On Nov. 13, 2010 I began editing ver 2.3 sequences.  The new comments are in

Green highlight.

 

On Jan. 6, 2010 there are 366 tomato P450 sequences and 93 are pseudogenes.

There are 11 partial sequences due to sequence gaps or possible assembly errors.

That gives a gene count estimate for full-length intact genes of 273.

This count includes the 11 partials mentioned above.

One gene on scaffold06070 is split and continues on scaffold 02027.

The two can be joined by an EST.  A pseudogene on scaffold00777 is broken and continues on scaffold05428.  The whole pseudogene is found on BAC contig C08.17_contig39 161-166 kb.

These four sequence fragments are combined and counted as two sequences.

 

On March 13 I found 4 more tomato genes and 4 more pseudogenes that are orthologs

Of potato genes. These potato geens were missing obvious orthologs so they were specifically searched for to fill in gaps in the collection.

 

On march 24, I assigned temporary names to all the tomato sequences.

The tomato filter has been sent to Ioannis for ver 1.03, waiting on the blast search with the new filter to find any new P450s in the ver 1.03 assembly.

 

March 27 finished finding orthologs by best reciprocal Blast hit between potato and tomato.

Tomato had 172 pseudogenes and 275 non-pseudogenes. 

Two pseudogene pieces were from one gene so the corrected pseudogene count = 171

Four non-pseudogene pieces form two genes so the corrected tomato gene count = 273

Potato had 401 non-pseudogenes. (note: 1 pseudogene was included in the table potato.byconservation since it matched CYP71x@5 from tomato.  The genes CYP704A.4a and CYP704A.4b are identical copies and probably represent one gene. This would make the potato non-pseudogene count = 400.

 

The P450s in the potato.byconservation table were compared to tomato P450s and 246 pairs

Were identified as orthologs (including one potato pseudogene CYP71y.1P that matches tomato CYP71x@5). 

23 of these were potato genes matching to tomato pseudogenes.  This means 222 non-pseudogenes from potato matched 222 non-pseudogenes from tomato. 

 

This means that 273-222 = 51 tomato genes do not have a potato gene ortholog.

1 tomato gene has a potato pseudogene ortholog.

Of the 50 other tomato genes without a potato ortholog 28 have best matches to potato pseudogenes.

155 potato genes do not have an ortholog in tomato

 

D. Nelson

 

 

>CYP94B17 CYP94B@1 scaffold00002 59% to CYP94B11

587854 MVMVTFLTTYPFFILPFFCLTLILYVSYVIVEHYQQGGRGFEGPPTYPVIGCLIPFYKNR 588033

588034 YRLLDWYTHLLSHSQTKTIVIDRLGARRTIVTANPHNVEYMLKTNFDNFPKGKPFNEILG 588213

588214 DFLGNGIFNVDGEMWYKQRKMVSHEFTGRCLRECVMNALKEEVENKLLPMLDLMEAENRA 588393

588394 FDLQDLLRRLGFDVVCKVSLGFDPCCLNDDSLPFSPLLDAFERASQICAGRGAAPVSAIW 588573

588574 KVKRLLNIGSERQLRLAIDQIHSSVGNMIRERKIQMRGETEQDINISKVDLLSKLLLAAN 588753

588754 FDDEEVRDMVISFIIAGRDTTSAAMTWLFYLLTLHPEVENELVSKELRFIEAETLTKHEI 588933

588934 LRDMKFLKACLCETMRLYPPVAWDSKHAIVDDILPDGTRIKAGNRVTYFPYGMGRMENLW 589113

589114 GKDRLEFKPERWMHNTEEDEGASNLYKFPVFQAGPRVCLGKELAFIQMKYVVSSILKRFH 589293

589294 ITPASSDPPLFLPLLTAHMAGGFNIFVHKTKNI* 589395

 

>CYP704A70 CYP704A@19 scaffold01167 97% to CYP704A.17P potato

2106018-2109154 (-) strand

2109154 MDILTMNPISIFATFPSISLSFLVLIVFFMSKLGEKQKGKKKYHPIVDSTTKQLINFHRI

HDHMADLAAKYKTYRLESPFRREIYTSDPANIEYILKTNFDNYGK (0)

GDYHHEILKDFYGDGMFTVDGEKWKEQRKVSSPEFSKRVIREVNCVIFSKNAVKLANIL

DESANSKETVDIQ (0)

DLLLKSSLDSVFQVAFGIELDSVCGSCEEGANRFIKALDDASEMSLLRYIDMFWKIKKAL

NFGSEAKLRKSMEIIDEYMYKLIRSKAEQLSQQRDTT (0)

EKAENIMSRFWHYSSTNPKYLRDILINFMGGGKDTTGTTLSWFILMLCRYPHVQEKLA

EEIKETTNTKGGSGTISDFAANLKEEAVDKMHYLHAVLSETIRLYPAIPV (0)

NAKVCLQDDVFPDGYSVKKGDMVAYPPYAMGRMKYLWGDDAEEFKPERWLDEN

GSFKQESPFKFTAFQ (0)

AGPRICIGKEFAYKNMKITAAVLMQFFVFKLSDDTKPVNYKTMLQLHIDGGLHVRAFRKINNY* 2106018

 

>CYP704A70 CYP704A@19 scaffold00040 ver 1.03 = scaffold01167 2106018-2109154 (-) strand

(adjacent to scaffold01376 gene)

2121793-2124929 (-) strand

97% to CYP704A.17P

2124929   MDILTMNPISIFATFPSISLSFLVLIVFFMSKLGEKQKGKKKYHPIVDSTTKQLINFHRI  2124750

2124749   HDHMADLAAKYKTYRLESPFRREIYTSDPANIEYILKTNFDNYGK (0)

2124503   GDYHHEILKDFYGDGMFTVDGEKWKEQRKVSSPEFSKRVIREVNCVIFSKNAVKLANILDESAN  2124312

2124311   SKETVDIQ (0)

2124140   DLLLKSSLDSVFQVAFGIELDSVCGSCEEGANRFIKALDDASEMSLLRYIDMFWKIKKALN  2123958

2123957   FGSEAKLRKSMEIIDEYM  2123904

          YKLIRSKAEQLSQQRDTT (0)

2123772   EKAENIMSRFWHYSSTNPKYLRDILINFMGGGKDTTGTTLSWFILMLCRYPHVQEKLAEE  2123593

2123592   IKETTNTKGGSGTISDFAANLKEEAVDKMHYLHAVLSETIRLYPAIPV (0) 2123449

2122906   NAKVCLQDDVFPDGYSVKKGDMVAYPPYAMGRMKYLWGDDAEEFKPERWLDENGSFKQES  2122727

2122726   PFKFTAFQ (0) 2122703

2121984   AGPRICIGKEFAYKNMKITAAVLMQFFVFKLSDDTKPVNYKTMLQLHIDGGLH  2121826

2121825   VRAFRKINNY*  2121793

 

SL2.30ch12 10998500-11001636 (-) strand

 

>CYP704A71P CYP704A@17P scaffold01376

1048-1311 (+) strand

84% to CYP704A.16P

221 NDVLEYYYGDGIFA

MDGDKCKEQRKLSSPDFSKRVLRDVNSIVFRRNAAKLANIMNETANSNNTVDIQ

NLLLKSSMDSLFQVALAFGIELESVCRSNKEGSNRFIRALDEVSELSFWRYIDLFMKIK

KFLNIGSEAKFKRSAQILHKY

IYNLINTKTEQLSHDSS

RKEENILSRFWHYSTTNPKY

1048   LRDILVNFMGIGKDTTGTTLVWFIWSLCKHPQVQEKVAQVIKDATKSNIGTTISDLASHL  1227

1228   NEEAMYKMHYLQTVLSETLRLYPCIPL  1308

       LLPDGYNVNKGDMVAYQPYAMGMMKYIWGDDTREFKPECW 1528

 

 

>CYP704A71P CYP704A@17P scaffold00040 ver 1.03 = scaffold01376

MDFVVFCLSFVIISVLLFL &

MSSSNVEKKRKR

2087881   YHPIGDSTLKQLMNFDRIHDHMTSLAAKYKTYRLESLFRREIYTSDPIEYILKTNFDNYGK (0) 2088063  

10971906  NLMGNDVLEYYYGDGIFA & 10971959

10971962 2094741 MDGDKCKEQRKLSSPDFSKRVLRDVNSIVFRRNAAKLANIMNETANSNNTVDIQ (0)  2094902

          NLLLKSSMDSLFQVALAFGIELESVCRSNKEGSNRFIRAL  2095100

2095101   DEVSELSFWRYIDLFMKIKKFLNIGSEAKFKRSAQILHKYI  2095223

YNLINTKTEQLSHDSS

2095458   QQRKEENILSRFWHYSTTNPKYLRDILVNFMGIGKDTTGTTLVWFIWSLCKHPQVQ  2095625

2095626   EKVAQVIKDATKSNIGTTISDLASHLNEEAMYKMHYLQTVLSETLRLYPCIPL  2095784

2095885   LLPDGYNVNKGDMVAYQPYAMGMMKYIWGDDTREFKPECW  2096004

2100380   AGPRICIGKEFAYRQMKITAAVLLRVFIFKLTDELRTVIYKTMIQLHISGGLHVRAMQRIDQN*  2100562

 

SL2.30ch12 10965687-10977792 (+) strand

 

>CYP704A71P CYP704A@18P scaffold01167 81% to CYP704A.17P

2084891- 2085082 (+) strand

AGPRICIGKEFAYRQMKITAAVLLRVFIFKLTDELRTVIYKTMIQLHISGGLHVRAMQRIDQN*

 

Probably part of CYP704A@17P

 

 

>CYP704A71P CYP704A@16P scaffold01167 81% to CYP704A.17P

2073947-2074147 (+) strand

EKKRKRYHPIGDSTLKQLMNFDRIHDHMTSLAAKYKTYRLESLFRREIYTSDPIEYILKT

NFDNYGK

 

SL2.30ch12 10965687- 10965887 (+) strand

This is probably part of CYP704A@17P

 

>CYP86A69 CYP86A@1 scaffold00777 71% to CYP86A2 Arab.

MDISTG

1610363 MMIVAIVVAYLLWFKSITKSMKGPKGPKIWPIVGSLPGLLENGNRMHEWIAENLRVCTGT 1610542

1610543 YQTCICAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGEGIFNSD 1610722

1610723 GDTWLFQRKTAALEFTTRTLRQAMGRWVNRAIKNRFCPILEMAQVQGKPVELQDLLLRLT 1610902

1610903 FDNICGLTFGKDPETLSPGLPENIFATSFDRATEATLHRFIIPEFVWKLKKMLGLGVEVS 1611082

1611083 LSRSLKQLDNYMTDIINTRKLELMNHHNGGPQHDDLLSRFMKKKESYSDKFLQHVA 1611250

1611251 LNFILAGRDTSSVALSWFFWLVSLNPRVEEKILIELCTVLVETRGNDTSKWLEEPLVFEE 1611430

1611431 VDQLTYLKAALSETLRLYPSVPEDSKHVISDDYLPDGTFVPSGSNITYSIYSTGRMKFIW 1611610

1611611 GEDCLEFKPERWMSKDGNKYQVQDAFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRH 1611787

1611788 RLAVAPGHKVEQKMSLTLFMKYGLVMNVNPRDLTPILAKI 1611907

1611908 ENFCKIDHSCGGEHMINNGINQPGATAVNGIAA* 1612009

 

SL2.30ch08 61445523-61447169 (-) strand

Extended N-term

 

>CYP51G1 scaffold02227 82% to CYP51G1 Arab. DB720389.1 = N-term, AI490746.1 = C-term

2171200 MELGDNKILNVGLLLVATLLVA

2171266 KLISALIMPRSKKRLPPVVKAWPIVGGLIRFLKGPVVMLRQEYPKLGSVFTLNL 2171427

2171428 LNKNITFFIGPEVSAHFFKAPETDLSQQEVYQFNVPTFGPGVVFDVDYTIRQEQFRFFTE 2171607

2171608 ALRVTKLKGYVDQMVTEAE (0) 2171664

2172433 EYFSKWGESGEVDLKYELEHLIILTASRCLLGEEVRNKLFDDVSALFHDLDNGMLPI 2172600

2172601 SVIFPYLPIPAHRRRDNARKKLAEIFANIINSRKRTGKAENDMLQCFIDSKYKDGRPTT 2172777

2172778 EGEITGLLIAALFAGQHTSSITSTWTGSYLLTNDKYMSAVVDEQKNLMKKHGNKVDHDIL 2172957

2172958 SEMEVLYRCIKEALRLHPPLIMLLRSSHSEFSVTTREGKEYDIPKGHIVATSPAFANRLP 2173137

2173138 HIFKNPDTYDPDRFGPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHLLRNF 2173317

2173318 EFELISPFPEIDWNAMVVGVKGEVMVKYKRRKLSVE* 2173428

 

note gray region appears 39 times in the genome

 

>CYP51G14P CYP51G@1P scaffold06818 CYP51GxP N-term pseudogene 71% to 51G1 tomato

7745413 IELDDNKILNVELLFVATLLVAKLISTLVMPRYK*CLPPVIKAWPIVDG 7745559

7745560 FKQKYPKLGSVTLNLLNKNITFFIGPEVSAHTFKAPKT 7745673

 

SL2.30ch10 38254360-38254620 (-) strand

 

>CYP51G12P CYP51G@2P scaffold01945 CYP51GyP N-term pseudogene 74% to 51G1 tomato

2735517 IELDDNKILNVGLLLVATLLVAKLIYALVMPRSK*CLPPIIKAWPIVGG 2735371

2735370 FRQEYPKLGNVTLNLLNKNITFFIGPEVSAHIVKAPKT 2735257

 

SL2.30ch03 31749343-31749603 (-) strand

 

>CYP51G13P CYP51G@3P scaffold05083

739439-739672 (+) strand

54% to CYP51G1 potato

739439   MELGDKMILNM*LLFVATLLVAKRISTLNIP

QSE*HLPQVVKAWTIYGGFR*EYPKLGS

VLTLNLLNKYITFFIGPEVS  739672

 

SL2.30ch07 20612556-20612789 (-) strand

 

>CYP73A96 CYP73A@1 scaffold03897  68% to CYP73A24 tomato, 78% to CYP73A78 Vitis, 87% to CYP73A27

MAKFINK

3077142 MTIYSILFTIIFISCSKLLSFPLNNISLVVLPILPLIFYFLYAN

3077010 NSQITLPPGPRPVPIFGNWLQVGNDLNHRLLATMAQTYGSIFLLKLGSKNLVVISNPELA 3076831

3076830 NQVLHTQGVEFGSRPRNVVFDIFTGNGQDMVFTIYGDHWRKMRRIMTVPFFTNKVVHQYS 3076651

3076650 DMWENEMDLVVDDLKKLKHEGIVIRRRLQLMLYNIMYRMMFDDKFESLDDPLFIEAT 3076480

3076479 KFNSERSRLAQSFDYNYGDFIPLLRPFLRGYLNKCKDLQTRRLAFFNNYFVEKR (2)

        KLMAENGEKHKISCAIDHIIDAQMKGEISEENVLY 3076120

3076119 IVENINVAAIETTLWSMEWAIGELVNHPNVQQKIRDEISTVLKGKSVTESNLHELPYLQ 3075943

3075942 ATINETLRLHTPIPLLVPHMNLDEAKLGDYTIPKETKVVVNAWWLANNPAWWKNPNEFRP 3075763

3075762 ERFLEEDGGTEAAVAGGKVDFRYLPFGMGRRSCPGIILALPILGLVIAKLVSNFEMQAPS 3075583

3075582 GEGKVDTSEKGGQFSLHIAKHSTVVFKPVAA* 3075487

 

SL2.30ch05 58159086-58160762 (-) strand

 

>CYP73A97P CYP73A@2P SL2.30ch01 (+) strand new pseudogene

42806420   LVGKMSIFSVFLTIFSC*GVISILFSFSINSSTLVVLMILPSDFSFL  42806560

 

>CYP78A77 CYP78A@4 scaffold03897 67% to CYP78A40 Vitis

3229872 MTTNTEKLWVFALATKYNFFNPINSILFALILSFVWFIINIIYWTHPGGPAWGKYNKL

3230046 SKYLLVKNPIPGPNGLPFIGSMFMMTGLAHQKIAIMAQLFKAKRLMSFSLGETRFIVTCN 3230225

3230226 HVVAKQVLNSKSFVARPVNESAYGLMFDRAIGFAPYGVYWRTLRKIASTHMFCSKQIKTS 3230405

3230406 EAQRFEIAKQMVEIFNGRSEGLRVRDVVKKASLNNMMCSVFGRKYSLVDYFNDEMKEVSE 3230585

3230586 LVDEGYDILGILNWSDHLPWLAEFDPQKIKYRCERLVPKVNRIVGRIIDEHRAQPSNVHR 3230765

3230766 DFVDVLLSLQGVEALSDSDMIAVLW (0)

3230926 EMIFRGSDTVAIL

3230965 IEWILARMILHPDVQSKVQEEVDRITEKSRPVKESDVTNMVYLQSVVNEVLRLHPPGPLL 3231144

3231145 AWARLSIEDTIVDGYHVPAGTTAMVNMWAITRSEEVWSEPLEFKPERFMNQIEPVVFSVL 3231324

3231325 GSDLRLAPFGSGRRSCPGKTLGLTTVTFWVASLLQEFKLKTADGSKTVDLSE 3231480

3231481 VLRLTCEMKTPLMVKVQARNLTN* 3231552

 

 

>CYP82W1 CYP82M@3 scaffold06019 53% to CYP82M1v1 Nicotiana tabacum

415202 MEIHILSHVEAIIGILVFFFLLFLIRKAKTWKNSKKFGPAPPQLPGAWPIIGHLPQILSN 415023

415022 TLDGRNRINKDGEIPLAHTLGALADKYGPVFTVRQGMFPIAVVSSYEAIKECFTTQDKNL 414843

414842 ANRVATCSCKYLGYDHANLTFANYGPYWRMVRKLVVNNLLSSKSLERLKHVRISEVESSI 414663

414662 KELYTLFVANEAKNVPTKVDIGHWFDDMMLNITVKMIGGKRYSQ (0) 414531

       VNNKEEEKEEAERFR

       KAFNETMYYIAIVGIEDAFPFPLLQWLDLQGNIKVMKRIADEMDVILQRWLDDHTNKRKN

       NESNDDQDLIDIMLTELDKDDFQYGYSRETIIKATML (0)

412885 TIVSDATHTTAVHLIWIIACLLNNKHVLEKVHEEIDTKVGKDRWVEDSDIKN 412730

412729 LMYFQATIKEVLRLYPPSPMLVHEALADCQVLGYHISKGTRLFVNVWKLQKDSKFWPEP 412553

412552 EKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITMAMQVTYLSIARLLQAFDFDL 412376

412375 PNNDPLDMTEGPGFTAVKKVPLEVVVKPRMLPMYYGT* 412262

 

>CYP89A69-de1b CYP89A@5P scaffold06019

913731-913868 (+) strand

95% to CYP89A.2 = CYP89A75

913731 AFDIIGNKEIKMMPFGAGRRVCPGYLLALLHLEYFVANLV*HFQWK  913868

 

42261217 NFNPDRFLS

42261260 AFDIIGNKEIKMMPFGAGRRVCPGYLLALLHLEYFVANLV*HFQWK 42261397

GNNVDLSEKLEFIVTMKNPLCAHIRPRVNKT* 42261494

 

SL2.30ch06 42261217-42261494 (+) strand

 

>CYP89A69 CYP89A@6 scaffold06019 55% to CYP89A39 Vitis

915173 MELWLIILILSLIITLCISFKS

915249 NKQKKFPPGPFAFSVITGLLRANADIELILRDLKTKYGPIFNLRIGIGFRRPSIFVASH 915425

915426 SLAYQALVQQGAVFSDRPKAAQTSVSLQSCRFNISSAPYGPSWRLLRRNMVSEILHPSRI 915605

915606 KSYSKVRSRVLTILIQQLRSDSAATEGIRLIDHFHYATFYLLVLMCFGENIDE 915764

915765 AQVKRINDVQRRWIQSAGRFINLSFFPRSLQKIIHRKKWKELLQLIQEQEC 915917

915918 VFVPLIEARMKAKTEEDVVAYADTLLNLEFPEKKRKFNQGEIVSLCSEFLTAGTDTTATS 916097

916098 LQWIMANLVKYPSIQEKLYQEISEIVSRENSKPDGLKEEDLEKMPYLKAVILEGLRRHPP 916277

916278 GHFLQPHTVTEEVELNGYVIPKDVAVNFMVADMGLDPQVWENPLDFNPDRFLSAGGHDKE 916457

916458 VFDITGVREIKMMPFGAGRRVCPGYGLAMLHLEHIVANLIWHFEWKAVDGNNVDLSEK 916631

916632 LEFTVMMKNPLCARIRPRVNQPT* 916703

 

>CYP94C29 CYP94C@2 CYP94C scaffold06019 61% to CYP94C1 Arab.

