAKK

GKLVHDDKSSKDTDAGFATVEESAVGKKQIDR

VWTDDDIIAQAVLFFVAGFETVSSAMTFLLHELALNPEVQDKLVEEIKENKERNNGKFDYNSIQNMVYLDMVVS

EXXRLWPPGVSLDRLCVQDYYLGNPNEMAIRDFI

LRKGTGVAIPVWAFHRNPEFFPDPLKFDPERFSEENKHNIKPFAYLPFGVGPRNCI

GSRFALCEVKVMAYQLLQHMEISPCEKTCIPSKLSKETFNLRLEGGHWVRLKIRD

 

>CYP9A22 Bombyx mori

MITLIWLGVLLVTLTLHLRKVYSRFKDYGVNHFTPIPVLGNAGPITVRLRHVAEDFDMVYKAFPEDR

FTGRFDLLRPTVIIKDLDLIKQITIKDFEHFLDHRALVDDTADPFFGRNLFSLR

GQEWKDMRSTLSPAFTSSKMRGMVPFMVEVNNQMIDMIKKKIVANA

GYLDCEGKDLTTRYANDVIASCAFGVKVDSHTNEENQFYLMGRDMADFGFRKIMVFLGYSSFPKLMK

KFNAKLLSDETGHFFTDLVLRTMEDREVKEIVRPDMIHLLMEAKQ

GKLSYDEKSTKEADTGFATVEESDVGKKTINRI

WSNTDLIAQATLFFVAGFETISSAMSFALHELALNPEIQDRLVQEIKENYAKTGGKFDFN

CIQDLTYMDMFVSEVLRLWTPVVGMDRLCVQDYNLGRANKNATKDFI

LRKGEGLSIPTWSIHHNPEYYPEPYKFDPERFSEENKRNIKPFTYLPFGTGPRNCI

GSRFALCEVKVMLYQLLQQIEVLPSDKTKVRAKLAKDTFNVKIEGGHWIRLKLRD

 

>CYP9G1 Bombyx mori BABH01029749.1

MFLETLLLLITIIVGYYWYIYKKAHYYFESKGVKYLRGVPFFGNLMNNLLRRTHL

WEDYDVVYKAFPNE

RYVGFTDGVCPGIFIRDPEIIKHVTVKEFDHFVNNKDLSPEGEESILKNSLIMLK

DEKWRKMRAALSPAFTASKMREMVPLITEISHNIVEYLK

EHLTEDIDLDDLMSRYSNDVIASAAFGLQINSLKERDNIFFKAGKDVFNFSLFQSIRMIFSDHFPSLSK

KLGFTVIPKSTSEFFRTLIASTVDYRIKNKVERRDMIQLLMQLST

EWTETELAAQLFVFFVAGFETTGNTLINCIHELALNPHIQDILYEELKAFKETKGNLVYENIGELKYLDCVLN

ETMRKWSAAIFVDRICTKPYVLPPPREGGKPCQ

LKPGEVIYNAVNSIHMDPKYYEEPEKFIPERFLDENKHKIKPFTFMPFGVGPRYCI

GSRFALMEMKILLFRLMLNFKVLKCAKTLDPIKMSPVGFNMNIWGGSWVKFQARKA*

 

>CYP9G3 Bombyx mori

MLVEVIVFLITTLVAYYLYVYKKIHYFYDARGVKYQPGIPVLGNILKSSLGTGHFWEDIDKIYKAFPGER

YIGYIEGTTPILMIKDPEIIKNITVRDFDHFVNHKEFFPVEIDALFGGSLFMMK

DDKWRDMRTTLSPAFTGSKMRLMLPFMIDISKNIVEYLK

GHQLEDVDVDDLMRRYTNDVIASAGFGLQVNSLVDKDNEFYECGQAMFSTSWPQRFKMILAAQFPTLAK

KIGIKVFPQKVTRFFREIVTSTMDYRLKNNVERPDMIQLLMDAYK

GTLKNESNESDEKNVGFAMTEEMLKPKGNVR

KWTQDELTAQVFIFFLAGFESSANGLTLCIHELALNPEAQEKLYEAIIKFKEEKGPLTYDNIGELKYLDCVLN

ETSRKWSAAIIVDRVCSKPYELPPPREGGKPYK

LQPGDIVYNSVNSIQMDPEHHPDPEKFDPDRFLDENKHKIKPFTFLPFGAGPRNCI

GSRFALLELKVLIYYIVLNFKIIKTEKTLSPIKLQPGEFNIKVWGGTWTQFEARE*

 

>CYP9G3-de9b10b Bombyx mori BAAB01034600.1

DFLFNVANSIHIDPIYHTEPDTFNPARFLVENEYQMREFTFMPFSIGPRNFF

GKGFALL*IKLILYYLVLNFKVMKFMKTQNPIKLIQHEFNLEV

 

>CYP9AJ1 Bombyx mori AADK01027242.1, BAAB01063629.1, AADK01003334.1, AADK01016060.1

MAPLMVESAKSVTNHLQKRIIDEKVIDINNITMSYVNDVIASCAFGFAVD

SLKEPDNCIYKLGQKAIIQDTTQVMKFFGYENIKTVMKGLKVKIIATEEA

EQFGLLFKSALKARKEKLVGPRPDFIQILVDAMQ

GKGDDDKISSNSTNGKVHLKIKSYLIINKNV

SFTDDDLVAQAVLFYVAGYDTTANLINYFLYEMAVNPHVQEKLNQEIAEMSD

EGDVYEAIQRLKYLEMCVC

EVLRLWPLVGSADRRSVIPYDFGPTYPDSKHSLIAPTGIHIWIPIYS

IHRDEQYWPDPNTCIPERFSPENKGSIVPYTYLPFGTGPRHCI

GSRFAILAAKVFLVKFLKTYRTKTHREKTKLSPRAFILRPRDGFELTVERRIEND

 

>CYP333A2 Bombyx mori EST DC547829.1 74% to CYP333A1 C-term region

MYSLNKSGQRVFALQIHKRYHYANGKFSTFN

KPFESIPGLGALPLIGPLHHFLPII

GTIGPKTNMFDVLGILEGK

FGPLVKVDGVFARGTMLFLFEPDHFEQ

VYRAEEANPLRPGFQVLDYYRTQLRKSRYGGLHGLINA

QGPEWREFRTKVNPALLLPKLVKLYAPGIDEIAQDFVQRYLFSFVIKYYNCVCNFLCSSIIPLR

DNFELELTKFSLEATALVALGSRLGCLKDSLDSDHPARRLMKSTRDIFELTYKLEIRPSP

WRYIATPAYKMVIEAYDTQWE

VSKYYFRISMMYINHARKKLEQRGYDIPEEEKSVLEKLIAIDEKVAVMMASEMLLAGIDT

IDVIAPNEYLSRSEKFYPQPEEFIPERWLVEKSDPLYYGNAHPLVTLPFGFGVRSCIGRR

IAELEIELLIKRLIEEFKVTWNGPPIKIVNKLTNTFVKPYNFTFTSVK*

 

>CYP333B1 Bombyx mori 39% to 12B2 mito AADK01000081.1, AADK01010165.1

MIIALHYSKLRPVLNFSCLQQCVR†

TVTVSAATEKLQQTELKSFREIPGPSSLPIMGPFLHFMP

GGSLHNINSTELTHKLYDIYGPIVRIDSMFSKDAIVLLYDAESAGI

ILRNENNMPIRISFKSLSYYRQKYKKSENDRTDRPTGLVSD

HGELWKSFRSAVNPVLLQPKTIRLYSSALEEVATDMVERL

RSLRDENNRIRGQFDQEMNLWSLESIGVVALGNRLNCFDSNLQDDSPVKRLIECVHQ

MFVLSNELDLKPSIG

QLNYTKNIFKTRLIYFSLTKYFIKKALDDIKMNKSKSDDEKPVLEKLLDINEEYAYIMASDMLVAGVDT†

TSNTMSATLYLMAINQDKQQKLREEVMSKNGKRSYLRACIKEAMRILPVV

SGNMRRTTKEYNILGYHIPEN

VDIAFAHQHLSMMEKYYPRPTEFIPERWLTNKSDPLYYGNAHPFANSPFGFGVRSCI

GRRIAELEVETFLSKIVENFQVEWSGSSPRVEQTSINYFKGPFNFIFKDL*

 