1099279 MATILFFLILAIVLSILLFLSRLKPYCECEICKSYLNSTWSLEFKNLCDWYSYLLKKSPTGTIHVHVLGN

1099489 VITSNPNNVEYMLKTNFDNFPKGKQFSTILGDLLGRGIFAVDGEMWKFQRKMASLELGRV 1099668

1099669 SIRSYAFDIVSDEIRNRLIPLLESNIHTVLDLQDVLRRFSFDSICKFSFGMDPGCLKL 1099842

1099843 SLPDSDLQESFDLASKLSAERAMTVSPLVWKIKRSLNIGSEKKLKEAIEKVDVLAEEVII 1100022

1100023 QKRKNDFSSQNDVLSRFMRNIDDDKLLRDIIVSFLLAGRDTVASGLTTFFWLLA 1100184

1100185 QHPHVINEIRAESNRVMGKTVNGTLATFEGIREMHFLTAAIHESIRLFPPVQF 1100343

1100344 DSKFCQEDDTLPDGTFVAKGTRVTYHPYAMGRMEGIWGKDCLEFKPERWLEDGVFKAQCP 1100523

1100524 FKYPVFQGGVRVCLGKDLSIVEMKSVALALIRQF 1100625

1100626 DFQVHLAKDQAPKFMPGLTATVRGGLPIMVQKRREQ* 1100736

 

>CYP71AH9 CYP71AH@1 scaffold06019 75% to CYP71AH1 tobacco = M01000002337

MSFIFLLK

2313605 MLACLFLFLFILFSLTTKKNKAKKLLPSPRKLPIVGNLHQLGKLPHRSLQKLSHEYGDFI 2313426

2313425 FLQLGSIPTLLVSSADVAKEIFRVHDVAFAGRPPLYAAKRLSYNCCNVSFAPY (1) 2313267

        GNYWREARKILALELLSAKRVESFSSIRDEEVSRLIQE

        IGNSLNSSINISALALTLSNNVVCRVAFGKGSDDESGYDNGGKKFHEILYDTQELLGEFN

        IADYFPKMAWINKFNGLDERLEKNFRELDKYYDKVIEDHVDSRNWIKEKDDEDLVDVLLR

        IQKDPNQDIPLQDSHIKGLLA (0)

2311639 DIFVAGTDTSATTIEWTMAELILNPKVMKKVQQEVRQVAKGKTKVHETDLYKL 2311481

2311480 EYMKLVIKEALRLHPPAPLLIPRVTTSTCKIMDYEIKENTRVLINATAIGTDPKYWENPL 2311301

2311300 TFIPERFMNKDIDYKGQSCEFLPFGAGRRGCPGINFSVPLVELAIANLLFHYDWTLPH 2311127

2311126 GMKPKDLDMEEALGLTMHKKIPLCLSASYYYDL* 2311025

 

SL2.30ch06 43681048-43683652 (-) strand

 

>CYP86A33 ortholog scaffold06019 97% to CYP86A33 potato

66% to CYP86A22 Petunia hybrida

2719431 MDPILVYSGIIASITAYFLWFYLLAQRLSGPKVWPLVGSLPYTFLNRRRFHDWISQNLRS 2719610

2719611 TGVSATYQTCTICIPFLAWKQGFYTVTCHPKNIEHILRTR (2) 2719730

2719994 FDNYPKGPTWQNAFDDLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMNRWV 2720155

2720156 NRTIRTRLWVILDKAAKEKNPVELQDLLLRLTFDNICGLTFGKDPETLSPKMPENPFAIA 2720335

2720336 FDSATEATMQRLLYPYFLWRLKKFLGIGAEKRLQKSLKVVENYISEALDSRKESPSDDLL 2720515

2720516 SRFMKKKDINGNSFPSDVLKRIALNFVLAGRDTSSVAMSWFFWNVMNNNHVENKIIEEIS 2720695

2720696 NVLKESRGVNHEKWTQEPLNFDEADKLIYLKAALAETLRLYPSVPEDFKYVVSDDVLPDG 2720875

2720876 TWVPAGSTVTYSIYSVGRMKTVWGEDCMEFKPERWLSTGGDRFEPPKDGYKFVAFNGGPR 2721055

2721056 TCLGKDLAYLQMKSVAAAILLRYRLLPVPGHKVEQKMSLTLFMKNGLKVYLNPRQLEPAV 2721235

2721236 PKIAMSA* 2721259

 

>CYP73A24v1 scaffold06019 CYP73A24v1 = M01000000227, blue part from ESTs, 94% to CYP73A47v1

3240192 MDLLLLEKTLIGLFFAILIAIIISKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE 3240013

3240012 YAKKFGDVFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT 3239833

3239832 VYGEHWRKMRRIMTVPFFTNKVVQQYRGGWESEAASVVEDVKKNPESATNGIVLRKRLQL 3239653

3239652 MMYNNMFRIMFDRRFESEDDPLFVKLRALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK 3239473

3239472 ICKEVKEKRLKLFKDYFVDERK 3239407

3238680 KLANTKSMDSNALKCAIDHILDAQQKGEINEDNVLYIVENINVA 3238549

AIETTLWSIEW

GIAELVNHPHIQKKLRDEIDTVLGPGVQVSEPDMPKLPYLQAVIKETLRL

RMAIPLLVPHMNLHDAKLAAYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVE

ANGNDFRFLPFGVGSRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKLDTSEKGGQFSL

HILKHSTIVMKPRSF*

 

SL2.30ch06 44616532-44618175 (-) strand

missing the C-term

Solyc06g082540.1.1    SL2.30ch06    44616493    44618175    -    1    Cytochrome P450 cinnamate 4-hydroxylase

 

>CYP73A24v2 scaffold06019 CYP73A24v2 blue part from ESTs

only one amino acid difference

3246440 MDLLLLEKTLIGLFFAILIAIIISKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE 3246261

3246260 YAKKFGDVFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT 3246081

3246080 VYGEHWRKMRRIMTVPFFTNKVVQQYRGGWESEAASVVEDVKKNPESATNGIVLRKRLQL 3245901

3245900 MMYNNMFRIMFDRRFESEDDPLFVKLRALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK 3245721

3245720 ICKEVKEKRLKLFKDYFVDERK 3245655

        KLANTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVA 3245009

AIETTLWSIEW

GIAELVNHPHIQKKLRDEIDTVLGPGVQVSEPDMPKLPYLQAVIKETLRL

RMAIPLLVPHMNLHDAKLAAYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVE

ANGNDFRFLPFGVGSRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKLDTSEKGGQFSL

HILKHSTIVMKPRSF*

 

 

SL2.30ch06 44623294-44624725 (-) strand

missing the C-term

 

>scaffold00446

CYP73A24v1 1419605-1421036 missing last exon

1419677   KLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVS  1419850

1419851   SPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  1420030

1420031   VQQYRGGWESEAASVVEDVKKNPESATNG  1420117

1420869   KLANTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAGM  1421042

 

 

>scaffold00446

CYP73A24v2 1426155-1427798 missing last exon

1426227   KLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTEYAKKFGDVFLLRMGQRNLAVVS  1426400

1426401   SPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKV  1426580

1426581   VQQYRGGWESEAASVVEDVKKNPESATNG  1426667

          KLANT 1427682 KSMDSNALKCAIDHILDAQQKGEINEDNVLYIVENINVA  1427798

 

 

>CYP76A22 CYP76A@1 scaffold01435 72% to CYP76A5, 59% to CYP76A12 Vitis, 61% to CYP76A5 Petunia

856318 MEWIWGYIFF

856288 SIITVLFPFLHFRWRTLLYNVRQQLPPGPRGWPVFGSMLELGNEPHKTLMDLKQKYGPV 856112

856111 VWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTEVMKSHGYDKGSLALAPYGTY 855941

855940 WRIMKRIMTVQMLVNKRITETVEVRRKCIDDLIEWIENREFSSSEGIHVAKFVFLASFNM 855761

855760 LGKLVLSRELVDPKSEKGTEFFAA

       MVGLMECSGHQNIVDVFPWLRWLDPQGLRRKMDRGLGKTIEIVSGFLKERFEERERTGEK

       KKDFLEVLLEYEGKGKDEPEKISDQELILIIL (0)

854825 EIFLAGSETTSSSIEWAMTELLCNPEAMDKVKTELSEVLGDTKKFEENDIDNHKYLQA 854652

854651 VVKETLRLHPPIPFLVPRKAIQDTEFVGYHIPKGTQVFVNTWAIGRDPECWKDPLDFKPE 854472

854471 RFLDLNIEYRGQNFEFIPFGAGRRICAGIPLAHRMLHLVLGALLSEFD 854328

       WEIDVSVLDEALDTRDRMGVTVRKLKPLKAIPKTKNRTL* 854208

 

>CYP71D220 CYP71D@15 scaffold01435 84% to C10.5_contig9 78-80kb CYP71Dxx, 68% to CYP71D51v3

1459438 MEFQFPFNIIFLFLFLSFLYLLLVEWK

1459357 KSRNLNKKLPPGPWKLPFLGSLHHLAIGGLPHHALTKLGKKYGPLMHLQLGEISTVVVS 1459181

1459180 SMDMAREVLKTHDLAFASRPKLASIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTAKN 1459001

1459000 VRSFSSILHDEASRLVQFIQSSTHGEPINITERILWYTSSITCKTAFGDQLLKDQE 1458833

1458832 KFIQMVKKLVELASGFSLADIFPSIKILGVLTGARSRILKVHKNVDAIVEDVIN 1458671

1458670 EHKKNLASGKKGNGAFGGENLVDVLIRLMGSGELKIPITNDNIKAIMV (0) 1458527

1458302 DLFSAGTETSSTTATWAMTEMMRNPRVLKKAQAEVREAFKGKETFDEDVIEELKYLRQVVKETL 1458111

1458110 RLHPPVPLLAPRECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFAR 1457937

1457936 SSVDFLGNNFEYLPFGAGRRMCPGITFGLFNVYLPLAKLLYHFDWKLPDGQKPED 1457772

        VDMTELSAITAARKSELYLIATPYHPSQ* 1457685

 

SL2.30ch10  63373684- 63375437 (+) strand

 

>CYP71D218P CYP71D@16P scaffold01435 = C10.5_contig9 85-86 kb, pseudogene, 66% to CYP71D51v3

1461777 MEFQFPFNLIFLFLFLSFLYLLVVQWKKSRNLNKKL

        PPGPWKLPFIGSVHHLALEGGLPHHALTKLGKKHGPFMHLQLGEISTIIVSSMDMAREVLKTHDL & 1461475

1461475 ILALDIILYKSTDIAFCPYGDYWRQMHKVCVLELLTTKNVRSFSSIRQDEASRLV

        QFIRSSRCGEPINVTERILWYQSSITCKTTFVELLKDQEKFLGILRELMEVAGGFSMADI

        FPSIKILQVLSGLKSRILKVHKNVDVIVEDVINEHKKNIASGTKGNGAFGGEDLVDVLLR

        LIESGGLKIPITNDNIKAIMI (0)

1460761 DLFVAGSETSGTTTIWAMSEMMRKPSVLAKAQAEIREAFKGKETFDFDEDVIEELKY

        LKQVVKETLRLHPSVPLLVP &

        RECREETNINGYTIPLKTRVMVNVYAMGRDPKYWEDAESFIPERF 1460397

1460396 DHSSVDFMGNNFEYLPFGAGRRMCPGMSFGLINVYLPLAKLLYHFDWKLPHGLKPKDVDM 1460217

1460216 TELSGVTAARKTEIYLIATPYYPSRE* 1460136

 

SL2.30ch10 63371345-63372986 (+) strand

 

>CYP71D219 CYP71D@17 scaffold01435 = M01000000101 LA3475 type 6, C10.5_contig9 81-83 kb, 65% to CYP71D51v3, 88% to CYP71D.50

1464884 MEFQFTFNFIFLFLFLSFLYLLVVQWK

1464803 KSRNLNKKLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGKKYGPFMHLQVGEISTVVVS 1464624

1464623 SMDMAREVLKTHDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLTTKN 1464444

1464443 VRSFSSIRRDEASRLVQFIRSSTCGEPINVTERISWYQSSITCKTAFGELLKDQE 1464279

1464278 KFLGILREFTEVAGGFSTADIFPSIKILQVLSGLKSRILKFHKNVDVIV 1464132

1464131 EDVINEHKKNLASGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIII (0) 1463973

        DLFIAGTETTTTTTI

1462826 WAMTEMIRNPSVLAKAQTEVREAFKGKEEIFNEDVIEELKYLKQVVKETLRLHPPLPLLI 1462647

1462646 PRECREETNINGYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNF 1462473

1462472 EYLPFGSGRRMCPALSFGLINVYLPLANLLYHFDWKLP 1462359

        DCVKLEDMDMNEFSGIAAARKSELYLIATPYYPSHE* 1462248

 

SL2.30ch10 63368238-63370874 (+) strand

 

>CYP71D217 CYP71D@18 scaffold01435 84% to C10.5_contig9 86-88 kb, 68% to CYP71D51v3

89% to CYP71D.50

1467463 MEFQFTFNFIFLFLFLSFLYLLVVK*K

1467385 KSRNLNKKLPPGPWKLPFIGSIHHLALEGGLPHHALTNLGKKHGPFMHLHLGEISTIIVS 1467206

1467205 SMDMAREVLKTHDLAFASRPKFLALDIICYKSTDIAFSPYGDYWRQMRKVCVLELLTTKN 1467026

1467025 VRSFSSIRRDEASRLVQFIRSSTCREPINVTERILWYQSSITCKTAFGELLKDQ

        EKFIELVKELVELASGFSVADIFPSIKILHVLSGLRNRILKIHKNVDAIVEDTINEHKKN

        LACGKRGNGAFGGEDLVDVLLRLMESGELKIPITNDNIKAIMI (0)

1466289 DLFAAGSETSATTTIWAMTEMMRNPNVLAKVQAEVREAFKGKETFDFDEDDIEELKYLKQIVK 1466101

1466100 ETLRLHPPVPLLVPRECREETNINGYTIPLKTRVMVNVYAMGRDPKYWDDAESFIPERF 1465924

1465923 DGSSVDFMGNNFEYLPFGAGRRMCPGMSFGLINVYLPLAKLLYHFNWKLPDGLKPKDVD 1465747

1465746 ITEFSGITAARKSELYLIATPSHE* 1465672

 

SL2.30ch10 63365656-63367450 (+) strand

 

>CYP71D216 CYP71D@19 scaffold01435 = C10.5_contig9 73-75 kb, 65% to CYP71D51v3

1473107 MDLQFSFNFIFLILFLSFLYLLLVELKKSRNLN

1473008 KKLPPGPWKLPIIGSIHHLALEDGLPHHALTKLGKKHGPLMHLQLGEISTIVVSSMEMAR 1472829

1472828 EVMKIHDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSS 1472649

1472648 IRREEGSNLVQFIRSSTRGEPINVTKQISWYESSITCKAAFGELLKDQEKFIGIVRELAE 1472469

1472468 LTGGFSVANIFPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRN 1472325

        IASGKRGNGAFGGEDLVDVLLRLMESGALKIPITNDNIKAIMI (0)

1471158 DLFSAGTETSTTTTIWAMTEMIRNPSVLAKAQTEVREAFKGKETSNEDVIERLKYLKQVV 1470979

1470978 KETFRLHPPLPLLIPRECREETNINGYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERF 1470799

1470798 EGSSVDFMGNNFEYLPFGAGRRICPGITFGLINVYLPLANLLYHFDWKLPHGVKLEDVDM 1470619

1470618 NEFSGITAARKSELYLIATPYYPSHE* 1470538

 

SL2.30ch10 63360007-63362576 (+) strand

 

>CYP76A21 CYP76A@2 scaffold01435 90% to CYP76A6 tomato

2038972 MEWEWSYLFFSAIIFLPILILFFSQKKSSKCCYNLPPGPPGLPIFGNMFELGKEPYKKMS 2039151

2039152 ALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIVDVNQAHNYFQGSLA 2039331

2039332 VGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKTVNSAEKGNGIEVTR 2039511

2039512 FVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMEWSGIANVSDIFPFLRMFDLQK 2039691

2039692 LRKKMTRDMGKAMEIMSMLLKERKKGMEKMKDFLDVLLEFEGTGKDEPAKLSEHEIKVLIV (0) 2039874

2040006 EMFLAGSETTSSSVEWALTELLRHPQAMAEVKTEISKAVGSNNRFEESDI 2040155

2040156 ENLPYMQAVIKESLRLHPPLPFLIPRETIHDTNFMGYDVLKGTQVLVNAWAIGRDPECWD 2040335

2040336 DPMSFKPERFLGSKIDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFEWE 2040509

2040510 LPDGVSPKSINMDESMGVTARKRDSLKVIPKKAYYLSQLYINNKRELLE* 2040659

 

SL2.30ch10 62791786-62793473 (-) strand

 

>CYP76A6 scaffold01435 99% to CYP76A6 tomato 1 aa diff, 85% identical to 76A2

2044042 MEWELSYLFFSSIILLSIFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMA

ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQVDVNSAHNYYQGSPA

LARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRFVFLASFNMLG

NLILSKDLADPESEEASEFFHAMKGIMEWSGVANVSDVFPFLRKFDLQSLRKKMTRDMGK

AMEIMSMLLKERKKGMEKMKDFLDVLLEFEGTGKDEPAKLSEHEIKVFIL

2043062 ELFLAGTETTSSSVEWALTELLRHPQAMAEVKTEISKAVGSNNKFEESDIENLPYMQAV 2042886

2042885 IKESLRLHPPLPFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPER 2042706

2042705 FLGSKLDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVS 2042541

PKSINMDESMGVTARKRDSLKVIPKKV* 2042457

 

SL2.30ch10 62788402-62789988 (+) strand

 

>CYP94C28 CYP94C@1 scaffold01435 57% to CYP94C1

2285728  MNHLDVFWWLKSFHVYSILIFIIISLFSLIFYMVRVKLWCNCEICHAYITTSWSSQFINLCDWYTHL

LKESPTRTIHIHVLGNIITSNTQNVEYMLKTRFDNYPKGKTFSTILGDFLGRGIFNVDGD

LWRFQKRMSSLELGKVSIRSYAFEVVKNEIDKRLVPLLHEYKQGGGVLDFQDVFRRFSFD

CICRFSFGLDPKCLESSLPMSQFALSFDLASKLSAKRAMTTSPIVWKIKRFFNIGSEKEL

REAIKVINILAQEVIRQKRKLAFSNHRDLLSRFMGSISDETYLRDIVISFLLAGRDTIAS

ALTSFFYVIGNNPQVAKAIREEANRVLGPNEDLTSYEQMSELHYLQACVYESMRLYPPIQ

FDSKFCLEDDFLLDGTFVKKGTRVTYHPYAMGRMEELWGCDALEFKPQRWLKDGVFVQEN

PFKYPVFQAGLRVCLGKEMALVEVKSVALSLLRRFHVELAQPYHHNPRFSPGLTASFKGG

LLVSVRQISS* 2287222

 

>CYP94A25 CYP94A@2 scaffold04765 64% to CYP94A6, 66% to scaffold07059 another CYP96A sequence

1146001 MVFNFDLSINIFSHLYFFFLPLVIILLFFIINISKTILTNVFIYPKSTKI

1146151 PRSYPIIGSYFSIKSNINRRIQWTSEIVLSILPSLTFTLYRPLGHRHIFTANP 1146309

1146310 SNVEHILKTCFHNYQKGCLGKETLKDLLGNGIFNADGEIWKYQRKLASHEFNSKSLRKFV 1146489

1146490 ENVVDFELSDRLIPILTMSASQKSVVDFQDLLQRFTFDNICMVAYGYDPAYLLPSFPEAK 1146669

1146670 FANAFEEVVRISSDRFNSLAPFIWKLKRILNVGSEKKLRVCSTQIRDMAKEMIKQKKER 1146846

1146847 SGYDKRSSDDLLSRFLISSNEQQNMHDDEFIIDIVISFILAGRDTTSAALTWFIWLISKN 1147026

1147027 PKVEKEILEEIAKTTTSLNYDEVKDMSYTHASLCESMRLYPPVPVDT 1147167

1147168 KEVMQDDLLPDGTFAKKGTRISYHPYAMGRVEHIWGKDWQTFRPERWLERDVKTGNWKF 1147344

1147345 VPKDPFVYPVFQAGPRVCLGKDMAFLQMKKVVAGVLPRFRFVPVVDKGEEPVLIAYLTIK 1147524

1147525 VKGGLMVRIEERTRSS* 1147575

 

>CYP716H2P CYP716H@1P scaffold04765

1201253-1203366 (+) strand

CYP716H pseudogene

76% to scaffold05103, 86% to CYP716H.2 potato

1201253   MNLFLLSLATTFAIIINFLFIYFFSKPKQKIILPPPGSFGWPIIGETIQFLVSLHYG  1201423

1201424   LVHEFVQERTKKYNSNIFKTSLLGQKVVIFSGPSTNKFIF  1201543

TKGNKLFSGWRPNSVQKLFPSTSFVPIEHHTKRAKSVITYFLNSQNVETLISTIDYMSHTQL

ENHWKGNNEVIVCDLVKFFIFSLSIRTFIGIEESNNNIYEK &

FKNFLRGLLVMDINLPGTTFYKAMKAGNELRK &

KRREKLLEINSNLGNVCYNYVLTQLIIEQDEDGNY &

LFGFIVGSYETTATTITLTMKYLKQNPQFFNEIME (1)

EQNEISTQMIPRKELCWNDIKKMK &

TWNFVNEVLRNTPIVQGVFREAIEDFTYEDFHIPKGWK (0)

IYLIFGATQK &

NGEYFPNPTKFDPSRFEGNEVVPYTSI &

KKFKLEAKVPLEKNMYPFFLLAIPTYGYFVTLSTL* 1203366

 

SL2.30ch11 48515438- 48517551 (+) strand

 

>CYP75A31 scaffold04765 = CYP75A31 2 aa diffs, 82% to CYP75A37P Vitis

2073864 MALRINELFVAAIIYIIVHIIISKLITTVRERGRRLPLPPGPTGWPVIGALPLLGSMPHV 2074043

2074044 ALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRPPNA (1) 2074190

2074890 GATHLAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDAS 2075069

2075070 QDGECVVIADVLTFAMANMIGQVMLSKRVFVEKGVEVNEFKNMVVELMTVAGYFNIGDFI 2075249

2075250 PKLAWMDIQGIEKGMKNLHKKFDDLLTKMFDEHEATSNERKENPDFLDVVMANRDNSEGE 2075429

2075430 RLSTTNIKALLL (0) 2075465

2076361 NLFTAGTDTSSSVIEWALAEMMKNPKIFEKAQQEMDQVIGKNRRLIESDIPNLPYL 2076528

2076529 RAICKETFRKHPSTPLNLPRVSSEPCTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFT 2076708

2076709 PERFLSGKNAKIEPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPNNV 2076888

2076889 IDINMEESFGLALQKAVPLEAMVTPRLSLDVYRC* 2076993

 

>CYP84A2 scaffold00090 4 aa diffs to AF150881 69% identical to 84A1

1633121 MVLNNINSILEALQANPILIFFFIIPLFFLYLFSTSRRKRYPPG

PLGWPLIGNMMIMDQLTHRGLAKLAQKYGGVFHLKMGYVHKIVISGPEEARQVLQVQD

NIYSNRPKTVAISYLTYDRADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEV

DSMVKIVTTNTGTSINLGELVFCLTRNIIYRAAFGTSSDEGQDDFIKILQEFSKLFGA

FNMADFIPWLGWIGKQGLNVRLAKARASLDGFIDTIIDDHIERKKAIHVINDDGYRES

DMVDELLAFYSEETKVNESEDLQNAIRLTRDNIKAIIM (0)

1630403 DVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANVVGLNRKVDESDFENLT 1630242

1630241 YLKCCLKETLRLHPPIPLLLHETAEESTVSGYFIPANSHVIINSFAIGRDKNSWEDPDS 1630065

1630064 FKPSRFLKEGVADFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAVAHLLHCFTWELPDG 1629888

MKPSELKMDDIFGLTAPLANRLVAVPTPRLLCKLY* 1629780

 

>CYP736A74 CYP736A@5 scaffold03179 58% to CYP736A26 Vitis

2301293 MSLIWEVVVVVSIVYVLYELLNIH

2301221 KRKKLPPGPRGLPIVGHLHLLGKNPHHDFQNLAKKYGPIMYMRLGLVPTIVVSSSDVAE 2301045

2301044 KFLKTYDHIFANKPHNEAAHYLAYGQKNIIFAKYGPYWRNMRKLCTQHLLTNQKINSFQS 2300865

2300864 LRSQQVELMIESLQNESRGERVVVDLSERVASLNANMTCLMVFGKKYMDEDFDKRGF 2300694

2300693 KAVLQEVVHLAAITNLGDFFPFLGVIDLQGLTRRLKDLSKVFDEFLEKIIDE 2300538

2300537 HVESHDENQTKDFVHTMLEFMQSGKAEFQFDRIHIKAVLF (0)

        DMIVAAIDTSATTIDWILTELLRHPHVMKKLQIEIKQVVGL 2300178

2300177 ERMVKESDLENLKYLDMVVKEGMRLHSVVPVTQREAMEDCVIDGFNIRKGSRIMINHYA 2300001

2300000 IQRDPNLWSEPEKFLPERFIGSNIDVRGRDFQLLPFNSGRRSCPAIQLGIIVVRLVVA 2299827

2299826 QLVHCFDWELPNGMQPCDLDLEEHFGIVTSKEKHLMAIPTCRLNEQ* 2299686

 

>CYP736A75P CYP736A@6P scaffold03179

4874820-4876780 (+) strand

86% to CYP736A.23P potato

4874820   MAFIWATLVVIFVVYTLLNNIQNR

4874892   KRYPPGPKGLPIIGHLHLLGKNPHKDLQKLANTHGPFMYVRLGLVPTIIVSSAGAAEK  4875065

4875066   VLKTYDHIFASRPHMEASYYLAYEQKNLISAKHGPYWRNMRKLCTQHLLSNQKINSFQSM  4875245

4875246   RREQVELMIKSLKNDDRVVFDVSAKISSLSADLTCMMVFGKKYMDEDLDKRGFKAVVKE  4875422

4875423   VEHLSATPNLGDFFPFLGVIDLQGLTRRLKDLAKVFDEFLEKMIDEHVQSRDQKQS  4875590

4875591   KDFVDIMLDIMQSGET  4875638

          (sequence gap)

4876451   LNYYAIQRDPNIWPEPENFFPERFVGSSIDMRGRDFQLLPFGSGRRSCPAMPLGIIIVHL  4876630

4876631   VVAQLVHCFDWELPNGMEPCDLDVEEHFGLATSRANPLMAIPTYRLNNA*  4876780

 

>CYP736A76P CYP736A@8P scaffold03179

4888912-4891064 (+) strand

87% to CYP736A.23P potato (100% to adjacent seq)

The two parts are called a and b in BOGAS

4888912   MAFIWATLVVIFVVYALLINIQNR

4888984   KRHPPGPKGLLIIGHLHLLGKNPQQDLQKLAKTHGPLMYVRLGLAPTIVVSSAETAEK  4889157

4889158   VLKTYD & 4889175

4889177   IFASRPHNEAAQYLAYGQKNLIAAKYGPYWRNMRKLCTQHLLSN  4889308

4889309   QKINSFQSMRREQVELMIKSLKNDDRVVVDLSAKISSLSADLTCLMVFGKKYMDEDLDK  4889485

4889486   RGFKAVVKNVEHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVLDEFLEKIIDEHVQF  4889662

4889663   RDQKQSKDFVDTMLDIMQSGET  4889728

          (sequence gap)

4890732   INYYAIQRDPNIWLGAEKFLPERFVGSNIDIRGRDFQLLPFGSGRRSCPGMQLGIIIVQL  4890911

4890912   TVAQLVHCFDWELPNGMEPCDLDVEDHFGLATSRENPLMAIPTYRLNKNA*  4891064 45829297

 

Note: this seq is broken into two sequences in ver 1.03

Note: in ver 2.3 the last part is on chr12 45828965-45829297 (+)

while the first part is on chr00 (unmapped) 13337417-13338233 (+)

 

 

>CYP736A@8P scaffold00887 ver 1.03

4323   MAFIWATLVVIFVVYALLINIQNRKRHPPGPKGLLIIGHLHLLGKNPQQDLQKLAKTHGP  4502

4503   LMYVRLGLAPTIVVSSAETAEKVLKTYD  4586

4588   IFASRPHNEAAQYLAYGQKNLIAAKYGPYWRNMRKLCTQHLLSNQKINSFQSMRREQVEL  4767

4768   MIKSLKNDDRVVVDLSAKISSLSADLTCLMVFGKKYMDEDLDKRGFKAVVKNVEHLAATP  4947

4948   NLGDFFPFLGVIDLQGLTRKLKDLSKVLDEFLEKIIDEHVQFRDQKQSKDFVDTMLDIMQ  5127

5128   SGET  5139

 

>CYP736A@8P scaffold00007 ver 1.03

1466126   INYYAIQRDPNIWLGAEKFLPERFVGSNIDIRGRDFQLLPFGSGRRSCPGMQLGIIIVQL  1466305

1466306   TVAQLVHCFDWELPNGMEPCDLDVEDHFGLATSRENPLMAIPTYRLNKNA*  1466458

 

>CYP736A77P CYP736A@9P scaffold03179 59% to CYP736A26 Vitis

missing the n-term, pseudogene

4903403 GTAEKVLKTYDHIFASRPHNEAAYYLAYGQRNMISAKHGPYWRNMRKLCTQHLFSNQKINSF 4903588

4903589 QSMRRQQVEVMIKSLKNGTCDHRVAVYLSAKISSLNADLTCLMVFGKKYMDEDLDKRG 4903762

4903763 FKALVKEVDELAATPNLGDFIPFLGVIDLQGLTRRLKDLSKVFDDFLEKIIDE 4903921

4903922 HVQSGDQKQSKDFVDTMLDIMQSGEAEFQFGRSHIKAILF (0) 4904041

4904119 DMLVAAMGTSATAIEWILTEFLRHPHVMKKLQKELEQVVGLEKMVKESDLENL 4904277

4904278 NYLDMVVKERLRLHAVAPLAPHEAMEDCVVNSFHIQKGS & 4904394

4904394 RILINFYAVQRDPNIWPEPEKFLAERFSGSSIDIRGHDFQLLPFGSGRRSCPAMQLAI 4904567

4904568 VLVQFTVAQLVHCFDWELLNGMQPCEMDVEEHFGLATSRANHLIAIPTYRLNKNA* 4904735

 

SL2.30ch12 45841637-45842969 (+) strand

 

>CYP736A78 CYP736A@10 scaffold03179 55% to CYP736A26 Vitis

4914373 MTLIWETIVVICIVYALYELLNIH

4914445 KRKKFPQGPKGIPILGHLHLLGKKPHHDLQNLAKKYGPFFYIRLGLIPTYIASSVDTAE 4914621

4914622 KFLKTYDHIFATRPHNEAAKYLSYGHKNLVFGTYGPYWRNMRKLVTLDLLTHQKINSFQS 4914801

4914802 VRTEQVDLMIQSLKNDGGGCVVDLSARVSKLSADITCLMVFGKKYMDEELGKRG 4914963

4914964 FKGILQEVVHLGATPNLGDFFPFLGVIDLQGITRKLKELSKVFDAFLEKIIDEH 4915125

4915126 VQSRDQKQSKDFVDTMLDIMHSRDREFQFDRTNIKAILI (0) 4915242

4915585 DMLVAAIDTSATSVDWIVTELLRHPHVMTKLQKELEEVVGLERMVKESDFEKLKYL 4915752

4915753 DMVVKEGMRLHSVVPVTQREAMEDCVVDGYHIRKGSRIMINHYAIQRDPNVWPEPEKFF 4915929

4915930 PERFVGSSIDIRGRDFELLPFSSGRRSCPAIQLGIIVVRLMVAQLVHCFDLELPNGMQ 4916103

4916104 PCDLDVDEHFGIVTSKENHLMVVPKYRLND* 4916196

 

>CYP703A13 CYP703A@1 scaffold05948 74% to CYP703A9 Vitis cyan possible intron seq

760686 MIDLTSFVIVLLCTYLLNLINYSIFLFGAYLISKLLHFSFVDKSKREINRLPPGPKQWPI 760507

760506 VGNLFQLGQLPHRDMASFCEKYGPLVYLRL (1) 760417

       GNVDAITTNDPEIIREILVQQDDVFASRPRTLAAIHLAYGCGDVALAPLGPKWKRMRRICMEHLLTTK

       RLESFAKHRADEAQSLVKDIWTKAQKGQIVDLREVLGGFSMNNVTRMLLGKQYFGAESAG

       PQEAMEFMHVTHELFWLLGVIYLGDYLPFWRWIDPHGCEKKMRDVEKRIDDFHRRIIEEH

       RKKKGSKNNNNNNIDDDEMDFVDVLLSLPGEDEGDGNGKQHMDDVEIKALIQ (0)

758908 DMIAAATDTSAVTNEWAMAEVIRHPHVLKKIQEELDIVVGSGRMVTESDLINLKYLRCVVRET 758720

758719 FRMHPAGPFLIPHESIRDTKINGYYIPAKTRVFINTHGLGRNTKIWDNIDEFRPERHLPP 758540

758539 NGDEKNMILTSSSSSSNRVEISHGPDFKILPFSAGKRKCPGAPLGVKLVLMALARLFHCY 758360

758359 DWNPPNGVKHQDIDTNEVYGMTMPKAKPLMAIAKPRLPPHLYQ* 758228

 

>CYP78A@6 scaffold05948 67% to CYP78A40 Vitis

859971 MNMIYWAHPGGPAWGKHTWKKLRSNPIPGPKGFPIIGSMNLMSGLAHHKIAKIAKTLKAS 859792

859791 RLMCFSLGETRVIVTCNPEVAKEILNSSVFADRPIKESAYRLMFNRAIGFASYGVYWRTL 859612

859611 RKISSNHLFSPKQIKFYEKPRFQIAKQLISMFEKNSPNDILRVRDGLKLASLNNMMCCVF 859432

859431 GKSYDFDCCNLETKELMKLVDEGYELLGMLNWSDHISWLGEFDLQRIKQRCSELVPKVNK 859252

859251 FVKKILDEHVNQSGDFVDVLLSLQGSERLSENDMIAVLW (0) 859135

858063 EMIFRGTDTVAVL

858024 VEWILARMTLHPDIQSKVQVEIDRIVGQSRTMTESDVSEMIYLPAVVKEVLRLHPPGPLL 857845

857844 SWARLAITDTIIDGYHVPAGTTAMVNMWAITRDADVWADPLIFKPERFLNEAHSDMDFS 857668

857667 VLGSDMRLAPFGSGRRSCPGKTLGLTTVTYWVATLLHEFEFGPSSNVDLSE 857515

857514 VLKLSCEMAHPLKVKIRSRHAPKTN* 857437

 

>CYP78A78 CYP78A@6 scaffold00340 ver 1.03 this N-term does not match seq above (it has extension)