>CYP333B2 Bombyx mori BAAB01158865.1 AADK01000081.1 BAAB01179470 BAAB01136746.1

MIGLYILFITFFFLFQNLIYCQ

ATVSTSENVDVTNLKPFHEIPGPSSLPLIGPLLHFIPG

GSLYTPDTKDFSAKLFKLYGPIVKLDPLFARNTLLMVYDPESAAN

VLRSENRIPYRGGFNSLAYYRKHIKKHENNHKKLTGLITE

GEEWWDLRSTVNPVLLQPKTIKLYSAAIDEVAQEMMNR

MHRKLDENDRLQAKFDDEMNLWALESIGVVAFGIRLNCFDPNLAENSPEKKLIECVHQI

FNLSNQLDFQPSLWHIFSTPTYKKAMKMFQLQEE

LSKYFINKAMRNINKNENKPDEQKGVLEKLLDINEEYAYIMATDMLVAGVDT

VANSIAATLYLFAKNPEKQEKLREEVMSKESKRYLKACIKETMRMMPVVSGNLRRTT

KEYNILGYHVPKG

IDVAFAHQDLSSMEEHYPRPTEFIPERWLADKNDPLYYGKAHPFVMAPFGFGVRSCI

GRRIAELEIETFLTKILENFRVEWYGPPPKIIQTSINYFTGPFNFVFNDIKKK*

 

>CYP15C1 Bombyx mori AADK01010670.1 BABH01011971

MLALIALCFILFFYIISRRHRGLCYPP

GPTPLPVVGNLISVLWESRKFKCHHLIWQSWSQKYGNLLGLRLGSINVVVVTGIELIKEV

SNREVFEGRPDGFFYTMRSFGKKL

GLVFSDGPTWHRTRRFVLKYLKNFGYNSRFMNVYIGDECEALVQLRLADAGEPILVNQMFHITIVNILWRLVAGKR

YDLEDQRLKELCSLVMRLFKLVDMSGGFLNFLPFLRHFVPRLIGFTELQEIHNALHQYLR

YQEIIKEHQENLQLGAPKDVIDAFLIDMLESQDDKR

ATLDDLQVVCLDLLEAGMETVTNTAVFMLLHVVRNEDVQRKLHQEIDDIIGRDRNPLLDDRIR

MVYTEAVILETLRISTVASMGIPHMALNDAKLGNYIIPK

GTFILLSLYELLHHGPHWKDPETFRPERFLTKEGNILQDEWLIPFGI

GKRRCIGEGLARSELFMFLTHILQKFHLRIPKNEPLPSTEPIDGLSLSAKQFRIIFEPRKTFKSI*

 

>CYP18A1 Bombyx mori

MITMLTNSKILWALWQVMNYCVSRTSVMLIIVTCTALLLTQFLKLVRDIRKLPP

GPWGPPVVGYLPFLGVRHKTFLQLARNYGALFSARLGNQLTIVMSDYKIIREAFRREEFTGRPSTPLMHTLDGL

GIINSEGRLWKNQRRFLHEKLREFGMTYMGNGKKLMEDRIQ

NEIHELIVSLHRAQGAPIDVNPLLALCVSNVICGITMSVRFSNGDVRFERLNHLIEEGMRLFGEVHYGEYIPLYN

YLPGKALAQEKVAKNRDEMFAFYQTLIDEHRETLDINNARDLIDVYLIEIEKAKSEGRAGELFEGRDH

ELQLKQILGDLFSAGMETIKSSLLWMIVFMLRNPDVKRRVQEELDAVI

GRERLPSIDDISSLPYTETTILETLRLSSIVPLATTHSPTR

DVQINGYKIPAGSQVIPLINCVHMDPNLWDEPNKFNPSRFIDATGKIRRPEYFMPFGVGRRMCLG

DVLARKEMFMFFSCMMHQFDLEMAEGDALPSLEGIVGATIAPKAFRVKFLARSPVPLVPTTLSADSSHLRHVGSH

 

>CYP18B1 Bombyx mori

MLIYTRIISTLGMWTKLDTYIELYNGYMQDILDRKHRTMDLLFLVLLGLLFLFLKRTICYYMYLPP

GPWGVPFLGYLPFMKSSPHAMYSRMADKYGEISSIKLGNHLVVCLNSPKLVKELFS

RSDSIARPRTPLNEIMEGR

GIVLSEGILWQKQRQFLHEKFRALGVKVWPKQRFEKFII

MEIEEFITDLIKLNGAPVDPTLLLGRHVHNIICQLMMSFRFEEDDQEFGIFNEKISRGMKL

YGSIHASEYVRHYL

KLPGKKTILDEMKRSLADISEFHANKIRERIDYRATHPYDEPADLLDYYLDNIEARKSRKRFPDIFPGVDP

EKQVVQVMNDLFSAGMETSRTTLSWTLLMMIHEPDVAAKVRAQLTETVHPGELVTLDHRPELPY

LEAVLFETLRCVSLVPLGTTHVNTT

SEWKVDKYVIPKGAHIIPLIGKMNNDPKVYPEPDKFKPERFLRDGQFHIPDSYMAFGVGQ

RLCLGIQLARMQLFLFFANIMNRFEFSLPEGAEMPPLEGFMAATHTPLPYSLCFHKIDN*

 

>CYP49A1 = old CYP49A2 Bombyx mori (revised based on synteny)

MLSGACTAHYTKHIRCVIIVMKYQTTVAAALESFRNF

ARCYTVMPGPRPLPILGNSWRFALGW

KPWRTKRLDLTLWCLRSLAGAGGAAKVAKLFGHPDLVFPFCAEETARIYRREDAMPHR

AAAPCLKHYKQELRKDFFGDEPGLIGI

HGEPWSRFRSKVSKALIAPEAARAAVPELDYVANDFVIR

LEHLLDLNRELPKDFLTELYKWALE

SVGAWALGTRLGCLNDTKTDAKEMIK

CIHGFFHSVPELELSAPLWRIYSTPAYKTYIEALDSFRL

LCLKRLTDKGVCAQVAKNCGQKVATILALDLMLVGVDTTAA

AAASSLYLLANVPRAQRALQKELDTNLPKNRILNDKDLDKLPYLKACIKEALR

MKPVILGNGRCIQSDTTISGYKVPKG

THIVFPHYVLSNEERYFPSPHEYVPERWLRENDIAG (gc boundary?)

VCRKQKEIGIHPFASLPFGFGRRMCVGKRFAEVELQLLLAR

IFQKYNVLWRHPELTYSVTPTYIPNESLKFTLNKRNE*

 

>CYP301A1 Bombyx mori

MGRALRSFAAYARPIQLQSTRNSSSCPFSKRQRSQIAPTAELNEEIFA

NARPYSEVPGPRPIPILGNTWRMVPVIG

QFDISEFAKVTKQFLDTYGRIVRLGGLIGRPDLLFVYDADEIER

MYRREGPTPFRPAMPCLVKYKSEVRKDFFGELPGVVGV

HGDQWRRFRSKVQRPILQPQTVKKYVAPIELVTEDFIKYMVDARDENGDLPHEFDNDIHRWSLEC

IGRVALDVRLGCLSPQLNSNSEPQRIIDAAKFALRNVAVLELKA

PYWRYIPTPLWSKYVNNMNFFVE

ICSRYINEALERLKTKKVTSENDLSLLERVLRSEGDPKIATIMALDLILVGIDT

ISMAVCSILYQAATRLEQQDKMAEEIRRVLPDPSKPLSYSDLDKLHYTKAFVREVFR

MYSTVIGNGRTLQDDDVICGYHIPKG

QVVFPTIVTGNMEQFVSDPLEFKPERWLEGGGKLHPFASLPYGFGARICLGRRFADLEIQVLLAK

LLSRYRLEYHHEPLDYAVTFMYAPDGPLRLRMIER*

 