516076   MTTNIESLWIFALASKCKSFTSINSVFFAIFVILIWLV

515962   MNMIYWAHPGGPAWGKHTWKKLRSNPIPGPKGFPIIGSMNLMSGLAHHKIAKIAKTLKAS  515783

515782   RLMCFSLGETRVIVTCNPEVAKEILNSSVFADRPIKESAYRLMFNRAIGFASYGVYWRTL  515603

515602   RKISSNHLFSPKQIKFYEKPRFQIAKQLISMFEKNSPNDILRVRDGLKLASLNNMMCCVF  515423

515422   GKSYDFDCCNLETKELMKLVDEGYELLGMLNWSDHISWLGEFDLQRIKQRCSELVPKVNK  515243

515242   FVKKILDEHVNQSGDFVDVLLSLQGSERLSENDMIAVLW (0) 515126

514057   EMIFRGTDTVAVLVEWILARMTLHPDIQSKVQVEIDRIVGQSRTMTESDVSEMIYLPAVV  513878

513877   KEVLRLHPPGPLLSWARLAITDTIIDGYHVPAGTTAMVNMWAITRDADVWADPLIFKPER  513698

513697   FLNEAHSDMDFSVLGSDMRLAPFGSGRRSCPGKTLGLTTVTYWVATLLHEFEFGPSSNVD  513518

513517   LSEVLKLSCEMAHPLKVKIRSRHAPKTN*  513431

 

>CYP78A@6 scaffold00340 ver 1.03 = scaffold05948

516076   MTTNIESLWIFALASKCKSFTSINSVFFAIFVILIWLVMNMIYWAHPGGPAWGKH  515912

513604   GKTLGLTTVTYWVATLLHEFEFGPSSNVDLSEVLKLSCEMAHPLKVKIRSRH  513449

 

 

>CYP98A55 CYP98A@5 scaffold02618 65% to CYP98A43, 85% to CYP98A30 Nicotiana tabacum

154151 MAFSLAFPALTLF

154112 LIYIAYNLYRRLKAKLPPGPRPWPIIGNLYDIEPIRFRCFAAWSEIYGPIFSFYLGSQL 153936

153935 NVVINNATLAKEVLKDNDQNLADRFRTKPLANVSRNGSDLIWADYGHHYVKVRKLCNLEL 153756

153755 FTSKRIEALRPIREDEVTSMIHDIFRDSTKQ (1) 153663

       GKSLIMRSYLGLVAFNNITRLTFGKRFMDSQGNVDEQGKELKEIVSNGMKIGG

       KLNLGDFVPWLSCFFKDDNEALKAQDSHVDRFTRVIMEEHTLARKNTGETKQHFVDALLT

       LQKEYELSDDTVIGLLW (0)

148361 DMVTAGMDTVAITVEWAMAELVKNTRVQQKAQEELDRVIGSDRVITESDMSK 148206

148205 LTYLQSVVKESLRLHPPTPLMLPHLASANVKIGGYNIPKGTIVHVNVWALGRDPKVWKNP 148026

148025 LQFRPERFIEEDIDMKGHDFRLLPFGAGRRICPGTNLAINMVTSMLAHLLHHFEWSPP 147852

147851 IGIERDGIDMLESPGTVTYMQTPLQVVPTPRLPQHLYERSPIVI* 147717

 

>CYP93A42 CYP93A@1 scaffold02618 68% to CYP93A16 Vitis

1641645 MVDIQGYLILF

1641678 LIWLFSTLFLKYVVFRKRNTCHLPPSPFGLPIIGHLHLLSPIPHQALHKLSTRYGPLI 1641851

1641852 HINLGSVPCLVVSSPEMARQVLKTHETSFLNRPQTSVIDYLTYGSQDFSFAPYGVYWKFM 1642031

1642032 KKICMSELLGARTLDMLLPVRRDEIKRFIELLLHKAESSEEVDVEAELLRVSNNVISR 1642205

1642206 MLMNERCSEDKDEAGSVRMLVQDITELTGKFNLSDYIWFCKNLDLQGFGKRTKDVRK 1642376

1642377 RFDEIMERIINEHEEARSKRNSESIVIKDLLDILLDISEDDCAEMKLTRENIKAFIL (0)

1642956 DIFAAGTDTAAITVEWALAELINHPNIMQKAVEEIDGLIGKNQIVEESDIVNLPY 1643118

1643119 LQAIIKETLRLHPTGPMILRESTEDCCVGGYHIPKNTRLIVNTWAINRDPEYWENPLEF 1643295

1643296 IPERFLTEEEEGNTKSQLDVRGQHYHFLPFGTGRRGCPGTSLALQVVQISLASMIQCFEW 1643475

1643476 KVSGGEVSKVDMEEAPGITLPRANPLVCVPVTRFNPFTSTSTYA* 1643610

 

>CYP71AT24 CYP71AT@15 scaffold02618 = C01.6_contig1 60-62 kb, 58% to CYP71AT2 tobacco

1955941 MEMLLLFLVAIPIIVIFLVKLRYTHNHPPSPPGLPLLGNL

1955821 YQLNQESPHKYLWELSKKYGPLMFMKLGFSQLVVISSSRIAKEVLKTHDFAFSGRPSFLG 1955642

1955641 QRKLSYNGLDVAFSPYNNYWREMKKICTLHLFSPKKVQSFRPIREDEVSRMINRVTQLAS 1955462

1955461 SSKLVNLSEIMSSLSSNISCIVGFGKRYDEKGYESKRFSKLLCEAQAMIGGFFLSDYFPI 1955282

1955281 FGRWIDCIFTRKANRLEKIYNELDLFYQELIEEHLSPTRPKSMDGDIIDMLIALRDQNQS 1955102

1955101 SSSLNLTWDHIKAVLM (0) 1955054

1954943 DIFIAGTDTNAAALVWAMTALMKEGGSARRKLQQGIRELVGKKGRVYEDDIQNLPYLRAV 1954764

1954763 IKETLKLYPPAPLIPRETMEKCIIDGYEIKQNTPVSINAWAIGRDPECWENPDEFIPERF 1954584

1954583 CDVNNNGIVDYKSGEFEMIPFGGGRRGCPGISLGVATVELALANLLYAFDWELPYGMVKE 1954404

1954403 DIDIDTLPGMTMHKKNPLCLVAKKYLLQ* 1954317

 

 

>CYP71D187 CYP71D@26 scaffold03494 91% to CYP71D47v1 Nicotiana tabacum

282084 MEIQFTNFVAFLLFLSTTFLLFK

282015 KWKTQNLNLPPGPWKLPFIGSLHHLALAGPLPHHGLKNLAKRYGALIYLQLGEIPTVIIS 281836

281835 SPRMAKEVLKTHDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKM 281656

281655 VKFFSSIRQDELSKMVSSIRTMPNNHPVNLTDKIFWFTSSVTCRSALGKICCDQ

       DKLIIFMREIISLAGGFSVADFFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQN

       RADGKKGNGEFGGEDLIDVLLRVRESGEVQIPITDDNIKSILV (0)

281104 DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETL 280913

280912 RMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFEN 280739

280738 SSVDFLGSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHESLDLTE 280559

280558 SPGISATRKDDLVLIATPYDP* 280493

 

>CYP71AT17 CYP71AT@14 scaffold01891 78% to CYP71AT1 tomato, 55% to CYP83E2 Lotus japonicus

100% to Tomato CYP83 EST SGN-E398231, 50% to CYP83B1/83A2 Arabidopsis

= M01000014354 LA3475 type 6

1053 MIMIIFILLVTLPIVLNFLAKKDRKNVMPPGPLGLPFIGNLHQYDGLTPHIYFSKLAK 1226

1227 KYGKIFSLKLGSTPIVVISSAKLAKEVLKIQDLTFCSRPSFLGQQKLSYNGRDIGFAPYN 1406

1407 DYWREMRKICVVHLFSLKKVQSFSPVREDEVSRMITKISQQATASQITNLSNLVISLTS 1583

1584 TIICRVAFGIRYDEEAHEKRRFDELLAVAQEMMARFFFTDYFPMFGWLDKVFGNI 1748

1749 SRLEKNCKELDEFYEELIEQHLNPNKPKSMEGDIIDLLLQLMKEQSTPIDLTLDNIKAIL 1928

     NIFVGGTDT 2108

2109 SAATVVWAMTALMKNPKVMKKVQEEIRKSIGTKGFVNEDDVQNMSYFKAVIKETFRLYPP 2288

2289 APILVPRETMKKSTLEGYEIQLGTIIHVNSWAIARDPEVWENPEEFMPERFLNSDIDF 2462

2463 KGQDFELLPFGAGRRGCP (1) 2516

2598 GIALGVATVDLMLSNLLYAFDWELPCGMKKEDIDTNVMPGITMHKKNDLCLVPKNYF* 2771

 

>CYP81B41 CYP81C@1 error this is a CYP81B seq. scaffold02164 57% to CYP81B27 Vitis

89% to CYP81B@3

857788 MDSLCLYFPVLFLVLYIISHHFLNKLQNLPPSPFPALPFIGHLYLLSRPFHRALFK 857621

857620 VSNHYGSVVFLQFGSRPVLLVSSPLVAEECFTKNDIIFANRPDFLSGKYFGYNFT 857456

857455 ILAWSSYGEHWRNLRRISTLEVLSSYRIQTLSIIRSDEINYLIRRLFRVSIESSEIIVEM 857276

857275 KSSLFNFTFNVISRMIAGKRYYGENSKEAMLFQDISKDTINTAPKTNILDFLPFMRWF 857102

857101 GLHSVEEKMMELQKKKDNFMRKEIDEHSRLKSSGSFPSAEVVAGKKKTIMEVL & 856943

       VDLQKTDPKYYTDKMIRNLLL (0)

856281 ILLQAGSDTSAITLEWAFSRLLDNPEILKTAQTEIDNQVGQDRLIDESDLAQLPYIRCIINETL 856090

856089 RMHPAAPLLLPHLSSEECKVAGYRVPRGTILLVNAWGIHHDPKVWEDPEKFNPDRFIGFE 855910

855909 SVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNSETIDMSEGT 855745

855744 GFTISPKVQPLLAKCSP* 855691

 

SL2.30ch04 60627124-60629221 (-) strand (one frameshift = &)

60629221 MDSLCLYFPVLFLVLYIISHHFLNKLQNLPPSPFPALPFIGHLYLLSRPFHRALFKVSNH 60629042

60629041 YGSVVFLQFGSRPVLLVSSPLVAEECFTKNDIIFANRPDFLSGKYFGYNFTILAWSSYGE 60628862

60628861 HWRNLRRISTLEVLSSYRIQTLSIIRSDEINYLIRRLFRVSIESSEIIVEMKSSLFNFTF 60628682

60628681 NVISRMIAGKRYYGENSKEAMLFQDISKDTINTAPKTNILDFLPFMRWFGLHSVEEKMME 60628502

60628501 LQKKKDNFMRKEIDEHSRLKSSGSFPSAEVVAGKKKTIMEVL & 60628376

60628376 VDLQKTDPKYYTDKMIRNLLL (0) 60628314

60627714 ILLQAGSDTSAITLEWAFSRLLDNPEILKTAQTEIDNQVGQDRLIDESDLAQLPYIRCII 60627535

60627534 NETLRMHPAAPLLLPHLSSEECKVAGYRVPRGTILLVNAWGIHHDPKVWEDPEKFNPDRF 60627355

60627354 IGFESVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKPNSETIDMSEGTG 60627175

60627174 FTISPKVQPLLAKCSP* 60627124

 

 

>CYP81B40 CYP81B@3 scaffold02164 59% to CYP81B27 Vitis

862000 MDSLYLYFPVLFFVLYIISYHFLHKLQNLPPSPFPVLPFIGHLYLLGKPFHRALFKVSNRYGSV 861809

861808 VFLQFGSRPVLLVSSPSAAEECFTKNDIIFANRPDFLSGKHFGYNFTSLAWSSYGEHWRN 861629

861628 LRRISSIEVLSSYRIQTLSSIRSDEINYLIRRLFRVSIEGSEKIVEIKSSLFNFTFNVLS 861449

861448 RMIAGKRYYGEKVENSKEAKLFQDISKATITTIPKANILDFLPFMRWFG 861302

861301 LHDVEEKMMELQKKRDNFMQKEIDEHRRLKTNGSFPSAEVVAGKKKIIMEVLLDLQK 861131

       TDPEYYTDETIRSLML (0)

860474 VLLQAGSDTSAVTLEWAFSHLLDNPEILKTAQTEIDNKVGQDRLIDESDLAQL 860316

860315 PYIRCIINETLRMHPAAPLLVPHLSSEECKVAGYRVPRGTVLLVNAWGIHHDPKVWKEPQ 860136

860135 KFNPDRFLGFEGVKEGCKFIPFGSGRRGCPGENLAIHVIGLALGSLLQCFEWDKP 859971

859970 NREIIDMSEGTGFTLSPKVQPLLAKCSPRPHMVKLLSEI* 859851

 

>CYP81B39 CYP81B@4 scaffold02164 64% to CYP81B27 Vitis

872900 MDYTLSPFLYAAPLLLAFYIITKHFLRKFHNHPPAPFLTFPIIGHLYLFKKPLQRSLAKI 872721

872720 SDRYGPVLLLQFGSRKVLLVSSPAGAEECFTKNDVVFANRPHLMAGKHLGYNFTSLAWSS 872541

872540 YGDHWRNLRRITSVEMFSTHRLQMLHGIRVDEVKSMVKRINSSAMAEKSVDMKSMFFELM 872361

872360 LNVMMRTIAGKR (2) 872325

872139 YYGENVEDIEEATRFREMVEETFRIGGATNVGDFLPALKLLVRKLEKSLLVLQQK 871975

871974 RDEFMQGLIKGCRKRMEKDGTVTDSEIEGKKKSLIEVLLTLQEKEPEYYKDEIIRSLML (0) 871798

870660 VLLAAGTDTSVGTMEWALSLMLNHPETLKKAQAEIDERIGHERLIDESDMNNLPYLRCIVNET 870472

870471 FRMYPAGPLLVPHESSEETTVGGYRVPRGTMLLVNLWAIHNDPKLWDEPRKFKPERF 870301

870300 EGLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFD 870169

870168 WQRIGDELVDMTEGTGLTLPKAQPLVAKCSPRPVMSNLLSQI* 870040

 

>CYP81C8 CYP81B@5 error this is an 81C sequence

scaffold02164 52% to CYP81W1, 58% to CYP81C6v2 tobacco, 71% to CYP81C1 tobacco

70% to CYP81C@2

918659 MQNFYNSNCSCYYLAIIFIFFLIILLKHLIHPKKN & 918763

918766 LPPSPLSLPIIGHLYLIKNSLHQTLNSLSTKYGPVIYLRFGCRNLLIVS 918909

918910 SRSSVEECFTKNDVVFANRPRSMLGDRVSFNYTSLFLAPYGQLWRVLRRQTTIELFSTNS 919089

919090 LQKSSLIRNEEIEILIRSLFKASEKNTRGTRVDLNCWAFTFVFNIMMRIGTGKSCVSEED 919269

919270 IGMEKGKKIIEEMRGVFFANLLVLNVCDFLPILKWFGYKGIEKKIDLMSMKRNKFLNK 919443

919444 LLDEFRQKKFSSDSEHEAKEKKATLVETLLSLQEFEPEFYTDDLIKSLLV (0) 919593

921232 ALFVAGTETTSMTIQWAMRLLLAHPKVFQKLRFEIDSKVGNKRLLNDSDFNNLPYLQCVINET 921420

921421 LRLYSLVPLLLPHYSLEDCSVGGYHVPKNTILMVNAWAIHRDPELWDEPEKFIPERFED 921597

921598 MDGAKKEGFNYKFIPFGMGRRACPGANMGMRTVSLGLGSLVQWFD 921732

921733 WKNVELDENYRNMDEYYNSNVISSKDKPFEAICIPRQH* 921849

 

SL2.30ch04 60690248-60692724 (+) strand

 

>CYP81C9 CYP81C@2 scaffold02164 61% to CYP81C6v2, 79% to CYP81C1 tobacco

924604 MEILNSYYLLLFFAIFLLKYL

924667 FRSKNRLPPSPLSLPIIGHLYMIKNSIHQTLTSLSAKYGPVMYLRFGCRNLLVVTSPS 924840

924841 AVEECFTRNDIIFANRPQTMTGDKYSFNYTAVVWASYGYLWRALRRLMVIEIFSFNSLQK 925020

925021 SSALRSEETTILIRGLFEANCDRSGRSNVKINLSDWVSSFAFNVMMRSGTGKRCVSEEEI 925200

925201 GTEKGKEIIDEIKGFFFATLLPLNVCDFLPVLKWFGYKGIEKRMVLAHEKRNEFLNSL 925374

925375 FDEFRQKKVSPISVSESSTDRNREKKGTLVETLLSLQESEPEFYTDDLIKSVLQ (0)

925596 VLFIAGTETTSMTIQWAMRLLLAHPEAFHKLRAEVDSKVGNERLLSESDFTNLPYLQCVINET 925784

925785 LRLYPPVPLLLPHYSLEDCTIGGYDVPKHTILMVNAWAIHRDPQVWDEPEKFKPERFE 925958

925959 GMKGEKEGFNYKFVPFGMGRRACPGAAMGLRTASLVLGSLIQWFD 926093

       WENVEFEENLDACYNARITLNKEKPLEAICIPRKNCIRFLDQL* 926225

 

>CYP81Y1 CYP81@1 scaffold02164 45% to CYP81W1 Vitis

928144 MEIGFILPTILLIFSIFFFR

928204 KLQNARKKNLPPSPPFLPIIGHLHLLKSPIHQTFKSLSSKYGPIMYLHFGTSQVIIVSS 928380

928381 ASIAEQCFTKNDIIFANRPKSLASKHLGYNHTTIGFSPYGDHWRNLRRISNIQIFSTFTL 928560

928561 NNSSSIRTEEVQFVVKKLAQEYKGGSTQKVKLKILFEKLVYDVLTKMVAGKRWAESSTDD 928740

928741 LFGPTMIMNICDYIPILKWIRFQGLEKNLVELKIRRDEFLQGLIDEC 928881

928882 RKSRADKKTIIHTLLSLQRDQPECYTDDIIKGVIM (0) 928986

929914 VMFTAGTHTSAVTMEWAMSLLLNHPEVMKKARLEIDNLIGETRPLEEPDILKLPYLRCIINET 930102

930103 LRLFPAGPLLVPHFSTQECTIEGYHIPKSTILFVNIWEIQRDSKIWEDANEFKPERF 930273

930274 EGGIEGCKFIPFGMGRRACPGYGLAIRLIGLVLGLFIQCFE 930396

930397 WERIGDELVSLDESCGLMLSKLEPLEALYRPRESMVALLSQL* 930525

 

>CYP81C10 CYP81C@3 scaffold02164 68% to CYP81C6v2

932625 MENQYYYYLTISFVLIFYKYFFNSRRNNLPPSPLAFPIIGHLYLLKNKPLLTLTSLSAKY 932804

932805 GPVLYLRYGSMPVVIVSSPSTVEECFTKNDIIFANRPRTMA (1) 932927

933076 GDQLTFNYTAYFWAPYGQLWRSLRRLTVMELLSSNSLQKTSNIRDEEVVNFTRSLFKF 933249

933250 CNGRSRNVDLTNWICTFSFNLVNKIVAGTHLVSEEDAGMEKGIAMIHRLKGIFFVDIPVL 933429

933430 NMCDFLPFLRWIGYKGMEKKMNLVHNQRNEFLDNLLEEFRQKKVNVGNRVKQNTLIETLL 933609

933610 SLQESEPEFYTEDVIKSIML (0) 933669

933894 VIFVTGTDTTSTTIQWAMRLLLAHPEALHKLRAEIDVQVGNTRLLNESDLTKLPYLH 934064

934065 SVINETLRLYPTVPLLLPHYSTEDCTVGGYNVPKHTILLVNAWAIQRDPQVWKDPNEFKP 934244

934245 ERFEAIEGGKEGVNYKFIPFGMGRRSCPGAGMATRAISLALGSLIQCFD 934391

934392 WQSVGKENLALSYNSRIKIQKNKSLEAICSPRSNFLQLLSQL* 934420

 

>CYP82D36 CYP82D@4 scaffold02164 C04.14_contig57 124-125 kb, seq gap in this gene

filled in by C04.14_contig57, 55% to CYP82D7 Vitis

1849676 MDIFLIVIMVASSSVFFFFLRKHAFSAKIHSKSKRVPGAGGAWPIIGHLHLLSGSETEQL 1849855

1849856 PHKIMGRMADKYGPIFGMKLGVHQVVVVSDPKLAKECFTTNDLALAGRPKSMASEIVGYK 1850035

1850036 HAMFALSAYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSGIKEIYSDWGKNNLNGV 1850215

1850216 VKMEMKEWIGDLVMNTMGKILFGKGRRSN 1850302

 124734 EDEGINKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEKAMKEVSKEMDSVVEEWLTE 124913

 124914 HKTKRGIIKSGEEEDFMDVMLSICEDRDLPGFDADTAIKANCM (0) 125042

1851570 GLLSAGTDTTIVTLTWALCLLLNNYEALKKAQDELDAHVGNNRWVQESDIKNLVYLQAIVK 1851752

1851753 EVLRLYPAGPLSVPHESMEDCVIGGYDIPKGTRLLVNLWKIQHDPNIWPNPHEFKPERFL 1851932

1851933 STHKDVDVKGNHFELMPFGSGRRMCPGISLALQVVPFVIAVLLQGFDMKRPSDEAIDMSE 1852112

1852113 SFGLTVLKASPLQVLLAPRLASVLYE* 1852193

 

SL2.30ch04 61624730-61626375 (+) strand

 

>CYP82D39P CYP82D@7P CYP82D pseudogene d

scaffold02164 tomato

1858077-1858391 (-) strand

75% to CYP82D.4 potato, 69% to 82D@2P

1858391 VIGHLHLFTGSNLPHKTLGLMADKYAPIFTVKFGAHQILLNDTKVAQDW & 1858245

        LLTNIKDLASRLKSLAIEL*AYNIAV &

1858280 FGLGPYWREMEKIVVLELLSNHCVQMFRHI  1858077

 

SL2.30ch04 61632261-61632575 (-) strand

 

>CYP82D35P CYP82D@3P CYP82D pseudogene b

scaffold02164 tomato

1846589-1847314 (-) strand

77% to CYP82D.4 potato

1847314 LGLMVDKYGPIFTVKFGAHRVLVVNDRKIAQD & 1847216

1847216 CFTTNVKAMASRPKSLAVELLG 1847151

1846972 KKAQDELDIQVGKNTLVNESHIKKNFAL

1846898 LCSIAKESLRLYPSALLSAPHESMEDCIIGG*NIPKGTRV & 1846779

1846780 CLFNL*KIQRDPTIWLKSDLFKPHKEVDVKGYNFELIPFSPGRRIC 1846643

1846642 RGISSVLVLLHLTLANVL 1846589

 

SL2.30ch04 61621640-61622362 (-) strand

 

$

 

>CYP82D34P CYP82D@2P_1 CYP82D pseudogene a

scaffold02164 tomato

1842385-1844978 (-) strand

86% to CYP82D.4 potato

1844978 MDYSLAITYATTIIIFLYFIYMLFGIFSNKKGKTPPKVVGSRPIIGHLHLFSGSNLPHKTF 1844796

        GF  MADKYGP

1844794 IFTVKFGAHQVLVVNDRKIAQDCYITNDKALASRSKALAVELLGYNYAIFGLAPYGPYWREIKK 1844576

1843759 ILVLGILSNHRVQMLRRIQEFEVKTSNKTTYERWLKEKMDGSSNFVRMKMKEWFEKL

        VMTIIIRMLFGKEYDFEEGNRARNVMTIFFKLLGAFAVADFIPSLRWLDIGGYEKEMKKN

        AKEIDYILE & 1843382

1843382 KWLVEHKKKTSCGENKWEDDKDF 1843314

(30 aa deletion)

1842813 SMLVGGSDIIIVALTWTLSLLLNNPHVMQKAQEELDIQVGRNKLVDESHTNSLVYLLAIAKESLRLYP 1842610

(59 aa deletion)

1842609 QDVKGNRFKLIPFGAGRRICTTLVLLHLTLANLLHAFEITKPSNEPIDMSSNLGIKE

        TPLEVLLASRLSPDLYN* 1842385

 

SL2.30ch04 61617435-61620028 (-) strand

 

>CYP82D37P CYP82D@5P old CYP82D@2P_2 CYP82D pseudogene c duplicate name

scaffold02164 tomato

1852385-1852808 (-) strand

70% to CYP82D.4 potato

adjacent to CYP82D@4 on opposite strand

1852808   LSITYVATFINFLYFMYVLFGIFGNKRGNINSR

1852709   TPPKVAGLWPVIGHLPLFS & 1852653

1852633   KALASWPKPLAVERLAYNYAVLGEGPYWREMEKIVVLELLSNHSIQMFRHILKFEVK  1852463

          MSINTKYERWLKEKMNDSSNLFRLK 1852385

 

SL2.30ch04 61626570-61626990 (-) strand

 

>CYP82D38 CYP82D@6 scaffold02164 = C04.14_contig32 121-123 kb, 55% to CYP82D7 Vitis

1854959 MDPFLIAVTLATSFFLIFFLQKQFYSVKKQSSSRKVPGAGGAWPIIGHLHLLAGSESDH 1855135

1855136 LPHKTLSRMADKYGPIFGMKLGVHQVVVVSDPKLVKECFTTNDLALANRPKSMVSEIIGY 1855315

1855316 KDAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSSVKEIYNNWGKNNLNG 1855495

1855496 FVKMEMKEWIGDLVMNTMGKILFGKGRRSNEDEGINKAHKAIRRFFELLGAFVVADFLPY 1855675

1855676 LRWLDIGGHEKAMKEVSKELDSVVAEWLTEHKTKRGIIKSGEEEDFMDVMLSICEDRDLL 1855855

        GFDADTAIKATCM (0)

        ALLSAGTDTTIVTLTWTLSLLL 1856035

1856036 NNYQSLQKAQDELDAHVGKNRWVQESDIKSLVYLQAIVKEALRLYPAAPLSVPHESMEDC 1856215

1856216 TISGYDIPKGTRLLVNLWKIQHDPNIWPNPLEFKPERFLSTHKDVDVKGNHFELMPFGSG 1856395

1856396 RRMCPGISLALQVLPFVIAKLLQGFNMKRPSDEPIDMSESFGLTVLKASPLEVLLAP 1856566

RLAPDLYE  5148803

 

 

>CYP82D40 CYP82D@8 scaffold02164 = C04.14_contig32 107-109 kb, 57% to CYP82D7 Vitis,

top part is in a seq gap in scaffold02164

109242 MDLFLIVVTLATSFILLFILHKQFYSVKKQSSSSRKVPEAGGAWPIIGHLHLLGGSE 109072

109071 SDHLPHKMLGRLADKYGPIFGMKLGVHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEI 108892

108891 IGYKHAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSGIKEIYNNWEKNN 108712

108711 LNGVVKMEMKEWIGDLFMNTMGKILFGKGRRSNEDEGINKAHKAIRRFFELLGVFVVADF 108532

108531 LPYLRWLDIGGHEKAMKEVSKEMDSVVEEWLT

1869062 EHKTKRGIIKSGEEEDFMDVMLSVCEDRDLPGVDADTAIKATCM (0)

1869273 ALLSAGTDTTMVTLTWILSLLLNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVYFQAIV 1869452

1869453 KEALRLYPAGPLSLPHESMEDCTISGYDIPKGTRLLVNIWKIQRDPNIWPNPHEFKPERF 1869632

1869633 LSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDEPIDMS 1869812

1869813 ESFGLTVLKASPLEVLLAPRLAPDLYE* 1869896

 

>CYP701A30 CYP701A@1 scaffold02164 66% to CYP701A23 Vitis vinifera

EST for N-term = AI899070.1, DB715576.1

1818429 MDAILNLQGVPLGTALTVGGPVVALGGISFWLLKEYVNDQKRKSPNFLPPVP (1) 1818274

1817722 GLPVIGNLLQMTEKKPHKTFTNWAETYGPIYSIKTGANTIVVLSSSELAKE 1817561

1816319 AMVTRYSSISTRKLTNALRILTCDKSIVAISDYDEFHKTAKRHILTSVLGPTAQ (0) 1816161

1816072 KRFRIHRDTLVENVSKQLHDLVRTDPNEAVNLRKSFQSELFGLALKQ

        ALGKDIEAIYVEGLDATLPREDLLNILVLDIMEGAIDVDW 1815713

1815712 RDFFPYLKWVPNKSFEHRIQRKHLRREAVMKALIADQRKRIISGE

        ELNSYIDYLLSEANTLTEKQILMLLWEAIIETSDTTLVSTEWA 1815353

1815352 MYELAKDSKRQ

        EQLFLEIQNVCGSNKITEEKLCQ 1815173

1815172 LPYLCAVFHETLRKYSPAPIVPLRYVHEDTQVGGYRIPKGTE 1815047

1814749 IAINIYGCNRDKNVWESPEEWKPERFLNGKYDPMELQKTMAFGAGKRVCAGAQQAMTIS 1814570

1814569 CTAIARLIQEFEWSLKEGEEKNVATMGLTTHKLHPMLAHIKPRN* 1814435

 

SL2.30ch04 61589482-61593476 (-) strand

 

>CYP92B5 CYP92B@3 scaffold03736 71% to CYP92B1 Petunia

1063465 MEISWAFIVFGSWL

1063507 FAFAFVLKILNHPAKRKLPPGPKPWPIIGNLNLLGSLPHVSLHHLSQKYGDLMLLKFG 1063680

1063681 SKPVLVASSPEMAKEILKTHDAIFASRPELAAGKYTSYNYSDMTWAPYGAHWRQARRIYL 1063860

1063861 TEIFSPKRLDSFEHIRVEEGRTLISRLFPLSGKPVLLKDHLPRFTLRTISRLVMSDK 1064031

1064032 YYNDDQSIITLETLQQMLDEWFLLGGVINIGDWIPWLSWFDLQGYLKQMKTLGKNFT 1064202

1064203 IFFNYVIEDHKATKREIEEDYVAKDMVDTLLHFADDPNLDVKLTSDRLMGLIH (0)

1064430 DLISGATDTSAATIEWAFQELLRSPNITEKAQQELDRAIGRERWVEEEDFSKLPYIDAIIKETF 1064621

1064622 RLHPLCALLPPHYSIEDCNVAGYDIPKGTIVYVNAWSLGRNSKYWDRAQEFIPERFIE 1064795

1064796 NNIDIKGQNFALLPFGSGRRKCPGYSLGMKVVRTTMANLLHGFNWKLGGDMRPEDI 1064963

1064964 SMDEIYGLTTHPNKPVSVIMEPRLPLHLY* 1065053

 

>CYP92B5 CYP92B@3 AK326302 tomato = scaffold03736, 89% to CYP92B.1

1063465 MEISWAFIVFGSWLFAFAFVLKILNHPA KRKLPPGPKPWPIIGNLNLLGSLPHVSLHH

LSQKYGDLMLLKFGSKPVLVASSPEMAKEILKTHDAIFASRPELAAGKYTSYNYSDMTWA

PYGAHWRQARRIYLTEIFSPKRLDSFEHIRVEEGRTLISRLFPLSGKPVLLKDHLPRFTL

RTISRLVMSDKYYNDDQSIITLETLQQMLDEWFLLGGVINIGDWIPWLSWFDLQGYLKQM

KTLGKNFTIFFNYVIEDHKATKREIEEDY (0)

DLISGATDTSAATIEWAFQELLRSPNITEKAQQELD

RAIGRERWVEEEDFSKLPYIDAIIKETFRLHPLCALLPPHYSIEDCNVAGYDIPKGTIVY

VNAWSLGRNSKYWDRAQEFIPERFIENNIDIKGQNFALLPFGSGRRKCPGYSLGMKVVRT

TMANLLHGFNWKLGGDMRPEDISMDEIYGLTTHPNKPVSVIMEPRLPLHLY

 

>CYP92B6 CYP92B@4 scaffold03736 71% to CYP92B1 Petunia

1069429 MDIPWVFV

1069453 VFGAWLLSLVFLSKKFNHSKRKLPPGPKPWPIIGNLNLIGSLPHVSFHHLSQKYGDLML 1069629

1069630 LKFGSKPVLVASSPEMAKEILKTHDTIFASRPSLAVGKHTSFNYSDMVWASYCAYWRQAR 1069809

1069810 KIYLTEIFSPKRLDYLEYVRIEERKTLISCLFAHSGKPIFLKDHLPRFTLRTINRLV 1069980

1069981 MSDNYCSDQSNDSDTSIVTLERLQWMLDEWFILGGVINIGDWIPWLSWFDLQGYVRR 1070151

1070152 MKALGKNMTEFYKYVLDDHNAKRIQKSGDFVPKDMVDALLHLANDPNREVKLTSDRMMGLIH (0)

1070420 NLVAGGTDTSAATIEWAFQELLRSPNIMEKAQQELDRAIGKEGWVEEEDFSKLPYIDAI 1070596

1070597 IKETFRLHPLCALLAPHYSLEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRPEEFIPER 1070776

1070777 FIENGIDIKGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGFNWKLAGDMKP 1070944

1070945 EHISMDEIYGLTTHPKKPISVIMEPRLRLHLY* 1071043

 

>CYP92B7 CYP92B@5 scaffold03736 70% to CYP92B1 Petunia

1092470 MDIPWVFIVFGSWLFA

1092518 LAFVFKKLNHPKRKLPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLLKFGSKPV 1092694

1092695 LVVSSPEMAKEILKTHDAIFASRPVLAAGKYTSFNYSDMTWAPYGAYWHQARKIYLTEIF 1092874

1092875 SPKKLHSLEYIRIEERQTLISRLYPHSGKPIFLRDHLPRFSLRTISRLVMSDKYFSD 1093045

1093046 QSNSDTSIVTLERLQWMLDEWFLLAGVINLGDWIPCLSWFDLQGYIKRMKDSGKNFT 1093216

1093217 QFYKYVLDDHNAIKMQKSGDFVPKDMVDALLHLANDPNREVQLTSDRMMGLMH (0)

1093465 SLLAGATDTSAATIEWTFQELMRRPNIMEKAHHELERAIGKERWVEEEDFSKLP 1093626

1093627 YIDAIIKETFRLHPLCAVLPPRYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRAEE 1093806

1093807 FIPERFIENNIDIKGQNFALLPFGSGRRKCPGYSLGMKVVRTTMANLMHGF 1093959

        NWKLGGDTKPEDISMDEIYGLTTHPKEPISLIMEPRLSLHLY* 1094088

 

>CYP92B8 CYP92B@6 scaffold03736 69% to CYP92B1 Petunia

MEIPWVFLVFGSWLFALA &

1113159 FVIKILNHPKRKLPPGPKPWPIIGNLNHLSSFPHKSLHHLSQKYGDLMLLKF 1113314

1113315 GSKPVLIVSSPEMAEEILKTHDMIFASRPPLAAIKYFSYNYSDMTWASYGAHWRQGRKIS 1113494

1113495 LTELLNPRTLNSLEDIRVEERKTLISRLFNLSGKPILLKDHLTLFTLRTINRSIMSK 1113665

1113666 TYCSDQSNSDTSIITHERLQWMLDEWFLLGGVINIGDWIPWLNWLDLQGYIKRTKALGK 1113842

1113843 NMTEFYEYVLEDHKAKRQTEENYIPKDMVDAMLQLADDPNLEIKLTTDSIMGLIH (0)

1114082 DLVGGGTDTAATMIEWAFQELLRSPNIMEKAQQELDRAIGRERWVEEEDFSKLP 1114243

1114244 YIDAIIKESFRLHPLCAMLPPRYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRPEE 1114423

1114424 FIPERFIENGIDIKGQNFALLPFGSGRRKCPGNSLGMKVVRTTMANLLHGF 1114576

        NWKLGGDMRSEDISMDEISGLTTHLKNPISLITEPRLSLHLY* 1114705

 

SL2.30ch04 56415075-56416674 (+) strand

Added missing N-term with one frameshift

 

>CYP92B9 CYP92B@7 scaffold03736 = M01000003232, 69% to CYP92B1 Petunia

Solyc04g071820.1.1 IS MISSING YELLOW REGION

1121597 MVIPWVFLVFGSWLLALAFVIKILNHPKRKLPPGPKPWPIIGNLNLLGSLPHKSL 1121761

1121762 HHLSQKYGDLMLLKFGSKPVLIASSPEMAKEILKTHDISFASRPPLAAGKYISFNYSDMT 1121941

1121942 WASYGPHWRQTRKISLTGLLNPTTLNSLEYIRVEERQTLISRLFPLSGKPILLKHRL 1122112

1122113 ARFTLRTINRLIMSETYCSSDASVVTHERLQWMFDEWFVLSGLINIGDWIPWLSWFDL 1122286

1122287 QGYVKRMKALRKNMTEFYEYVLEDHKAKRQKEENYSPKDMVDAMLHLAD 1122433

        DPNLEIKLTTDTMMGLIH (0)

1122565 DLVGGGTDTAATTIEWAFQELLKRPNIMEKAQQELDRAIGREGWVKEED 1122711

1122712 FSKLPYIDAIIKETFRLHPLCALIPPHYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYW 1122891

1122892 DRPEEFIPERFIENNIDIKGQNFGLLPFGSGRRKCPGYSLGIKIVRTTMANLLHGFD 1123062

        WKLAGDMKPEDISMDEIYGLTTHPKNPISLIMEPRLPLHLY* 1123188

 

SL2.30ch04 56423565-56425156 (+) strand

 

>CYP92B10P CYP92B@8P scaffold03736 75% to CYP92B1 Petunia, pseudogene

1111522   MEIPWVFIVFGSWLFVLAFVLKILNHPKRKLPPGPKPWPIIGNLNLLGSLPHKSLHHLSQ  1111343

1111342   KYGDLMLLKFGSKPVLIASSPEMAKEILKTHDISFAL  1111235

 

1131861 LNSLEYIRVEERQTLISRLFPLSGKPILLEHHLALFTLRTISRLIMSETYYNSDASVVTHER 1132046

1132047 LQWMFDEWFVLSGLINIGDWIPWLSWFDLQGFVKRMKALRKNMTEFYEYVLE 1132202

        HKAKRQT*ENYSPKDMVDVMLHLADDPDLDA  1105858

 

 

1132306 NQRERWVEEEDFSKLPYIDAIIKETFRLHPVCALLAPHYSLEDCNVAGYDIPKGTAVFVSGWSLGR 1132497

1132498 NPKY 1132512

1132511 GSGRRRCPGYSLGLKVVQTTMANLLHGFNWKLGGDMKPEDISMDEIYGLTIHPKNPISLIMEPRLPLHLY* 1132723

end is from scaffold00103 ver 1.03

1105641 GSGRRRCPGYSLGLKVVQTTMANLLHGFNWKLGGDMKPEDISMDEIYGLTIHPKNPISLIMEPRLPLHLY* 1105429

 

SL2.30ch04 56427882-56433975 (+) strand

 

>CYP82E12P CYP82E@11P scaffold02102

308042-308134 (-) strand

93% to CYP82E.3

308134   EFIPFGSGRQSC*GITYATQVTHLAIAHLLY  308042

 

SL2.30ch12 65178071-65178163 (+) strand

 

>CYP82C22 CYP82D@1 scaffold02102 72% to CYP82D14 (82D14 MAY BE MISSNAMED)

62% TO CYP82C2 ARAB.