>CYP301B1 = old CYP49A1 Bombyx mori (revised based on synteny)

MIMINLLGAKNSMLSTCPVHIQRARSTHVVDATAFEVSSPVKPWEDVPGPKPLPLLGNTWRFTPYI

GSYSVEHIDRICVSLRAKYGKCVKMAGLLGRPDMLFVFDANEVERVFRGEDAAPHR

PSMPSLNYYKHTLRKDFFSAEENCAGV

HGDSWSAFRTKVSRVALSAGAAAQYTAPVAEVADCFVER

IRKIRDENMETPEDFLNEIHKWSLE

SLGLIALDTRLGCFEACEGSESQRLIDAV

KTFFLCVGELELRAPCGGSTPPPCSDERRCFRHYPQV

SVTLRHVDKALEEIKLNGSSKSLLQDLVTAAGARVAAVAALDMFLVGIDT

TSTAVASILYQLSSRPHVQEKIYEEVTKALQGRPMSPGDLNQMPYLKATVKEVLR

MYPVVIGNGRQLTKDTVICGYNIPKG

TQVIFQHYVMGNSEEYFKDASQFRPERWLKRTAQRHHAFASLPFGYGKRMCLGRRFAELEIHTVICK

LLQKYKLEYHYGDLEPTRSFIARPKRALKLRFIDRI*

 

>CYP302A1 Bombyx mori

MFVRLTVKNNIPYRARKCVYRRASENFVGSEHASKVNEQGDNLM

NFEDIPGPRSYPIIGTLHKYLPLI

GDYDAEALDKNAILNWRRYGSLVREKPIVNLVHVYDPDDIEAVFRQDHRYPARRSHTAMNYYRTNKPNVYNTGGL

LRSNGPDWWRLRSIFQKNFTSPQSVKTHVSDTDNIAKEFVEWIKRDKVSSKNDFLTFLNRLNLE

IIGVVAFNERFNSFALSEQDPESRSSKTIAAAFGSNSGVMKLDKGFLWKMFSTPLYKKLVNSQIYLEK

ISTDILIRKINLFESDDSKNDKSLLKTFLQQPQLDHKDIMGMMVDILMAAIDT

TAYTTSFVLYHIARNKRCQDEMFEELHTLLPKKDDEITADVLSKASYVRSSIKE

SLRLNPVSIGIGRWLQKDIVLKGYSIPKG

VIVTQNMTSSRLPQFIRDPLTFKPERWMRGSPQYETIHPFLSLPFGHGPRSCIARRLAEQNICIILMR

LIREFEIQWAGEELGVKTLLINKPNKPVSLNFIPRSS

 

>CYP303A1 Bombyx mori

MWLAALAVLLAVCLYLFLDTLKPRKFPPGPKWTPILGCAKEVYKLREK

TGYLYKAVRELSLTYCKETPVLGLRIGKDRIVMVNSLEANKEMLFNEDIDGRPKGIFYQTRTWGERRGVLLT

DGELWKEQRRFLIKHLKEFGFGRSGMGETAKLEAEHIVIDVMHMIGDRGSAVIQMHN

FFYVYILNTLWTMMAGNRYNPSDPQMKILQ

SMLFDLFAAVDMVGTAFSHFPILSIVAPTLSGYR

NFIKTHKRIWKFLREELARHKDSFQPDKEDKDFMDVYIRALREHGEVNTYSEGQ

LVAMCMDMFMAGTETTSKSMSFCFSYLVREQEVQRKAQEEIDRVVGKDRVPSVNDRPN

MPYNEAIVHECVRHFMGRTFGVPHRALRDTTLAGCHIPE

DTMVVSNYTNILLDENYFPEPYSFKPERFLVNGRVSLPDHYFPFGLAKHRCMGDALAKCNIF

VFTTTMLQRFSLVPVPGEGLPSLDHMDGATPSAAPFKALVIPRI*

 

>CYP305B1 Bombyx mori

MLPVLVCIIVIVLICCNVIRSVIKPEKFPPGPIWYPFFGSSSIV

QQMTSKHGSQWKALLELSKQWSTQVLGLKLGRELVVVVYGEKNVRQVFSESEFDGRPN

SFFYKLRCLGKRLGVTFVDGPLWREHRQFTVKHLKNVGFGKTSMELEIQNELKLLREY

INDNKHKPIKVDSMFSSAVMNVLWKYVAGERIREDKLERLLELFYLRSKAFTLTGGLL

SQIPWCRFIIPGLSGYKLIVDLNQQISEIIEEAIKKHLNKEVQQNDFIYSFLDEMNEE

NKASFTYDQLKTVCLDLIIAGSQTTGNAVKFALLSVLRNKNIQEKIFNEIENTIGDSM

PCWADSSKLVYTSAFLLEVMRIHTIAPLAGPRRVLQDTVIDGYVIPKETTVLISLADI

HLDPNLWPDPHEIKPERFIDEKGLSKSNEHIYPFGSGRRRCPGDSLARSFVFIIFVGI

LQKYRIDCVNGVLPSNEADIGLLAAPKPFVANFVSRE

 

>CYP306A Bombyx mori

MDLYFIWLVTFVAGFWIFKKIKEWQNLPPGPWGLPIVGYLPFID

RYHPHITLTNLSKTYGAIYGLKMGSIYAVVLSDHKLVGDTFSKDSFSGRAPLYLTHGL

MNGNGIICAEGGLWRDQRKLITSWLKSFGMSKHSVSREKLEKRIASGVYEILENIEKT

SDAALDLPHMLTNSLGNVVNEIIFGFKFPPEDKTWQWFRQIQEEGCHEMGVAGVVNFL

PFIRHVSPSTRKTIEVLVRGQAQTHTLYASMIDRRRKMLGLEKPKGAEYAPHENLLKL

YPNGHIKCIKYSKVSPNTEHFFDPNTLIPTEGDCILDNFLLEQKKRFESGDPTALYMR

DEQLHFLLADMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEILSVYPYDDDVDSSR

LPLLMAAICETQRIRSIVPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWE

EPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDELSRMLSCGLVSRLFRKQRIRL

ASKIPTAEEMRGTVGVTLAPPPVKYYCEPI

 

>CYP307A1 Bombyx mori

MSSLIIVLFVFALAVYKLLRRKTVRWVKTNKYGGVETAILRTAPGPVCWPIIGSLHLLGG

HESPFQAFTELSKKYGDIFSVKLGSADCVVVNNLSLIREVLNQNGNVVAGRPDFLRFHKL

FAGDRNN

SLALCDWSNLQLRRRNLARRHCGPKQHTDSHARIGTVGTFESVELIQTLKGLT

SRSDASIDLKPILMKSAMNMFSNYMCSVRFDDEDLEFQKIVDHFDEIFWEINQGYAVDFL

PWLAPFYKKHMEKLSNWSQDIRSFILSRIVEQREINLDTEAPEKDFLDGLLRVLHEDPTM

DRNTIIFMLEDFLGGHSSVGNLVMLCLTAVARDPEVGRKIRQEIDAVTRGKRPVGLTDRS

HLPYTEATILECLRYASSPIVPHVATENANISGYGIEKGTVVFINNYVLNNSEQYWSEPE

KFDPSRFLEKTRVRTRRNSQCDSGLESDSERAPVGKPDVEREMLSVKKNIPHFIPFSIGK

RTCIGQTMVTSMSFTMFANIMQSFEVGVENINDLKQKPACVALPKNTYKMHLIPRK

 