2930754 MDTSSYIPLIGVLIFLYFIFKKNKNCSTSKQAPEPAGAWPIIGHLPLLGGTDQLLYRTLG 2930575

2930574 AMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGF 2930395

2930394 APYSPFWREMRKIAMFELLSNRRLDTLKYVQVSEVDMGIQALYKLWVDNNSDR (2) 2930236

PILVELKRWFEDLTLNVIVRMVAGKRYFGAGATCDNDDEARRCQKAINQFFHLIGI

FVPSDAFPILGFLDINGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEAKSTTDSAVQ

DFIDVMLSLEEEGRLSNFPYDADTSIKSTCL (0)

2929138 ALILGGSDTTAGTLTWAISLLLNNPKILRKAQEEIDNHIGKNRQIDESDINNLIYIQAIIKETLRLY 2928938

2928937 PAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWENPNCFNPDRFLTSNV 2928764

2928763 DVKGKDFELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPIDDQPIDLTESPG 2928590

2928589 LTIPKATPLDVLVAPRLSANLYGC* 2928515

 

>CYP81B38 CYP81B@1 scaffold02102 88% to AK326947.1 Solanum lycopersicum (micro Tom)

57% to CYP81B2 tobacco

3238292 MEISYYILIFISLYLLKNHFLRKFQNLPASPFISLPIIGHLYLLNKKPIHKTLANISEKHGPLL 3238101

3238100 YLRFGSRPVLLISSPSLAEECFTKNDVVFANRPRLLAGKHLGYNYTTLLWASYGQRWRNL 3237921

3237920 RRISTHEVLSTQRIQMFADIRRNEVHTLLQRLVRGKSCGGDPNTNVVDMKAAFFEMTLDN 3237741

3237740 LMMMIAGKQYDGDSDEKLEASRRFKEIVTESFKVSGATNIGDCVPLLKWIGVNKL 3237576

3237575 EDKVKLLQEKRDKFMQELIEEHKNRRKGSSVEQSNNTMIDVLLSLQDSEPDYCTDEVI 3237402

3237401 KGMGMVMFTAGTDTTAITMEWALSLLLNNPEALKKAQNEIDTHIGESSRLLDDSDLAQLP 3237222

3237221 YLHGIINETLRMYPAAPLLVPHESSDECVVGGFHVPRGTMLLVNLWAIQNDPKLWDKPNE 3237042

3237041 FKPERFIDVKGQRDGFRLMPFGYGRRGCPGENLAMHVAGLALGSLIQCFE 3236892

3236891 WERVSEELVDMTEGTGLTMPKAIPLLAKCRPRQNIDNLIAHL* 3236763

 

>CYP81B37 CYP81B@2 scaffold02102 100% to AK326947.1 Solanum lycopersicum (micro Tom) 66% to CYP81B26

3255963 MEISYYTLIFTFIYILKNHFLRKFQNLPPSPFISLPIIGHLYLLNKKPLHKTLANITEKHGP 3256148

3256149 LLYLRFGSRPVLVVSSPSLAEECFTKNDVVFANRVNLLAGKHIGYNYTTLVWASYGQHWR 3256328

3256329 NLRRIATHEVLSTQRVQMFADIHRDEVRALLQRLLRGKTSGGDTNTNVVDMKAVFFEMTL 3256508

3256509 NIMMMMIAGKRYYGDSAGKLEESRRFKEIVIESFQVSGATNIGDFVPLLKWIGVN 3256673

3256674 KLEDKVKLLQEKRDKFMQELIEEHKNRRKGSYLEQKNNTMIDVLLSLQDSEPDYYTDE 3256847

3256848 VVKGMGIVMLTAGTDTTASTMEWALSLLLNNPEALKKAQNEIDTHLGESSRLLDESDLAQ 3257027

3257028 LPYLHGIINETLRLCPAAPLLVPHESSDECVVGGFRVPRGTMLLVNLWAIQNDVKLWDRP 3257207

3257208 NEFMPERFIDFKGQRDGFRLMPFGYGRRGCPGENMAMHVAGLALGSLIQCFE 3257363

3257364 WERVSEELVDMTGGPGLTMPKAIPLLAKCRPRQNIDNLLTHL* 3257492

 

>CYP71AT1   Lycopersicon esculentum (tomato) not found in the genome

           GenEMBL ESTs BM111044 94% to 71AT@7P

           BQ513164.1 94% to 71AT@7P

           DN940809.1 92% to 71AT@7P, 92% to 71AT@9

           BG888978.1 89% to CYP71AT@7P, 87% to CYP71AT@9

           BE919854.1 89% to CYP71AT@7P, 89% to CYP71AT@9

           BE919843.1 86% to CYP71AT@7P, 85% to CYP71AT@9

           49% to 71B37, 47% to 71G1v1

           Note 71AT1 is 56% identical to CYP83E1 and CYP83E12

           The 71AT subfamily may need to be moved to CYP83E

MILFLLFVALPIILIFVLPKAKKGAKNTQPPGPVGLPFIGNLHQFDSLTPHIYFW

KLSKKYGKIFSLKLGSTPMVVVSSAKLAKEVLKT

QDLVYCSRPSILGQQKLSYNGRDIVFAPYNDYWREMRKISVLHLFSLKKVQLYKPIRE

DEVSRMIKKISLHAASSQITNLSNLMISLISTIICRF

AFGVRFDDEAHERKRFDYLLAETQAMMASFFVSDVFPFLGWIDKLTGLTDRLKKNLKELD

EFYEELIEQHQNPNRPKSMEGDIVDLLLQLKKEKSIPIDLTLEDIKGLLMNV

LVAGSDTSAAGIVWTMTALMKNPKAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVIKE

SFRLYPPVPLLVPRESMKKSTLEGYEIQAGTIVHVNSWAIARDPEIWENPEEFIPERFLN

SDIDYKGQNYELIPFGAGRRGCPGMTLGVASMELALSNLLYAFDWELPHGMKKEDIDTNV

RPGITMHKKNDLCLIPKSYF*

 

>CYP71AT13-de1b CYP71AT@1P scaffold01402

2398055-2398150 (+) strand

83% to CYP71AT.1, 78% to CYP71AT@7P

QNMPY &

KAVTKETF &

FRLYPPF

PLLMSRESIQKSTLQGYE

2398055   RFLNNDIDYFKG*NFELISFGVGRRGCPDV*F  2398150

 

SL2.30ch09 66952559-66952766 (+) strand

 

>CYP71AT13 CYP71AT@2 scaffold01402 71% to CYP71AT1 Lycopersicon esculentum (tomato)

= M01000021935, M01000000997, M01000000539, M01000015380

2399708 MLFSLFVFLVIIIILSFLLPKAKRNGKNILPPGPLGLPFIGNLHQFDSVNPHTYFLKL 2399881

2399882 SKKYGKIFSLKFCSTPVVVISSAKLAKEVMKTQDLTFCSRPSTLCQKKFSYNGQDIASSP 2400061

2400062 YNDNWKELRKICVTHLFSPKKVQYFVPIREDEVSRMIKEISQQAVTSRTTNLSSILI 2400232

2400233 SLTTTIICRVAFGIRYDEETRERRNFNELLKVTEEMLVSFFVSDFFPLFGWIDNLSKKINILEKN

        FKDLDEFYEGLIEQHLSPNRPKSMEKGDIIDLLLQLKKDKSTPIDLTLDNIKAIIM (0)

2400757 NMLVGGTNTSAATIIWAMTSLIANPNAMKKVQEEIRESVGKKSIVSEDDVQNLPY 2400921

2400922 FKAVIKETFRLYPPAPLLVPRETMRNSVLEGYEIKAKSIIYVNAWAIARDPEIWENPEKF 2401101

2401102 IPERFLNSDIDFKGQNFELIPFGAGRRGCPAMTVGVATVELVLSNLLYAFDWELPCGM 2401275

2401276 KREDIDTHVLPGLTMHKKKPLCLVPRNYL* 2401365

 

>CYP71AT14P CYP71AT@3P scaffold01402 68% to CYP71AT2v2 Nicotiana tabacum

MFFPFFVVIVIIIILSFVLPKLKKNEKNILPPGPLRLPFIG

NLHQFDSLTPH

YLKVTEEMLADFYVPDYFLLFG*IDKLSEKLNKLEKNFKYLDEFYEGLI

QHLSSNRPKSVEGDIVDLLQR

KKEKSIPIDLTLVNIKGIIM ()

2403738 NMLVAGTDTSAATIIWAMIALIANPSAVKKVQVKFRESVGEKSIVSEYNVQNLRYFK 2403908

2403909 AVIKETFRLYPPVPLLVARETMQNSMLEGYEIKPKTIDYVSAWAIGRDPDIWESSEEFIP 2404088

2404089 ERFLNNDIDYKSQDFELIPFGAVRRGCPGRALSVANVELVLSNLFYAFDWELPRGMKR 2404262

2404263 EDIDTDVLPGIIPHKKNTMVPCS* 2404334

 

SL2.30ch09 66957834-66958952 (+) strand

extended N-term

 

>CYP71AT15 CYP71AT@4 scaffold01402 = M01000000771 LA3475 type 6, 3 aa diffs, 73% to CYP71AT1

M01000003308, M01000000027

2405501 MMFFPLFVTLVIITILSFILPKTRKNRKNILPPGPLGLPFIGNLHQFDSVTTHLYFSKLSKKYGKI 2405698

2405699 FSLKLGSSTMVVVSSANLAKDVLKTQDLVFCSRPSLLGQQKLSYNGHDIALSPYNDYWRE 2405878

2405879 LRKISVLHLFSLKKVQYFSPIREDEVSMMINKISQQAATSQITNLSDIVISLTTTIIY 2406052

2406053 RTAFGIRYDEETREGRRFDELLKVTEEMLAGFFVTDYFPLLGWIDKLSGKINKLEK

        NFKDLDEFYEGLIEQHLNPKRPKSMEGDIIDLLLELKKEKSTPIDLTLENIKAIIM (0)

2406628 NMLVGGTNTSAAAVVWAMTALISKPNAMKKVQAEIREMVGKKSIVNEDDIRN 2406783

2406784 LPYFKAVIKETFRLYPPGPLLIARETMQNSILEGYEIKAKTIVHVNIWAIARDPEIWENP 2406963

2406964 EEFIPERFLNSDIDLKGQNFELIPFGAGRRGCPAVALGVATVELVLSNLLYAFDWELP 2407137

2407138 CGMNKDDIDTNVLPGLTRHKKQPLCLVPRNYLQKLN* 2407248

 

>CYP71AT@5P scaffold01402

2407919-2407981 (+) strand

94% to CYP71AT.19P

ILSFLLPKAKR

2407919   VNLAREVMKTQDLAFCSRPSLLGQQKLSYN  2407981

KRPTSMERDIIDRLLQLKKEKSTPINLTSDNIK

AFDWELPCGMNIEDIDTDVL

LAMHKKKPFCLVPGNYY*KLN 66962960

 

 

 

SL2.30ch09 66962503-66962960 (+) strand

 

>CYP71AT16 CYP71AT@6 scaffold01402 72% to CYP71AT1

2410582 MMLFLLLLVAFLIILIFLLNKTKI

2410510 SRNTNLPPGPLGLPIIGNLHQYDSVTPHIYFWKLSKKYGKIFSLKFGSTPIVVISSAKLA 2410331

2410330 KEVMKTQDLAFCSRPSTLCQQKLSYNSNDIVFSPYNDYWREIRKICLIHLFSLKKVQSFS 2410151

2410150 PIRVDEVSRMIKKISQQAAASQITNLSKIVISLTTTIICRVAFGIRFDEE AHEKRRFDE 2409974

2409973 LMNESQDILASFFVSDFFPSLSWIDKFTGMKNKLEK NFKCLDEFYEELIEQHHNP 2409809

2409808 NRPKSMEGDMIDILLQLRKEQSTQIHLTLDNIKAILM (0) 2409698

2409597 NLFLAGTDTSAITVIWAMTALMKNPKAMKKVQEEVRKTMGKKGIVNEDDTQNMSYLKAVI 2409418

2409417 KETFRLYPPAPILVARETMQNSILAGYNIPPKTTIRVNYWAIARDPEYWENSEEFIPERF 2409238

2409237 LNNNIDFKGQDYEFIPFGAGRRGCP (1) 2409163

2408982 GLALGVATVELILSNLLYAFDWELPFGMNIEDIDTESLRGITMHKKNDLCIVPKNYM* 2408809

 

>CYP71AT18P CYP71AT@7P scaffold01402 pseudogene 90% to CYP71AT1

2420141 MMLFLLFVAFPIILIFLLLKVKKSGKNNVPPGPIGLPFIGNLH*FDSLTTHIYFWKLS 2420314

2420315 KKYGKIFSLKLGSTPMIVVSSAKLAKEVLKTQDLVFCSRPSILGQQKMSYNGHDIVFARY 2420494

2420495 DDYWRETRKISVLHLFSLKKVQFYKPIREDEVSRMIKKVSQQAASSQITNLSNLMISL 2420668

2420669 TSTIICRLAFGVRFDDE 2420719

        AHERKRFDYLLAEAQAMMASFCVSDIFPFLYWIDKLIGL &

        RLETNFKELDEFYEELIEQHQNPNRPKSMEGDMVDLLLQLKKDKSIPIDLTLEDIKGLLM (0)

2421105 DMLVAGSDTSAAGIVWTMTALMKNPKAMKKVQQEIRESIGNKGIVNEDDIQNMPYFKAVIKET 2421293

2421294 FRLYPPIPLLVPRESMKKSTLEGYEIQAGTIVHVNSWAIARDPEIWENPEEFIPERFLNS 2421473

2421474 DIDYKGQNYELIPFGAGRRGCPGMTLGVASMELGLSNLLYAFDWELPHGMKKED 2421635

2421636 IDTNVSPGIATHKKNELCLIPGSYF* 2421713

 

>CYP71AT19-de1b CYP71AT@8P scaffold01402

2423427-2423651 (+) strand

76% to CYP71AT.20

MIMIILIVLVTPIVLNFLAKK

2423427   RKNDIAFAPYIDYWKEMQKVCVVHLFSLKKFRFFSLNREDEVSRMITKIS*SATASQITN  2423606

2423607   LSNLAISLTSIIFIK  2423651

VRYDEEAREKRRF

 

SL2.30ch09 66978757-66979091 (+) strand

 

>CYP71AT19 CYP71AT@9 scaffold01402 89% to CYP71AT1 C-term, 86% to CYP71AT1 N-term

= M01000003601, M01000001713, M01000000134

2425277 MIIFLLFVTFPILLIFLLSKAKKSSKNNVPPGPIGLPFIGNLHQFDSLTTHIYFWKLSKKYGKI 2425468

2425469 FSLKLGSTPMIVVSSAKLAKEVLKTQDLVFCSRPSFHGQQKLTYNGRDIVFVRYNDYWRE 2425648

2425649 MKKISVLHLFSLKKVQFYKPIREDEVSRMIKKVSQQAAASQITNLSNLMISLTSTIIC 2425822

2425823 RLAFGVRFDDEAHERKRFDHLLVETQAMMTSIFVSDIFPFLYWIDKLTGLTDRLEK

        LFKELDEFYEELIEQHQNPNRPKSMEGDMVDLLLQFKKEKSIPIDLTLEDIKGLLM (0)

2426247 NVLVAGSDTSAAGVVWTMTALMKNPKAMKKVQQEIRESIGNKGIVNEDDVQNMPYFKAVI 2426426

2426427 KETFRLYPPIPLLVPRESMKNSTLEGYEIQAGTIVHVNSWAIARDPEIWENPEEFIPERF 2426606

2426607 LNSDIDYKGQNYELIPFGAGRRGCPGKTLGVAFMELALSNLLYAFDWESPHGMKKEDI 2426780

2426781 DTNVRRGITPYKKNELCLIPTSYF* 2426855

 

>CYP71AT20P CYP71AT@10P scaffold01402 80% to CYP71AT1

2428688 MMLFLLFVALSIFLIFLLPKAKKSVKNNLPPGPISLPFIGNLHQYDSLTPHIYFLKLSN 2428864

2428865 KYGKIFSLKFGSTPIVVISSAKLAKEVMKTQDLVYCSRPSLLGQQKLSYNGHDIAFAPYN 2429044

2429045 DYWREMRKICVLHLFSLKKVQSFCPICEDEVSRMIKKISQQAVDSQITNLSNSMISL 2429215

2429216 TSAIICRVVFGVKFDEETHERKRFDYLLPEVQAMSVSFFMSDYFP &

        LLSWIDKLTGLTDRLEKNFQDLDEFYEELIEQHQNPNRPKSMEGDILDLLL

        QLKKEKSTPIDLTLDGIKGILM (0)

        NVFAAGSDTR

2429692 AMTALMKNPKIIKKVQKDIRETIGTKGIVNEDDIQNMSYFKAVIKETFRLYPPSPLLIPR 2429871

2429872 ETMKKSTLEGYEIQPGTIIHVNSWAIARDSEI*ENPEEFIPERFLNSNIDFKGQHFEL 2430045

2430046 IPF &

2430057 GCPGITLGVASMELALSNLLYAFDWELPYG & 2430146

2430146 MKKEDIDTFVKPGTTMHRKNDLCLIPKIQII* 2430241

 