>CYP314A1 Bombyx mori

MQSTSPPLLDWSCVPTLVLAVIAVVVAVTALLTRTSDAKHSCR

LPGPQPLPFLGTRWLFWSRYKMNKLHEAY

ADMFKRYGPVFMETTPGGVAVVSIAERTALEAVLRSPAKKPYRPPTEIVQMYRRSRPDRYASTGLVNE

QGEKWYHLRRNLTTDLTSPHTMQNFLPQLNTISDDFLELLNTSRQSDGTVYAFEQLT

NRMGLE

AVCGLMLGSRLGFLERWMSGRAMALAAAVKNHFRAQRDSYYGAPLWK

FAPTALYKTFVKSEETIHA

VPDRIVSELMEEAKSKTTGMAQDEAIQEIFLKILENPALDMRDKKAAIIDFITAGIET

LANSLVFLLYLLSGRPDWQRKINSELPPYAMLCSEDLAGAPSVRAAINEAFR

LLPTAPFLARLLDSPMTIGGHKIPPGTFVLAHTAAACRREENFWRAEEYLPERWIK

VQEPHAYSLVAPFGRGRRMCPGKRFVELELHLLLAK

IMQKWRVEFDGELDIQFDFLLSAKSPVTLRLVEW*

 

>CYP315A Bombyx mori

MHRFPSMSSIRSAVRSRNSNRCSMSTKPHKSLRTIDEMPHKKSL

PIIGTKFDLFSAGGGKNLHKYIDMRHKQLGPIFYERLTGKTKLVFISDPTHMKSLFLN

LEGKYPAHILPEPWVLYEKLYGSKRGLFFMDGEDWLINRRIMNKHLLREDSDVWLRAP

IRTAVFHFICNWKLRAQSGNFSPNLESEFYRFSTDVILAVLQGNSALLKPTPEYEMLL

LLFSEAVKKIFSTTTKLYALPVEFCQRWNLKVWRNFKQSVDDSISIAQKIVYEMLHTK

DAGDGLVKRLKDENMSDELITRIVADFVIAAGDTTAYTSLWILFLLSNNTEILTEMND

NDQYVKNVVKEAMRLYPVAPFLTRILPKQCVLGPYLLEEGTPVIASIYTSGRDEQNFS

KADQFLPYRWDRNDQRKKDLVNHVPSATLPFAFGARSCIGKKMAMLQMTELISQIVKN

FDLKSMNNSDVDAVTSQVLVPNKDIKVLILPRSISK

 

>CYP324A1 Bombyx mori

MLFIIIFIFILLLLTWWLIRWQQVKSYWAARNVPHEPPHPVLGSLTFLQKENP

SIWLIKLYKKFPFPYIGIWLFWKPALIINSPELARQILTKDADTFRNRFSNAGKSDPVGALNLFMIN

DPVWSSVRRRLTPVFTKLKLQALYPILIRKSNDLKKRIKEDTEKNIKINLR

SLFVDYSTDILGEAAFGVSSNSITTGESAMREVTKDFMKFDWLRGLQWSCIFFFPELADFFR

CKLFPKESLEILRKIYRTMVAERSKSQSISGKSKDLLDALMAMKIEAAAENE

VYNEDLLFAQATLFVQAGFETTSSAITFAIYELAYNPEIQ

ERLYREIVEAKQKMEGNELDGVVLSNLQYLNCVIN

ETLRKYPSLGWLDRVSSQSYKVDDTLTVPAGTAVY

VNVAGIQSDPQLFPKPEEFIPERFNTDNNNIKPFTFIPFGEGPRQCI

GIRFGYQAIQFGLSAIILNFKLRPIEGSPLPNNCHIESKGFVYTADHPLHIQFVPRN*

 

2 aa diffs to CYP341A1

688517 VIQNK*EEITRENNSKTEVDYEY 688585

 

>CYP341A1 Bombyx mori nscaf2813 684692-690756 (+)

MIVILLIVLVLGWFSVFRYRRRNMYKLAAAIPDVDKHIPLLGIAHKFTGNTE

EIMSMLQKYSYNSMKHNGLAKGWLGHVLYF

VLSNPVDSEVVLKTCLEKDDLHRFIRAIIGYGGIFAP

VSIWRRRRKIMVPAFSPRIVQSFVGIISEQSEKLASNLGKRVGKGMFSSWPFLSAYTLDSVC

ETALGVKINAQGDKDSSFLKSMNRILNIVCMRIFHLWLQPVWLFKLFPVFNEHQSCIEMLHDFVDK

VIQNKREEIKRENNSKTEVDYEY†

NLGSYKCKTFLDLLITLSGAEKGYTNIELREEVLTLTVAGTDTSAVAIGFTLELLSKYPEIQEKVYKE†

LREVFCDSERPLIKEDLEKMKYLERVVKESLRLFPPVPFIIRKVLEDMTL†

PSGSVLPAGSGIVVSIWGIHRDPKYWGPEAEHFDPDRFLPERFNVEHPCCYLPFSSGPRNCL†

GYQYAMISIKTSLSAILRRYKVVGEPEKGPVPRIRVKLDIMMKSVEGCQVALERRPTK*

 

>CYP341A2 Papilio xuthus AB201381
MFLCLLCLSVVLGMVLFKLKRRRLYRLASKIPGSDDELPFIGLAHKFTGTTE
DILNSLQKYSYEAMKNNGILRGWLGHILYFIVVD
PVDVEVILKTSLEKDD LHRFIRNVIGNGLIFAPVSIWRRRRKITVPAFSPKIVDTFMEVFAEQSEKLVSVLAAC
AGNGYIAMEPYLCRYTLDSVCETTMGITTNAQNNPNAPYLKALKNILNLVCERIFHLW
LQPDWLYKFFSQSKSHQKYTKEMQGFVDEVIQNKRREIKKEKDLKSEVDRNFGLSNYK
TQSFLDLLIEFSGGENGYTDLELREEILTLTIAGTDTTGISIGYTLKLLAMYPKVQDK
LYQELLDVFGTSDRRIVKEDLSKLKYLERIVKESLRLYPPGPFIIRKVLEDISLPSGR
VFPAGSGAAVSIWGLHRDPKYWGPDAEVFDPDRFLPERFNLKHACSYIPFSSGPRNCI GYQYALMSMKTVLSAIVRRYKIMGEESGPVPHIKSKIDIMMKAVDDYKICLEKRFK

 

>CYP341A3 Bombyx mori AADK01027984.1 96% to 341A1 nscaf2813 663621-675641 (+)

MIVILLIVLVLGWFSVFRYRRRNMYELAAAIPDVDEHIPLLGIAHKFTGNTE

PVDLELVLKTCLEKDDLHRFMRVVIGYGGIFAP

VSIWRRRRKIMVPAFSPKIVQSFVGIISEQSEKLASNLGKCVGTGKFSSWPFLSAYTLDSIC

ETAMGVKVNAQGDKDSNFLISMNRILNIVCMRIFHLWLQPAWLFKLFPVFHEHQKCKKLLHDFVDE

AIQKKREEIGTENNSAIEVDYKY

LGSYKSKTFLDLLITLSGAEKGYTNIELREEVLTLTVAGTDTSAVAIGFTLELLSKYPEIQEKVYKE

LCEVFGDSERPLVKEDLEKMKYLERVVKESLRLFPPAPFIIRKVLEDITLRN

SGNVLPAGSGVMVSIWGIHRDPKYWGPEAEHFDPDRFLPERFNVEHPCCYMPFSSGPRNCV

GYQYAMISIKTSLSAILRRYKVVGEPEKGPVPQIRVKLDIMMKSVNGCQVALEKRPTK*

 

>CYP341A4 Bombyx mori nscaf2813 639938-650294 (+)

MIVILLIVLVLGWFSVFRYRRRNMYKLAAAIPDVDERIPLLGIAHKFTGNTE

ALLNPVDMEVVLKTCLEKDDLHRFMRVVIGYGGIFAP

VSIWRRRRKIMVPAFSPKIVQSFVGIISEQSEKLASNLGKCVGTGKFSSWPFLNAYTLDSIC

ETAMGVKVNAQGDNDSIFLKSLNRMLNIVCMRIFHLWLQPTWLFKLFPVFHEHQKGKKLLYDFVDE

AIQKKREEIRTENNSGTKVDYKY

DLGSYKSKTFLDLLITLSGAEKGYTNIELREEVLTLTVAGTDTSAVTIGFTLELLSKYPEIQEKVYKE

LCAVFGDSERPLVKEDLEKMKYLERVVKESLRLFPPVPFIIRKVLEDITL

PSGNILPAGSGVVVSIWGIHRDPKYWGPEAEYFDPDRFLPERFNVEHPCCYMPFSSGPRNCL

GYQYAMISIKTSLSAILRRYKVVGEPEKGPVPQIRVKLDIMMKSVNGCQVALERRPTK*

 

>CYP341A5 Bombyx mori AADK01003016.1 -635341 (+)

MISSING EXONS 1,2,3

ETAMGVNINAQAKADSEFLKSLNRLLNVICERIFHLWLHPDWLFKQLPVYDEHQKCIKVLHEFIDQ

VIQNKREEFQIEKISKdIEVDTQY

DLGLYKRKTFLDLLITFSGDEKGYTNVELREEMLTLTVAGTDTSAVAIGFTLELLAKYPKIQDKVYQE

LYEIFDGSERALVKEDLEKMEYLDRVVKESLRLFPPVPFIIRKVLEDTRL

634758 PSGNVLPAGSGIMVSIWGIHRDPKYWGPEAEHFDPDRFLPERFNLEHPCCYMPFSSGPRNCL 634940

GYQYAMISIKTSLSAILRRYKVVGEPEKGPVPQIRVKLDIMMKSVNGCQVALERRPTK*

 

>CYP341A6 Bombyx mori nscaf1613 (N-term) nscaf2813 601959-616470 (+)

exons 5,6 have no exact match, 5 has 1 aa diff on nscaf1613

exon 3 has 1 aa diff to A7

exon 2 has 2 aa diffs to A7

AADK01011365.1 has exact matches to exons 5,6,7

MIALLLILVGLGWVLVFRYRRRNMYKLAAAIPTPDETNLLVGVAHKMMGNTE

VSSNPFDLEVILKTCLEKDDLHRFFRPAIGYGGIFAP

VSIWRRRRKIMVPAFSPKIVHSFVGIISEQSEKLVSSLSKCVGKGMFGSWPFLSAYTLDSVC

ETAMGVNINAQAKADSEFLKSLNRLLNVICERIFHVWLHPDWLFKQFPVFNEHQKCIRVLHEFIDQ

VIQNKREEFQMEKISKDLEVDTHY

DLGSHKSKTFLDLLITFSGDEKGYTNVELREEMLTLTVAGTDTSAVGIGFTLELLAKYPKIQENIFQE

LYGIFDGSERALVKEDLEKMKYLERVVKESLRLFPPVPFIIRKVLEDTRL

SGNVLPAGSGIFVSIWGIHRDPKYWGPEAEHFDPDRFLPERFNVEHPCCYMPFSSGPRNCL

GYQYAMISMKTSLSAILRRYKVVGEPEKGPVPRIRVKLDIMMKSVDGCQVALERRPTKLC*

 

>CYP341A6-ie5b

611146 VIQNTREEFQMEKILK 611193

 
>CYP341A7 Bombyx mori nscaf1613 (N-term) continues on AADK01018246.1
probably is completed by nscaf2813 553949-554549
96% to CYP341A6

567987 MIALLLILVGLGWVLVFRYRRRNMYKLAAAIPTPDETNLLVGVAHKMMGNTE 568142

VSSNPFDLEVILKTCLEKDDSHRFFRPGIGNGGIFAP

VSIWRRRRKIMVPAFSPKIVHSFVGIISEQSEKLVSSLSKCVGKGMFSSWPFLSAYTLDSVC

ETAMGVNINAQAKAESELLKSMNRFLNVICERMFHVWLHPDWLFKQFPVFNEHQKCIKVWHEFIDQ

VIQSKREEFQMEKISKDLEVDTHY

DLGSHKSKTLLDLLITFSGDEKGYTNVELREEMLTLTVAGTDTSAVGIGFTLELLAKYPKIQENIFQE

LYGIFDGSERALVKEDLEKMKYLERVVKESLRLFPPVPFIIRKVLEDTRL

553949 SGNVLPAGSGIVVSIWGIHRDPKYWGPEAEHFDPDRFLPERFNVEHPCCYMPFSSGPRNCL 554131

554376 GYQYAMISMKASLSAILRRYKVVGEPEKGPVPRIRVKVDIMMKSVDGCQVALERRPTK 554549

 

 

>CYP341B1 Bombyx mori nscaf2811 76523-85648 (-) 45% to CYP341A4

MLVQLILCIFVALWLLSQRYKKKEMMKVWEQLKNDYTALPLIGHAYMFFGSQEGRHN

MISEPVMAEYVLKTCLEKDDILKCSRFLVGNGSVFAP

VSIWRPRRKILAPTFSPKNLTHFVDIFSKQSSYMVKYLGKAAKTGNFSIWKYINTYSMDSIC

ETTLGVKVNAQGNSEQPFLRAFEIICRLDSSRFCQPWLHNDTVYKMMPQYQQHKDSKDFLCNFIDQ

VIKSKRNSLEEQKDSTEADQ

NAHRNGLKSFLELLIESSGGNKGYTDLELQEETLVLVLAGTDTSAVGVAFTSVMLSRHQDVQEKVYEE

LKEVFGDSDRPIVADDLPKLKYLEAVIKETMRLYPPVPLIVR

KVDKDVTLPTGLTLVKNCGIVINIWAVHRNPLYWGDDADIFRPERFIDTPIKHPAAFMAFSHGPRACI

GYQYATMSMKTATANLLRHFRLRPAEPTDPTYKHEKNKPLRVKFDVMMKDMDNFTVQLEPRYK*

 

>CYP341C1 Bombyx mori BAAB01149680.1 missing C-term nscaf3005

contains non-LTR retrotransposon:BMC1 (AB480244.1) at the end of exon1

possible pseudogene

MIWNLLLLVVLFLLWLSRRSNKNIMKVYKEIGSGFKKMPLVGHTYLLGDC

VSVDPVELDVILKNCLEKDDLMKFSRILTGNGSIFAP

VNIWHRRRKLLNPHFGTKNQNNFMETFIKQSAVLVNNLRKEADNGTFSVWDYLTAYTLDSVC

EATLGVQMNSQAHSNLEFLRSFDVCSSLGAARICQPWLHSDIIYHRLQRYKTYQKNTEYVLDFVKQ †

IVQSKRRQVENEPDSKTQCDKQSD

DNGMKTVLELLILNKTFNDVELQEEAFVMIIAGTDTSAIGISFTLLMLARYPDVQEKVYQE

IQELFGDSERPPEVEDIHRLLYLDAVIKEAMRLYPPAPVIIRKVERETKL

 

>CYP332A1 Bombyx mori

MDVSGPLQLFLIFIIFCLTA

IYLLFNRNYQYWEKRGVPYEKPFFLFGSLSFILRKSFWDYFYELSKRHTGDYVGIFLGFK

PTLMVQTPEIARRILVKDNAHFNNRYCYSSYGVDPLGSLNLFTVK

NPKWSNIRHELSPMFTSLRLKTICELMNVNAKELVLKIQRDYIDNNEDVNLK

ELFSMYTSDTVGYTVFGLRVSALNDPSSPLWFITNHMVKWDFWRGFEFTAIFFVPALARFLR

LKFFSQPATEYIMRLFRTVVDERKKTNQNTDKDLVNHLLKLKENLKLGADI

KLADEIMMAQAAVFILGSIETSSSTLSYCLHELAYHPEEQQ

KLFEEVDDAIKETGKEILDYENLQELKYLSACILETLRKYPPVPHIDRVC

NKTYKLNDELTIEEDIPVFVNVLAIHRNEKYYPEPDQWRPERMIGVTDNDNLQYTFLPFGDGPRFCI

GKRYGLLQMRAAIAQMIHKYKFEAAEPHSTPSDPYSVILSPKSGGRIKFVPR*

 