SL2.30ch09 66984085-66985639 (+) strand

 

>CYP71AT21 CYP71AT@11 scaffold01402 83% to CYP71AT1

2432256 MILFLLFVAFAILLIFLLSGKRNLPPGPIGLPFIGNLHQYDSLTPHLYFWKLSKKY 2432423

2432424 GKIFSLKLGSSIMVVVSSAKLAKEVLKTQDLVYCSRPSLLGQQKLSYNGHDIAFSPYNDY 2432603

2432604 WREMRKICVLQLFSLKKVQSFSPIREDEVSRMIKKISQQAACFQMTNLSSLMISLTST 2432777

2432778 IICRVAFGVRFDEEAHERKRFDYLLAEAQAMMATFFVSDFFPSLSWIDKLTGQTDRLERNFKNLNE

        FYEELIEQHQNPNRPKSMEGDILDLLLQLKKEQSTPIDLTLEDIKGLLM (0)

2433568 NVLVAGSDTSAAVVVWAMTALIKNPKVMKKVQEEIRKSIGTKGVVNEDDIQNMSYLKAVI 2433747

2433748 KETFRLYPPDPLLIPRESMKKSTLEGYEIQPKTIVHINAWAIARDPEIWENPKEFIPERF 2433927

2433928 LNSDVDFKKEDYELIPFGAGRRGCPGITLGITAIELALSNLLYAFDWELPYGLKKEDI 2434101

2434102 DTNVRHGITMHKKNDLCLISKKYF* 2434176

 

>CYP71AT22P CYP71AT@12P scaffold01402 71% to CYP71AT1 pseudogene

2435537 MMLFLLLVAFPIILIFLLPKAKKCDKKNNVPPGPKGLPFIGNLHQFDSLTPHIYFLKLSNKYGK 2435728

2435729 IFSLKLGSIPIVVVSSAKLAKQVLKTQDLLFCSRPSHLGQKKLSYNGRDIVFHRYNDYWR 2435908

2435909 EMRKISVLHLFSHKKVKLFSPIREDEVSRLIEKISQQASASHITNLSNLMISLSTTIIC 2436085

2436086 RVAFGIRFDEEAREKRRFDELLEESATMLTSFYISDFFSYLGWIDKLTELTNRL &

        EKNFKDLDEFYEELIEKHVDPNKPKSMEGDILDLLLQLKKEKLTPIYLTLEDIKAIVM (0)

2438860 TIVHVNAWAIARDPEIWENPEEFIPERFLNNDIDFKGEDFELISFGAGRRGCPGIALGVA 2439039

2439040 SMELALSNLLYAFDWELPCGMKKEDIDTNVKPGITMHKKNDLCLIPIKYI* 2439192

 

SL2.30ch09 66990936-66994591 (+) strand

Solyc09g092660.1.1    SL2.30ch09    66994442    66994591    +    2    Cytochrome P450 (AHRD V1 ***- A9ZT58_COPJA)

 

>CYP71AT23 CYP71AT@13 scaffold01402 79% to CYP71AT1

2439661 MMLFLLFVAFLIPLIFLLSKAKKSSKNNLPPGPIGLPFIGNLHQFDSLAPHIYFSKLSKKYG 2439846

2439847 KVFSLRFGSTPIVVISSAKLAKQVLKTQDLAFCSRASHLGQQKLSYNGRDIVFAPYNDYW 2440026

2440027 REMRKTCVLHLFSLKKVQSFRPIREDEVSRMIKKISQHVVTSQITNLSNLMILLSSSI 2440200

2440201 IFRVAFGIRYDEESHESRRFYFLFEESAAMMTSFFVSDFFPSLNWIDKLTGLTNRL

        DKNFKELDEIYEELIEQHLNPNRPKSMEGDILDVLLQLKKEKSTPIDLTLEDIKAIVM (0)

2440709 NVLLAGSETSAAAVVWTITALMKNPKAMKKVQQELRKSIGNKGTVNEDDIQNLPYFKAVI 2440888

2440889 NEAFRLYPPAPLLIPRETMKKSTLEGYEIQPGTIVHVNAWAIARDSDVWENSEEFIPERF 2441068

2441069 FNSDIDFKGQDFEFIPFGAGRRGCPGITLGVASMELALSNLLYSFDWELPYGMKKEDI 2441242

2441243 DTDFKPGLAIHKKNDLCLVPKCYM* 2441317

 

>CYP71D186-de1b2b CYP71D@20P scaffold02227 CYP71D pseudogene

2632219-2633200 (+) strand

2632219   VSLVVVTSPNVVKQVLKTHDLAFASRPTLLAAEIICYNGSDIVFSPYGDYWRQMRKI  2632389

2633060   WTMVEMMRNPNVITRAQEEVRNTFRGKETFDENDIEELKYLKLVVKE  2633200

 

SL2.30ch01

2703963 VSLVVVTSPNVVKQVLKTHDLAFASRPTLLAAEIICYNGSDIVFSPYGDYWRQMRKI 2704133

2704126 VKFPLTNDNIKAIIFAALLKLMKERGLQFPLTNDNIKAIIF 2704248

2704793 AIIDWTMVEMMRNPNVITRAQEEVRNTFRGKETFDENDIEELKYLKLVVKE 2704945

        RFENNSMDFVGNNFEYL 2704996

 

 

>CYP71D186 CYP71D@21 scaffold02227 77% to CYP71D55 Hyoscyamus muticus

93% to CYP71D.8P

2635416 MHFFNIFSLFIFVS

2635458 FLFLLIKYWKNSNDQIRKKLPPGPWKLPLLGNIFHLLGGPPHRVLRDLAKKYGSIMHLQL 2635637

2635638 GEVSLVVVTSPDMAKQVLKTHDIAFASRPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKIC 2635817

2635818 IMELLSAKNVKSFSSIRQDEVLRMIEFFRSSSGETVNATRRIFQFASSMTCRSAFGK 2635988

2635989 VFKEQDELIQLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKSKIMDVH 2636132

2636133 HELDAILENIINEHKNNGELGGEGLVSTLLRLMKEGGLQFPITNDNIKAIIF

        DIFAAGTETSSATIDWIMVEMMRNPNVLSKAQEE 2636483

2636484 VRNAFKGKETFDENDVEELKYLKLVVKESFRLHPPFPLLLPRECREEVEINGYTIPLKTK 2636663

2636664 VMVNAWAIGRDPKYWDDAESFKPERFEDNSMDFIGNNFEYLPFGSGRRNCPGISFGLA 2636837

2636838 NVYFPLAQLLYHFDWKLPNGINSSELDLTESAGSTCARKNNLYLIATPYQ* 2636990

 

>CYP71D185 CYP71D@22 scaffold02227 77% to CYP71D55 Hyoscyamus muticus

2642657 MEFFNLIS

2642633 ISLFVSFLFLLKKLKNSNSQINKSLPPGPWKLPFVGSMFHMIGGLPHRVLRDLAKKYG 2642460

2642459 SILHLQLGEVSLVVVTSPIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFCPYGDYW 2642280

2642279 RQMRKICVLEVLSGKNVRSFGSIRQDETIRLVEFFRSSSSSEPVNVTKRISLFTSFII 2642106

2642105 CRSAFGTIFKEQDEFIQVMKGVTSLLEGFNVADIFPSLKFLHVLSGMK 2641962

2641961 SKTMYLHHKVDTIVENVINEHKKNLVNGKTNGELGGEDLIDVLLRLMEDGDLQFPITNDN 2641782

2641781 IKAIVY (0) 2641764

2641077 DMFAAGTETTSTTIDWAMVEMIKNSSILVKAQKEVREVFRGKDTFDENDVEELKYLKLVVKET 2640889

2640888 LRLHPPLPLMLPRECREEVDIDGYTIPSKTKLIVNVWAIGRDPKYWDDAESFKPERFE 2640715

2640714 QSSLDFVGNNFEFLPFGSGRRICPGISFGLANVYLPLANLLYHFDWKLPPGIKPSDLDMT 2640535

2640534 ESDGASCTRKSNLYLIMTPYQPSQE* 2640457

 

>CYP71D184 CYP71D@23 scaffold02227 = M01000000829 LA3475 type 6, 73% to CYP71D55 Hyoscyamus muticus

2661631 MQFFNIFSLFLFMSFLFLLNKWKNSN

2661553 SKSKRLPPGPWKLPLIGSMFHLLGGLPHHVFRDLAKKYGPIMHLQLGEVSLVVVTSADMA 2661374

2661373 KQVLKTHDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSAKNVKSFN 2661194

2661193 SIRQDEVHHMIEFFRSSSGETINVTKRIYQFSSSMTCRSVFGKVFKEQNKLM 2661038

2661037 ELAKEASRFLKGFDVADIFPSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNNGELGGE

        GLLVALLSLMKEGGLQFPITNDNIKAIIF (0)

2659305 DMFAGGTDTSSTLIDWAMVEMMKNPSVLLKAQDEIRNAFTGKETFNENDVEELKYLKL 2659132

2659131 VVKETFRLHPPAPLLVARECREEVDIDGYNIPLKTKVLVNAYAIGRDPKYWIDAECFKPE 2658952

2658951 RFEQISVDFIGNNFEFLPFGSGRRICPGISFGLANIFFPLAKLLYHFDWKLPIGINPS 2658778

2658777 DLDLTESAGIACARKSNLYLIATPHEPSQE* 2658685

 

>CYP71D214P CYP71D@31P scaffold04338

325737-336097 (-) strand

71% to CYP71D.47P

MKFQFPFFIFLFIFLSFLYLLP

336097   VEWEKSRNLNKKLPPGPWKLPFLGS  336023

         FHHLALEGGLPHHALTNLGKKHGPSMHLQLGEISTILVRT  335904

335913   SPDMAREVMKTNDLAFA  335863

328754   LDIICYNSIDIVVSSYENY*RQMRKVCVLELLTIKNFWSFS  328632

328630   IRRDEASRLLQLIQSSTRGEPINATEQILRYESSMT

328521   CKAAFGDQLLKDEGKFIEILRELVESASGFSVSDIFPSIKILHVLSGLRSKILKLHQNVD  328342

         SIVEDVINDHKKNIASGKKGK*CI  328271

         NDVFGDEDLVDFLLRLIESGEVKT

         PITNDNIKAIII  328175

326267   NMFTAPTETSGTITTWAIIEMMRNSNLPAKAQAEVRKAFKGQETFN*DVIE

325925   IPLLIPRKCMEETTINGYTIPLKTRVMVNVYAMGRDPKYWLDAESFIPEKFEQSSIDYIGNNFRV  325737

 

SL2.30ch09 59153332-59164638 (-) strand

Added N-term

 

>CYP94A24 CYP94A@1 scaffold04338 1350947-1352455 (+) strand, 92% to CYP94A.3 potato

MMIIDLEFSTLLICLVPFLFIFFINLFHSKSTKIPKSYPIIGSYFSILANKHRRIQWSSD

IIQTTTNLTFTLIRPFGNRQIFTANPSNVQYMLKTHFHIYQKGHMFKSTMADFLGDGIFN

VDGEIWKYQRQVASHEFNTKSLRKFIETVVDAELNERLIPLLAVAASEKKVVDLQDILQR

FAFDNICKIAFGYDPAYLSPSLPQEKFAVAFEEAVKLSSERFNAIFPFLWKIKRHFDFGS

EKRFRIAVDEVRQFAKQLVREKQSELNQKSSLDSVDLLSRFLSVGHRDDDFVTDVVISFI

LAGRDTTSAALTWFFWLISEHPVVESSILNEIKLKSHTPVYEEVKEMIYTHASLCESMRF

YPPVPIDSKTATEDNVLPDGTFVKKGTRVSYHPYAMGRAEELWGSDWNKFKPERWLDKDE

VTGNWNFVTKDMYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRFKVVPVTEKGVEPVF

ISYLTAKMKGGFHVTIEERDHE*

 

>CYP71BP2 CYP71x@7 scaffold04338 48% to CYP71D55

1575349 MELTILLCALFLVLPLLVTKWYKECNSKKKLPPGPWKLPFIGNLHHFIDWQSSELLP 1575179

1575178 HRTLAKLASKHGGLMHMKLGEREAIVVSSPQMVREVMRKHDLIFSNRPTLLVGTEMFYDH 1574999

1574998 ADMGFCDYNDFWRQMRKICNQELLGHTYIQSFYPNMMNEITNLVSCIKSCASEGGGSINM 1574819

1574818 TETLSLYTNSIICKASVGRACKNQGSLIEI

        MRIVSASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVVLEEIIDEHESQNSETSE

        KDIVDVLLRLQKSQDFSIPITRDNIKAVIM (0)

1574388 DLFSGGSTTSASTMEWAFSELMKNPEMMKKAQDEVRRVFKGKETTIDLTDIQKL 1574227

1574226 KYIKMIVKETLRFHPLAPLLAPRESREECEINGYVIPKGTMALVNFWAISRDPNYWRNPE 1574047

1574046 IFDPERFNDSHLDFIGAHFEFTPFGTGRRMCPGLSFSMATVELSMALLLYHFDWKLPN 1573873

1573872 RMNPHELDMTEKFGSTLERKNNLFLIPSLYVRA* 1573771

 

>CYP71BP1 CYP71x@8 scaffold04338 53% to CYP71BE6 Vitis, 57% to potato CYP71x.1v1 (intact gene)

1586939 MELTILLCALLLVLPLLVTKLYKECNSKK

1586852 KLPPGPWKLPLIGNLHHLIDWQSSELLPHRTLAKLASKHGDLMHMKLGEREAIVVSSPQ 1586676

1586675 MVREVMRKHDLIFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQELLSHKNIQS 1586496

1586495 FYPNMMNEITNLVSCIKSSASEGGSSINMTETLSLYTNSIICKASVGRACKNQGSLIEIM 1586316

1586315 RTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVVLEEI 1586178

1586177 INEHESQNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIII (0)

1585970 DLFAGGSTTSASTMEWAFSELMKNPEIMKKAQDEVRQVFKGKETTIDQADI 1585818

1585817 QKLKYIKMIVKETVRFHPLAPLLAPRESREECEINGYVIPKGTMALVNFWAISRDPNYWQ 1585638

1585637 NPEIFDPERFNDSHLDFIGAHFEFTPFGTGRRICPGLSFSMATVELSIALLLYHFDWK 1585464

1585463 LPNGMNPHELDMTEKFGNALERKNNLFLIPLPYVRA* 1585353

 

>CYP94A26 CYP94A@5 scaffold07059 47% to CYP94B1

3062954 MTFIDLLLLFSLIPFFLIFFLKFQKARKNPISSNTKIPKSYPIIGSYFSLLANQEQRIQWLS 3062769

3062768 DIILSTPKLTFTLIRPLNFHTIITANPSNVQHILKTNFSVYQKGQNSNNTL 3062616

3062615 ADFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVESVVDVEVSERLVPILANAAAEKN 3062436

3062435 VVDLQDVLQRFAFDNICKIAFGYDPKYLLPNLPEAEFAVAFEDCVRLSSERFAVPFPLIW 3062256

3062255 KMKRAFGIGSEKKLRIAVGEVREFAKRIVREKLNERSSLDSADLLSRFLSTGHSD 3062091

3062090 EDFVVDIVISFILAGRDTTSAALTWFFWLISKNADVESEILREIGGKEE 3061944

3061943 DVSMRYDEVKNMMYTHASLCESMRFYPPVPMDSKEVMKDDVLPDGTFVKKGMRVTYHPYA 3061764

3061763 MGRSEEIWGKDWAEFKPERWLNKDEMTGNWMFVGKDPFAYPVFQAGPRVCLGKEMAFLQM 3061584

3061583 KRVVAGVLQRFKVVPVVEKGVEPMFISYLTAKMKGGFPVTIEERM* 3061446

 

>CYP71D221 CYP71D@46 scaffold07184 77% to CYP71D50v2

3502126 MQILSLVYIFLFLSFLFLLRKWKNSKSQTTK

3502033 KLPPGPWKIPFIGSIHHIVGGYPHHVLRDLAKKYGPLMHLQLGEVCVVVVTSSEMAKQIF 3501854

3501853 KTHDLAFASRPKLLVMDIITYNSRDIAFSPY (1) 3501761

GDYWKQMRKISVMELLNAKNVRSFSSIRHD

EVVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKLPKDQDIFIKLVRQVLRLSN

QGFDMADIFPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSFANHKRTSDDDALG

GGDEDLIDVLLRLMKDKSLQFPINNHTIKAIIV (0)

3500581 DIFAGGTDTTSIIIVWAMAEMMRNPSILAKAQAEVREAFKGKVKFDKYDVEELKYLKLVV 3500402

3500401 KETLRLHPSVPLSVPRECREETDINGYTIPLKTKILINVWALGRDPEYWDDPESFKPERF 3500222

3500221 EQCSVDFIGNNFEFLPFGSGRRVCPGISFGLANIYSSLAQSLYHFDWKLPNGMDPTDL 3500048

3500047 DLTESDGGSTGMKNDLYLIATPYKP* 3499970

 

>CYP77A1 = old CYP77A2 CYP77A@2 scaffold07184 74% to CYP77A14

89% to eggplant CYP77A1 (ortholog), only 72% to eggplant CYP77A2

3896131 MEPFIFTISAIFLSLFIFILTLKPKSKTLNLPPGPPGWPVVGNLFQVAGSGKQFFQYIRDLKPKYD 3896328

3896329 SIFTLKMGSRTMIIVTSADLAHEALIEKGQIFASRPKENPTRTIFSCNKFTVNAAVYGAV 3896508

3896509 WRSLRRNMVQNMLSPIRLKEFRDCRETAMEKLIERIRVDAKENNDVVWVLKNARFAVFYI 3896688

3896689 LLAMCFGVGMDDEEMIERVDQMMKDVLIVLDPRIDDFLPILRLFVGYKQRKRVN 3896850

        DVRKRQIETLVPLIEKRRRVLQNPGSDKTATSFSYLDTLFDVKIE (1)

        GRKSGPTNAELVTLCSEFLNGGTDTTATALEWAIGRLI 3897207

3897208 ENPSIQEKIYKEIKTVVGDKKVDENDIEKMPYLNAVIKELLRKHPPTYFTLTHTVTEPV 3897384

3897385 KLGGYDIPMDTNVEFFVHGISHDPNIWSDPDKFDPDRFLSGREDADITGVKAVKMMPFGV 3897564

3897565 GRRICPGLGMATVHLNLMLARMVQEFEWLAYPGNSEVDFSEK 3897690

3897691 LEFTVVMKNPLRAKVKPRT* 3897750

 