>CYP337A1 Bombyx mori

MLLLLLISFTLLLIFFWKQNNYWKSRNVKQVTGTLFKFTFGSRSLPEYYKEIYDKHNESQ

IGIYLGRRPAIILKDLRDIQAVLAGDFQSFHSRGIILSEKETLADSILFIDDLPRWKILR

QKLSPAFSSLRLKTMFEGIERSARDFVEFIENSGNDQDLEEMPFNAIYKYTTGSIGAAVF

GVDVDQNTLDTPALNITRKALEPTLKSIMTFFLAGTFPRLIKWLDMMNFDNYETSFIDAV

KKVLENRRAGEKQYDFIDVCLELQNHEVLRDLVTGYEIVPTDELLAAQAFFFFVAGADTT

ANVMHFTLLELSSNPSVLKKLHAEIDEVFQDGKKTLNFEDMDKFKYLEMVVNETMRKYPP

IGLLQRICTKETNLPSNNLRISKDTIAVVPVLALHRDERFYPKSDAFDPQRFAPENFNEI

NKFSFLPFGEGNRVCI

GAKFARLQLRAGLAWLLRKYTLVPQDYKPVKFERSPFAVRDTKAKYRLINRTN

 

>CYP337A2 Bombyx mori

MLPVLVIVSLVAILILYWQSSNYWKKRNVREVNGTVLKFTFGNCSLPEYYKQIYDKYNEN

QIGFHLGASPALVLRDLQDVQAVLASNFQSFYRRGFAVNDADVLGGNMLFLDDLPRWKIL

RQKLSPAFSSLRLKAMYEAIEKTARDFTDYIATDERAIKEPFDAVLKYTTASIGVAVFGL

DEKGESLIDLPLSHVAGNALKPSLKANIVFFIGSTFPRLFKWLNMTFFGEYEDVFIGAVK

KVLKNRRKLDKRLDIVDVYLDMQSSGRLRDVVTGFEMEPTDEVIAAQSFFFYVAGADTTA

NAIHFILLELSANPHVLNKLHAEIDTVLPKGTEVLTFEDIDRLTYMDMVISEAMRKYPPI

GFIQRLCTKDAILPSNNLRISKDTVTVVPILAIHRDERFYPNPDVFDPERFTPEKIKERN

KFSYLAFGEGNRICIGARFSRLQVKACITWLLRKYTLKPQEYKPERFERSAFSLRDTKSK

YEFIRRTN

 

>CYP338A1 Bombyx mori

MFFESFLLNLSVLIVLIVALVFDYVTKFFSYWYVRHVPYKTPIPFFGSDYHRVLGLTNST

DEVVKLYNEHPGDKFVGRLKNRIPDLIVKDPDAIKRMLSTDFAYFHSRGLGLDKSRDVCI

RNNLFYADAEKWTLLRQGLEAVLNGLCREFDIHACLSEANGDTNVQQLLSVVLDSVFDNL

LLGDEGTSIKELRTTLQKRSMIVKLKSYLKNIFPSIYVTFGLSTLPNNVLKNTRKYMESS

KLQRLIDDSGYMHQVSLKDKHVYAFENEFASSTLAL FVTEGYIPCLYTLTALFYELAVNP

QIQEKARNSIEKDKGVNYLDAIIKETMRLHPSHSIISRQCVKMYQYPDSNLTIDRNVTIN

VPVEAIHKDKEHYENPEVFNPERFFDDHGPTKHSYSYLPFGAGPRKCI

 

>CYP339A1 Bombyx mori ESTs CK535081.1, CK535031.1, CK537569.1,

MLMCQVRHLQLHGRLHLLSRFLSRSPNSSQSAIPQQLSKDDLKQEHSPIG

ALPVENKNTNEIFPTARVIPMMLTNKESVV

LPFDDVPGPKSLKYLSTVRQYLSDIGTQLT

AGILTFGVNIGTFINSRKPLKKFSAL

FDEYGPVVRFISPVGNDIVLINHPDHIQKVYTIE

GDCPVRSTLDSLEKYRIEHRNHIYGGLYTL

NGEEWSRQRSIIYTPLHNAVTYHIQGIDDICEYFSQKIYNMRNHQDEIPKDLYKDLHKWAFDCL

GLILFSKKFSMLDTDLVYSQCDMSWMYHSLEKATEAVIKCESGLQWWKILSTPAWYSLVKYCDSLD

SLIGKYVLEAEQAISYKAKEIEEQY

PNSNILINAMLLGQEKMNPEDIATVIMDMLLIGVNT

ITSSTSFLLYYLAKYQKAQKILYKEIQENFPEQKIMDLTKIREQTPYLQACIKETLR

LTPPIPVLTRILPKNITLDKYN

IPRGTLIIMSTQDASLKESNYDDANTFCPERWLKSDSNEYHLFASIPFGYGARKC

LGQNIAETMMSLLTVK

MIQAYKIEYRREPLEYHIHPMYTPNGPIRLRLVER*

 

>CYP340A1 Bombyx mori nscaf2330 1227939-1236477 (-)

MFIPIIVVVVCVLLLFYSIAERHSNVPLCDNYLPVIGHTHMIIGGGK

SGLLQTVKYACEETNKKGGVAILKLGLSNYY

VITDPEDNLTVANGTLQKHFVYQFASNWLGDGLITSS

GETWKRHRKLLNPAFSQQMLNIYTAVFNRKSRNLISAIEIEMKSGPVLIDTVFREMALNTLL

STAFGIEEEDSDFNKKYIHAVDVILALLTRRFQNPLLHYPFFYKLSALKKKEEEVIETILTASKK

IIKNKREALNKERSNENGYAT

ERKFKSMLELLLKDSDGDALTDEEIRDEVDTLILAGSDTSSQLTLVVVMVLGSYPEIQDKVYQE

VASVCGVSDTDVEKHQHPRLVYTEAVLKETLRLYPTVAVVLRKPENEIKL

KNYTIPANSNCVLGIYGLNRHPVWGPDAHTFRPERWLEPGGVPGNPNAFAGFSVGKRNCI

GKTYALISTKIILAHLVRRYKVTADISKIEFKMDVIMTPSDNCYVEFELRK

 

>CYP340A1-de9b Bombyx mori BAAB01213048.1 nscaf2330 1211734-1211555 (-)

NYTIPSDSNCVLGIYGLNRHPVWGPDAHTFRPERWLELGGVPDDPNAFAGFSVGKRNCI

 

>CYP340A2 Bombyx mori nscaf2330 1304617-1314623 (-)

MFILIVLVVVCVVLLFYSIKKSNSNVPLCDNYLPVIGHTHMLIGGGK

KLLRTVKYACEEANKKGGVVILQLGLENYY†

VITDPEDNLTIANGALQKHSFYQFASNWLGDGLVTSA

GETWKRHRKLLNPAFSQQMLNIYTVVFNQESKNLISAIEIQMKSGPVLITAALKEMALKTLL

STAFGIEVEECDFNQKYMHAVDEVMAVLTRRIQNILLHNSFVYKLSALKKKEDELIETITTMSNK

VINSKRRALKNKQESHENGCAS

EKKTQSMSDLLLKGLDDEAFTDKEIRNEVDTLIFTGSDTSSQIMTVVVMLLGSYPEIQDKVYQE

IKSVCGDSDADVDKLQHPR

LVYTEAVLKETLRLYPITPVVLRKTENEIKL

KNYTIPANSNCLLGIYGLNRHPVWGPDAHTFRPERWLEPGGVPDDPNAFAGFSVGKRNCI

GKTYALISMKTTLVHLVRRYKVTADISKIEFKMDVIMVPSDNCYVKFESRK*

 

>CYP340A2-de9b nscaf2330 1296468-1296620 (-)

1296620 GKTYALISTKIILAHLVRRYKVTADISKIEFKMDVIMTPSDNCYVEFELRK 1296468

 

>CYP340A3 Bombyx mori nscaf2330 1376949-1388385 (+)

MLIPVFLIILCVILYYFYWRDKSINNVPLCDKYLPIIGHTHLFIGNTK 48

ILRTVKSICEDTNDKGGVTVARLALQDYY 29 77

VITDPVDNLKIANGTFLKHFAYRFTSHWLGDGLITSS 37 114

GETWKRHRKLLNPAFNQQILNSFIGVFNDESRKLVSEIGNEMAKGPVEVTTPFRQMAFRLLF

LTAFGIPVEDSDFNQKYIHSVDKLLSMLIYRFQNVLLHNSFIYKISGLKKKEEQMVETVHAMSNM

IIKRKREASKNKSPTDEHCYDT

TAHRYKSILDLLLKGLDGDALTDKEIRDEVDTIIVAGYDTSSWVLTLVMMALGSYPEIQNKVYQE

VSSMFGDSEADVDKSHYPGLVYVEAVLKETLRLYPIVPIALRQTESDIELK

NYTIPADSNCVLGIYGLNRHPVWGPDAHTFRPERWLEPGGVPDDPNAFAGFSVGKRTCI

GKVYALMSMKTTLVHLIRRYKVTADISKVEFKMDVLMTPVNNCNVKFELRK*

 

>CYP340A4 Bombyx mori nscaf2330 1319070-1337181 (-)

MFIPTILVVVCVVLLFYSIKKSNSNVPLCDNYLPVIGHTHMLIGGSK

LLRTVKYACEEANKKGGVVILQLGLENYY

VITDPEDNLTVANGELQKHYFYQFTSNWVGDGLVTSA

GETWKRHRKLLNPAFSQQMLNIYTAVFNRESRNLISAIEIQMKSGPVLITAAFKEMALKTLL

STAFGIEEEECDFNQKYMHAVDELMAVLTRRLQNILLHNSFIYKLSALKKKEDELIETIMAMSNK

AINSKRRALKNKQESHENGCAS

EKKTQSLSDLLLKGLDDEAFTDKEIRNEVDTFIAAGSHTSSQLMTVVVMVLGSYPEIQDKVYQE

IKSVCGDSDADVDKLQHPRLVYTEAVLKETLRLYPIAPVVLRKTENEIKL

KSYTIPANSNCMLGIYGLNRHPVWGPDAHTFRPERWLELGGVPDDPNAFAGFSVGKRNCI

GKTYALISMKTTLVHLLRRYKVTADISKIEFKLDALMVPSDNCYAKFESRK*

 

>CYP340A5P Bombyx mori nscaf2330 1270690-1259700 (-)

MFIPIILVVVCVLLLFYSIAERHSNVPLCNNYLPVIGHTHLIIGG

SGLLQTVKYACEESNKKGGVAILRLGLSNYY

VITDHSDSLTVLLGT

VITDPEDNLTVANGTLQKHFVYQFASNWLGDGLITSS

GETWKRHRKLLNPAFSQQMLNIYTVVFNRKSRNLISAIEIQMKSGPVLIDTVFREMALNTLL

IIKNKRESLNKERSNENSYTT

ERKFKSMLELLLKDSDGDALTDEEIRDEVDTLILAGSDTSSQLTxVVVMVLGSYPEI*DKVYQE

VASVCGVSDDDVEKHHHPRLVYTEAVLKETLRLYPTIPLVLRKPENEIKL

KNYTIPANSNCVLGIYGLNRHPVWGPDAHTFRPERWLEPGGVPGNPNAFAGFSVGKRNCI

GKTYALISTKIILAHLVRRYKVTADISKIEFKMDVIMTPSDNCYVDFELRK

 

>CYP340A6 Bombyx mori AADK01002164.1 BABH01020618 nscaf2330 1375106-1359414

MFILIVLVVVCVVLLFYSIKKSNSNVPLCDNYLPVIGHTHMLIGGGK

LLRSVKYICGETNKKGGVARCKLGLDYYY

VITDPEDNLTVANGALHKHFFYQFASNWLGDGLVTSS

GETWKRHRKLLNPAFSQQMLNIYTVVFNRESRNLISAIEIQMKSGPVLISAAFKEMALKALL

ATAFGIEVEECDFNQKYMHAVDEVMAVLTRRFQNILLHNSFVYKLSALKKKEDELIETITTMSNK

VINSKRRALKNKQESHENGCAS

EKKTQSMSDLLLKGLDDEAFTDKEIRNEVDTLIFTGYDTSSQIMTVVVMLLGSYREIQDKVYQE

IKSVCGDSDADVDKLQHPRLVYTEAVLKETLRLYPITPVVLRKTENEIKL

KSYTIPANSNCMLGIYGLNRHPVWGPDAHTFRPERWLELGGVPDDPNAFAGFSVGKRNCI

GKTYALISMKTTLVHLLRRYKVTADISKIEFKLDALMVPSDNCYAKFESRK*

 

>CYP340B1 Bombyx mori nscaf1071 1022390-1040926 (+) 38% to CYP340A3

MLVLLLLGVLLYLFVWSMRLPGTGIPELPGKLPIIGHGLMFFGDGKHIHKTFKWLGEEAI KLGGVVSVNFGPIKVYIVADPDDSAVVATNCLAKGFFYDFSNAYIGNGILCAKLPLWKQQ RKALNPAFKQQILNNFMDIFNNQGRRLIMQLAAHGPGSFDHHHPILINNLESSL
QTLAGYHIDEIADKCDTYVQSVEEFLHIISERFSKIWWYSDYLFSFSDLKKRLDKCTNIIHSYS
LNVSFNIGTRIRNYQPNSLIFSSVYVKMIAV 

QTISLLDFILDQDKSKQFLTDEEIREQIDIFLIASFDTSATALIYLLTVVGSYPEVQQKIYDEIL AEVGDNKDVTKDVLPKLVYLEAVIKETLRMYSVVPAIARKTDIDLKLKNYTIPKGSSIGI MLGTLHQHPQWGPDAHQFRPERWFTENLNVFAPFSMGKRNCIGKVYAMMSMKVLLVHVFR HYKVTGDISNTEHRLGVLLKPATGHHIKLDKRNKT*

 

>CYP340C1 Bombyx mori nscaf1071 1060794-1043647 (-)

MLHAVIWFLFCVTVYAYWRTVCRRRNIKLPSPPDLPRRLPFIGHAHIFF

DAWKVIKWLSKETDKRGGVASISMGPHKGF

CVTDPDDCLTISNVCLKKDYYYSFATPWLGNGLLTGS

VATWRLHRRLLGPAFSQRVLNGFISAFNCKSRALVTQLEDRVGRGP

FDHVPYLSFNNLETIC

QTALGIKMEDHSAVNQQYEQALHDIFAVLTERFQKFWLHYDFVYNRTKLKEREDQIIKVLHNM

AIKKIYKKNPYSIRLLTL

GMFLDVSDKSKTFIDIILETCGGAFSDKDVREEVDNIIFAGHDTISTVLTTALSLLGSHPDVQDKVYNELV

SRRVLGDAERDVTKEDYLRLEYLEAVLKESMRMYPVAPVIARYSDAEVKL

KNYTAPAGSGFILLLWGVHQHRIWGADADQFRPERWLEAATLPDPSFFAGFSTGRRSCI

GKVYAMMSMKTTLSFLLRRYRVSSDVTDLEFKLEAILRPHRGHYIAIERRSKDDK*

 

>CYP340D1 Bombyx mori nscaf2330

MIILTVSLVIIIAVLGSWMLFYRHYKDSPPFHKGLLPIIGHSYLFMGDTT

SIWRNLKNLAQDCTDKGGVLQIIMGFKRHY

IITDPKDALTVANACLQKHFVYSFGSRWLGNGLITGS

GEIWKRHRKLLSPSNSPQILNTYLGIFNENSRQLVTDLAPMVGEGLKDLSFHIRKMAMNTIF

RTAFGVYTNEDENFTKAYMSAVDEILTIITKRFTRVWLQIDFIYNLTSIKKREDELIRIVNEMSNK

IIARKRSELASGVAAANET

DNKYQGLLDLMLKLAKEDALTDQEIREEVDTAIMAGFDTSSWILVYVLVKLGSFPEVQDRAYNE

IMDVFGDSDRDLEKEDLSKLVYTEAVLKETMRLYTMGPVSLRHIEEDVKL

KNFTLKAGTDCSISLFGINRHTVWGEDVNEFKPERWLDPQKIPDNAFAAFSIGKRSCTG RAYALTLMKINLAHLLRKYKISGDVSKLDFKFNFIIKPISGSEIGLEYRK

 

>CYP340E1 Bombyx mori CK533198††nscaf2330 BABH01020583.1

1206476 MLFSLFFFIFILSLAVLYSALVKKGRSDDPPLLVNYRPVVGHLFYLFC 1206333

 

1202984 VITHPETAVTVADSTTSKHYIYSFFRRWLREGLLTSS 1202874

GGVWKRHRKLVSPSFNLRVLYSFMGVFNSGSKKLINHFRDEMNKGPLNVLPLIKVVSLESICR

ISENTFGIEESSDLEFKKKFMIAVDKMLFIVIERIRKIWLHNDFLYNYCTSLKKEEDNVV

KVLTDMTNK

VLHKKQALLKMKSPTEQPEQSKKS

EKKFKALLDLLLDLSAEDSLTGPEILEELNTAVFGGYDTTSCTLTYVLMNLGTYQDVQQKMYEE

IKNVFGDSERDVESDDLSKLVYTEAVIKESLRLYPIAPIIFRELDQDVKIN

NYTLKAGRGCAINVYGINRHAMWGDDADKFRPERWLEPDGVPSVYYAFATFGVGKRACI

GRTYAMMSMKTTLVHILRQFRIAADITKIEFKIEIILVPQTPCYLTLERRS*

 

>CYP340F1 Bombyx mori BAAB01090784.1 nscaf2902 BABH01001890.1
nscaf2234 BABH01044125.1 AADK01006838.1 43% to CYP340D1 runs off the end

MLGIVLFLIILFVFLWKLTVEVKENSPPTFSGWIPIIGHLYKIIGGRE

RLSRTLFDLGEECERKGGVIGFYVGAQRHF

VIVDPEDALTAANSSLSKHAIFKQAEPWLGNGLITSGGE

24762 GSTWKMHRKLMNPAFHLNVVLGYLDLFNNQARSLVENLEDEVDKEPFNVFQYLSQTSLKTIC 24947

26308 STAFGINVDQDSEFCNKYIHACEKLIGIQTRKFQNIWLQS

DLIYRLSGFKKKEDELIKYVHQLSNS 26505

IVQRKRMERKERHKEVKSGIVIIKINNNETT

26930 SLIDLLLNLSGDQVFSQEDIREEIDTVIVAAFDTTSWSLTYALLVLGSMPEIQEKVXXX

IEEVLGPTDRNLDKDDLQKLVYTEAMIKEVLRLYNVLPAVLRDITEKVQL

NYTMYPGDQCMILINNLNRHKAWGLDVEQFRPERWLGEAELPEHHSAYFATFGIGRRFCI

GRIFAMYSMKTILVHILRRYSVKSDLAKLRLTSDYVTKPVSGHFITITRRINAVN*

 

>CYP365A1 Bombyx mori BABH01031525.1 BABH01031526.1

MFGFRRSLVEAVVFLSWLLEDWTFGSSVLWHVYFTLWICSLVLTVTTYDH

DYWKDRGIFSPPALPVVGHILSVVLFREQGGMCFKRIYDTYTDQRFLGTH

QFYQRTLVIRDPELIKRVCVNDFQHFVDRGFFFNKEVDPLAGSVLFLRGN

EWKKLRAKISPIFSPNKLRGMFPLIDNTADEF

DAYALVDSEELVGGYTADAIVPCAFGLKSLVMDKPDDPFAVAL

QAFYEKSLYNVFEKTMRQFWPAFVLFFRMRIIPKKTHDFFHNVVTSVLRA

RESGEQEKRGDFIDMMMNLRNDDANNKKTDDPDEVEITDIVISANAFIIF

LGGFETTSSTLAFLFLELAADQRVQEKMRQEIREVLSRNDGKMTFEILQE

LIYMEMVIQ

ETLRLYPPFPSIQRMCTKDYLIPGTEKVVEKGTIVLFPTLGIQRDNQ

YFERADDFYPERWSGGFVPPPGVYMPFGDGPRYCIGKRFAMIQM

KCCLVKVLQYVVITPASPAQPRTRPFAADCCSPQTLHPDNSLVKLSLL

 

>CYP366A1 Bombyx mori

MLIMSEVLWCLLMLCACVWWWCSAPRRTRKLLAALPSFPQLPLLGNIHQIPRNSI
NLFQFLEKIAVTCDTTEMPFVFWLGPRPIL
FISDPEDVKGVNNAFIEKPHYYSFAKVWLGNGLVVAP
PEIWKNSIKKLSGTFTPSIVEGYQEVFAGRAADLV
QRLKARTTEEPFDIMHDLAYTTLEAICQTAFG
FPKISESIVTKEYYDAFHRCLELLIRRGLNPLLHLDFMYRLTPASKELQKCVGILHNVSNT †
VITKLIQERECAKQDNRNEI
VPNRRRFKSFLDLMLEMQVSTPELSVEQIRSEVDTVLFGGHETVATTLFYALLMIGRDKNLQDKLYNE †
VRDVVGDGGRPVTGADLPRLRYCEATVLETLRLFPPFPAVLRMADKDLQLSSGKCG
VPRGTVCAVSAMVMGRARRLWGPDAAEYRPERWLAPPHAQPAAFLAFSYGRRACI
GKNYAMAILKTVLASCVRELEFTAEQAELQLKLDVVLRPASGHLLQVKTRNLK*

 

>CYP367A1 Bombyx mori

MLWPVIYLLALVFAYWPYWRWKNRRLLRLSASMPGPRALPIIGNGLLIVVNTGGKFNKTI

LFRTYGDYCKIWLGPELNICVKNPDDIR

LLLTSNKVNQKGPAYEIMKAAIGPGILTG

GPTWRNHRKIVTPSYNKRAVKLYSAVFNREAEVLANLLLKKQSGVTFNVYYDVVEITTQCVC

QTLIGLSKDDSRNVDGMSDLILETQN

LYELLFTKMTVWWLQIPFVYWITGRKATENAYVKKIDRLTSDFLKKRRTALKGGNVDEESMGIVDRYI

ASGELTEQEIKWETMTLFTTSQEASAKITSAVLLFLAHLPDWQEKVYKEIVEVIGSGRND

VTAEHLKHLHYLDMVYQEALRYLSIAALIQRTVEEEITINNGKFTLPIGT

TLVIPIHDLHRDPRYWDEPLKVKPERFLPENVKKRSPNVFIPFSLGAMDCLGRVYAEPLIKTLVVWAVRE

VQLEAEGCVEDLKLHVAISVKFANGYNLKVKPRI*

 

>CYP367B1 Bombyx mori BABH01042142.1 BAAB01109192.1 AADK01004845.1 BABH01044255.1

MISYMILIVIVFALMWSGWKQKNKKFMEMANQFPGPQALPFIGNALRFMCEPE

ELISVIKELLQVYGEASRFWLGPNLNVIINNPDDLK

ILLSSSKTSTKGPQYKYMAHVLGGGILSGS

GVTWRKHRKIATPNYGKKVVDSYEKIFNEEVHLLLKKLRNIPSEQEFDIYNKIVQT 7649

TSYCVC 7668

QTLLNLSKEQVTEIPHLQEIIDCTPR

NYDIVFDRMIKWYLQIDPVFWMTKSYQDQKHFVALITEFSKAIIENRKREINKIYLNNEES

INRQLGVIDRFILSEELTQEELIKETFTIFTS

SQEATAKICSFVLLMMAYHPKSQ

EKLYEEITKIIGDKDRCVTNEDFKQMPYLDMVFKEVLRLFPIGSMLQRTINENIRI
SSGTLPAGCSLVAPIYHLHRDSRFWTRPDDFDPERFNPVNTKLRQPNCYIPFSLGPMDCL
GRYFGTRLVKMICVRVLREFEVTTSRTYKDLKLSIAISVSPLDGFPVKLHPRKIKEKQ*