>CYP71AT27 CYP71AT@18 scaffold07184 60% to CYP71AT7 = M01000016499, M01000022276

4472306 MIFFLLFVAIPICLIFLLPNAKWSGKNKVPPGPIGLPFIGNLHQFDTLAPHIYFWELSKKY 4472124

4472123 GKIFSFKLTSNVPIIVVSSAKLAKEVLKTQDLVFCSRPSLVGQQKLSYNGHDIGFAPYND 4471944

4471943 YWREMRKICVLHLFSLKKVQLFSPIREDEVSRMIKKIYQQAVNSQVTNLSNLMISLN 4471773

4471772 STIICRVAFGVRFDEEAHERKRF

        NYILAEAQAMFAGFFMSDFFPSLSWIDKLTGMIDRLEKNFKDLDEFYEELIEQHYNPNRP

        KSMEGDFIDILLQLKKDQLTPIDLSLEDIKGILM (0)

4470583 NVLLAGSDTSSSVIIWAMTILIKNPKAMKKVQEEIRNLIGNKGIVNEDDIQNMHYLKAVI 4470404

4470403 KETLRLFPPAPLLIPRESMKISTLEGYEFQPRTIVYVNAWAIARDPEIWENPEEFMPERF 4470224

4470223 LNSNIDFKGQDYELIPFGAGRRGCPGLALGVASVELALSNLLYAFDWELPYGLKKEDI 4470050

4470049 DINGKPGITVNKKNDLCLIPKKYF* 4469975

 

>CYP71AT26P CYP71AT@17P scaffold07184

4467572-4469335 (-) strand

4469335   KLSKKYGKIFSLKLASVPIVVVTSPKLAKEVLKTQDLVFL &  4469219

4469214   SRTSLVGQQKLSYNGHDIAFAPYNDYWREMRKICVLHLFSLKKVQLFSLIREDEVSRMIK  4469035

4469034   KIYQRAFNSQVTNLSNLMISLNSTIICRVAFGVRFDEEAHE*KRFNHVVDKAEDMLGRFF  4468855

4468854   VSDFFPSLG*IDKLTGLTNRLEKSFKNLNNI  4468762

          SMEGDIIDLLVQLKKEQLTPTDLSLEDIKGVLM

4468078   AMTILMKNPKP*RKSNKKSEI*LVTKVL*MTMIFKMSYFKAVIKETLKI  4467932

4467931   IHTNSTPNSKRMNGKIHSWAIARDPEI**NPEEFVSERFMNSDIDFKGQDYEL  4467773

4467772   IPLGAGRRGCPTMALGVAYVELALSNLLYAFD*ELPYGLKKEDIDMNGRHGITVKKKNDL  4467593

4467592   CLVPKKYF*  4467572

 

>CYP71AT27-de2b CYP71AT@19P scaffold07184

4473195-4473335 (-) strand

82% TO CYP71AT@18

4473335   IYLVSNLLYAFN*ELPYGLKKEDIDINVRPGVIVNKKNDLCLIPKNY  4473195

 

1216041 IYLVSNLLYAFN*ELPYGLKKEDIDINVRPGVIVNKKNDLCLIPKNYF* 1216187

 

SL2.30ch11 1216041-1216187 (+) strand

 

>CYP71D215P CYP71D@1P scaffold00141

41165-53033 (+) strand

73% to CYP71D.13v2

57761437 SSTIVSAFLEKI*NPHVMEKDNLK

41165   LRLYPLAPLVPRECREEKKINGYTIPMK  41248

52867   TKVLVNAWSISRDFKYWHDSKSFMPE  52944

52953   RFENNTIDFKANCFKFISFSLGRRMRP  53033

MLFSLVNIAHPLFQLLYH 57773495

 

SL2.30ch10 57761437-57773495 (+) strand

 

>CYP71D-se4[1] CYP71D@2P scaffold00141

1524850-1524942 (-) strand

45% to CYP71D.49P N-term

1524942   FKFMIIFLKNLFYVSFIYFILVSFKKKRNIN  1524850

 

SL2.30ch10 59288143-59288235 (-) strand

 

>CYP98A54P CYP98A@1P scaffold00141 pseudogene 68% to CYP98A33v1 tobacco, 85% to 98A@2

1650892 MAFPLVLSLSIFIIFLCYKLHN &

        QLTVKLPPGL*LWSIIGNLLNITPMRFRCFAEWAQSHL &

1650724 PIFSFYLGSQLNVVVNNAELAKEVLKENDQNLANRFRTKPLDNVSKIGMDLIW 1650566

1650565 ADYGPHYVKVRKVCNLELFTPKRLEA 1650488

1650495 LKPIKEDEVTAMIHNIFRDSNKH 1650427

 

SL2.30ch10 59393496-59393961 (-) strand

 

>CYP98A53 CYP98A@2 scaffold00141 66% to CYP98A43 Vitis

1656634 MAFPLVLSLSIFIIFLCYKLHNRLTAKLPPGPWPWPIIGNLFSIAPMRFRCFAEWAQIYG 1656455

1656454 PIFSFYLGSQLNVVVNNAELAKEVLKENDQNLANRFRTKPLDSVSKNGMDLIWADYGPHY 1656275

1656274 VKVRKLCNLELFTQKRLEALRPIREVEVTAMIENIFKDTTKP (1) 1656149

1655389 GDDSKTMTLRGYLGLVSFNNITRLTFGKRFINSKGEVDEQGEELKSIVTDGIRISGKPNLGEFV 1655198

1655197 PWLRWVFKDDNEALESQDRRLNKFTRLIMEEHTIAREKSGETKHHFVDALLTLQKE 1655030

1655029 YDLSDDSIISLFW (0)

        DMVQAGTDTIAITVEWA 1654850

1654849 MAELVRNPRVQQKVQEELDRVIGSDRIIDETDISNLSYLQHVVKESLRLHPPTPLMLPHM 1654670

1654669 ASNNVKVGGYNIPKGSIVHVNVWALGRDPNIWREPLQFRPERFVEEDVDMKGHDYKLL 1654496

1654495 PFGAGRRICPGMNLAINLVTSMLAHLLHHFVWSLPNGVKVEDIDMMESPGTVTYMQTPLH 1654316

1654315 VVPTPRLPRNLYTHVE* 1654265

 

>CYP98A52 CYP98A@3 scaffold00141 72% to CYP98A33v1 Nicotiana tabacum

1662146 MAFSLVLSLSILIIFLCYKLYHRHTAKLPPGPWPWPVVGNLFSLTPIRFRCFAEWAQIYG 1661967

1661966 PIFSFYLGSQLNVVVSNAELAKQVLKDNDQNLANRFRTKPLENVSKNGKDLIWADYGPHY 1661787

1661786 VKVRKVCNLELFTPKRLEALRPIREDEVNAMIESIFKDCTKP (1) 1661661

1660878 GNVNKSTMLRGYLGSVAFNNITRLTFGKRFINSQGEVDEQGKEMKSIVTNGIKISGKPNLGEF 1660711

1660710 VPWLRWVFKDDNEALEAQDKHLDEFTRIIMKEHTIAREKSGETKHHFVDALLTLQK 1660543

1660542 EYDLSDDSIISLFW (0)

        DMIAAGMDTVAITVEWAMA 1660363

1660362 ELVRNPRVQQKVQEELDKVIGSNRIINETDISNLSYLQHVVKESLRMHPPTPLMLPHMAS 1660183

1660182 NNVKVGGYNIPKGSIVHVNVWALGRDPNTWKEPLQFRPERFVEEDVDMKGHDYKLLPF 1660009

1660008 GAGRRICPGMNLAINLVTSMLAHLLHHFVWSLPNG 1659904

1659903 VKVEDIDMMESPGTVTYMQTPLHVVPTPRLPRNLYNTCSMNM* 1659775

 

>CYP98A51 CYP98A@4 scaffold00141 92% to CYP98A33v1 Nicotiana tabacum

1670589 MALFLIILTSIALIFLAHKLYHRLRFKLPPGPRPLPVVGNLYDIKPVRFRCFADWAQTYG 1670410

1670409 PIFSVYFGSQLNVVVTTAELAKQVLKENDQNLADRFRTRPANNLSRNGMDLIWADYGPHY 1670230

1670229 VKVRKLCNLELFTPKRLESLRPIREDEVTAMVESIFNDCTKP (1) 1670104

        DNRGKSLLMREYLGSVAFNNITRLTFGKRFMNAAGEIDEQGQEFKGIVSNGIKIGGKLPLAEYVPWLRWFFSME

        NEALVKHSERRDRLTRIIMDEHTLARKQTGDTKQHFVDALLTLQKQYDLSDDTVIGLLW (0)

1668676 DMITAGMDTTTITVEWAMAELVRNPRVQQKAQEELDRVIGSDRIMSETDFSRLP 1668515

1668514 YLQCVAKEALRLHPPTPLMLPHKASAGVKIGGYDIPKGAIVHVNVWAVARDPAVWKDPLE 1668335

1668334 FRPERFLEEDVDMKGHDYRLLPFGAGRRVCPGAQLAINLVTSMLGHLLHHFTWSPPPG 1668161

1668160 VSPKDIDLTENPGTVTYMKNPIQAIPTPRLPAHLYKRVPMDM* 1668032

 

>CYP94D34-de1b CYP94D@1P scaffold00141 61% to CYP94D2 exon 1 only, upstream of other CYP94D gene

77% to downstream gene

1698122 MEVFSYPTLIFIALISLFFFYFLKKNPNKSGFKIYPLVGALPEFLLNRHQFLEWTTNVLSNCT 1698310

1698311 TNTAVFYRPGNIHGVMTANPLNVEHMLKANFENFPKGFRFYTRLEDFLGD 1698460

1698461 GIFNVDGEIWKIQRKSASYEFSTRSLRNFVMQTAQ (0) 1698565

 

SL2.30ch10 59441628-59442071 (+) strand

 

>CYP94D34 CYP94D@2 scaffold00141 59% to CYP94D2

1698736 MEFFSLIFTVLVSLFFFYYFNKNLQKKGFKIYPLVGALPGFLHNRHRFHDWMTDVLSNCPTN 1698921

1698922 TAVFHRPVNVHGIMTANPLNVEHMLKTNFENFPKGFRFYTRLQDLFGDGL 1699071

1699072 FNVDGESWRTQRKSASYEFSTRSLRNFVMETAQ (0)

        VEIHTRLIPILEEASQRGRIIDIQDILERFAFDNIIK 1699431

1699432 LAFNVDANCLGGAESEFMQAFDIATTLSSGRFMYAIPFLYKIKKILNIGSEKKLQESI 1699605

1699606 KVVHEFADNIINSRMEERDEKKDEDLLSRFMGDSNEVSAKFLRDIVISFILAGRDT 1699773

1699774 TSSALTWFFWILSSRKDIEQKILEELVEVRGRNGKKIGEAYNFDELREMQYLHAA 1699938

1699939 ISESMRLYPPVPIDTRSCLKDEILPDGTFIGKDWFISYQTYSMGRMENLWGKDCCEYKPE 1700118

1700119 RWFDENGVYKQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVLEMFEFDVQLENG 1700289

1700290 KCPEYVLSLTLRMKGGLPVEVKERC* 1700367

 

SL2.30ch10 59442242- 59443873 (+) strand

 

>CYP78A79 CYP78A@3 scaffold03785 71% to CYP78A42 Vitis

335528 MSFTSIYEDFTWWMFTLPPILETQNFFTLLIPTFIVFMVITIFTWAFTPGGPAWKNGLNSMGRVSI

335330 PGPKGLPFFGSLFSLSHGLAHRTLAFTASAYGATQVMAFSLGSTRAIVSSDPTIAREILT 335151

335150 SPHFANRPVKESAKQLMFSRAIGFAPNGTYWRLLRKIASSHLFAPKQILAHESE 334989

334988 RQVECNSMLVSIAKEQNMHGLVTLRKHLQFASLNNIMGIVFGKKYEMFEDNKEAKELQ 334815

334814 EIVNEGFELLGAFNWSDHLSWLNYFYDPYTLKERCAVLVPRVESFVKKIIQDHKNGNS 334641

334640 KKILEPHCDFVDVLLALNGEEKLHEDDMVAILW (0) 334542

334416 EMIFRGTDTTTLLTEWVMAELVLNQDIQEKIHNELKTIVGKNENARDAHISKL 334258

334257 PYLQAVIKETLRLHPPGPLLSWARLSTSDVHLSNGMIIPSNTTAMINMWSITHDPNVWDN 334078

334077 PSTFKPERFLKYSGGMDFDVRGNDLRLAPFGAGRRVCPGKNLGLVTVSLWVAKLVQQF 333904

       MWVESETHPIDLSEVLKLSCEMKYPLSAKAVPRILD* 333793

 

>CYP71D206 CYP71D@24 scaffold02597 55% to CYP7D55 61% to CYP71D47v2

1002304 MDMNLVSFI

1002277 LLFSFLFIIFRKLRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVMYL 1002098

1002097 ELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRK 1001918

1001917 ICIMELLSAKMVKSFSSIRKDELSSVLSSIDSVRGCCEVNMTEIIVRFTSSVTCR 1001753

1001752 LVFGKLCRDRDELINLMKDALFLVGGFDIGDFFPSWKLLYKMSGAKSKLVKMHQKVDSV

        LERIVNEHIKNREAGIKGNGAHGGEDLVDVFLRIKENDQLQFPITNDHIKAVIL (0)

1000668 DMFTAGTETSSTAIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLK 1000498

1000497 LVIKETLRLHAPSIVHRECREETTVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIP 1000324

1000323 ERFENSPIDYLGNNYEFLPFGAGKRICPGMQFGIANVKQPLARLLYHFNWGLPYGTNN 1000150

1000149 PKHLDMSEKSGLSAAKEKDLYLIAKTNQSLDAML* 1000045

 

SL2.30ch06 37926659-37928918 (-) strand

 

>CYP71D205 CYP71D@25 scaffold02597 60% to CYP71D47v2 Nicotiana tabacum

= M01000022799 LA3475 type 6

1020536 MEVIYSSSYNLVALLLIFFPFLFTQ

1020461 LLRKSSTAKEKLPPGPWRLPIIGSLHHLRGALSFPHRTLKNLATKYGPIMYLQLGEIPAV 1020282

1020281 IVSSPIMVKEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLG 1020102

1020101 TKTVKSFSSIRKDEITRLLSSIRSTNGTRLVNLTELILRYTNSVTCRSAFGKVC

        TNQHHLINLLRDVLDTLGGFDVSDLFPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEH

        IKNRALGCKGNGDKLIGGEDLVDVLLRIKENGELQFPITSDHIKAIIS (0)

1017766 DMFAAGTETSAATIIWALSEMMRKPKIMAKAQNEVRQVFKGKITFYEDDLDKLTYLKLVIKET 1017578

1017577 LRLHPPSTLLPRECRKQTYINGYTIPPKTRVLINTWALGRDSESWDDPESFIPERFE 1017407

1017406 NSPVDYMGNYYKFIPFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDMI 1017227

1017226 EKNGLSAAKHRDLCLLIAIEHKNDDKI* 1017143

 

>CYP76Y8 CYP76Y@1 scaffold02597 55% to CYP76Y3,

1032638 MELPILVIIFISFILFIIKPY

1032681 INSKPNKLPPGPTGLPIIGSLLKLGTKPNQSLAELAKKHGPLMTLQLGSLTTIVVSSAK 1032857

1032858 VAKEILHKHDETFSARIVPVAVAAQPNPEATLAWVNGDHMWKKKRRFLSTQMFNNQRLD 1033034

1033035 LLQELRHQKAEQLVSHIRSQCESGSAVDIGRVAFATTLNLISNTIFSIDMVDTEFKTAHE 1033214

1033215 FKELVWTVMEDAGVPNLSDFFPVLKWLDLQGVRKRIKPAYLRLHEIFEENIEKRIE

        ARAIGMKKKGDFLDILLDQCEDDGSGFGTNIKPLMV (0)

1034477 DLFIAGSDTSAITTEWAMAELLRKPEELNKVRQEIMEQIGLERAVKESDMDKLPYLQA 1034650

1034651 VVKETMRLHPAVPLLLPHKAQNDIQVLGFNVPKYSQVFVNAWAIGRDPKSWERALEFLPQ 1034830

1034831 RFIESNVDYKGRDFEFIPFGAGRRICPGIPLAIRMVNLMLASVIQPFKWKLPDGMAPE 1035004

1035005 ELNMEEQFGVSLRKAVPLVAVPSMEEK* 1035088

 

>CYP76Y7P CYP76Y@2P scaffold02597 56% to CYP76Y3 (deletion of EXXR region), pseudogene

modified 2/10/2011

1039425 MEFSILVFCISIFLITWHFIKLLTLNFTKSTNKLPPGPTGFPIIGSHLQLGSKPNQSLAE 1039246

1039245 LTKIHGPLMTLKLGSITTVIASSAETAKEILQKHDKTLSARTAPDAVTSQPNPEATLAWV 1039066

1039065 ESDNMWRNKRRILNTQMFTNQKLDSLQPLRHQKGEQLVCHIRKLCENDSAVDIGRVAFAT 1038886

1038885 MLNLVSRSIDLVDPESDMAQEFKDLVWTINEYAGKPNLSDYFPVLKWLDLQGVRRRIRPA & 1038706

1038706 VHQIFDQLIEKRVEDRASSPKMKVAGDFLDVLLDQCQDKESGFDRETIKPIIV 1038548

        DLFVAGSDTSAITTEWAMAELLRKPEELNKVGQEIMEQI

1038029 LLLPHKAQHDVQVLGFTVPKDSQVLVNVWTIGRDPKYWEQPLEFLPERFMESSVDYKE 1037856

1037855 RDFEYIPFGAGRRICPGMPLAIRMVNLMLASIIQPFYWKLPDGMTPEKLDMEEQFG 1037688

1037687 VTLKKAIPLVAIPCMKENMVRF* 1037637

 

SL2.30ch06 37966706-37968512 (-) strand

Added C-term

 

>CYP76Y6 CYP76Y@3 scaffold02597 57% to CYP76Y3

1043123 MELPILIFFISLIFFLFLIKPYFYTKKLPPGPTGFPIIGSLLQLGSRPNQSLAKLANIHG 1042944

1042943 PLMTLKLGSITTVIASSPETAKEILQKHDKIFSARTVPNAVASQPNWEATLAWVPPDNMW 1042764

1042763 RNKRRICNKQMFTNQKLDSLQELRRQKAEQLVSHIRSQCESGSAVDIGRVAFATTLNLIS 1042584

1042583 NTIFSIDMVDTEFKTAHEFKELVWTIMEESGVPNTSDYFPLLKWLDLQGIRRRIRPAYLR 1042404

1042403 LHEIFEENIEKRLDDRATGQTMKKDGDFLDVLLDQCEVENSGFDRKTIKPLIL (0)  1042245

1042158 DLFIAGSDTSASTTEWAMAELLRNPEELNKVRQEIIQQIGIERAVKESDMDKLPYLQ 1041988

1041987 AVVKETMRLHPAVPLLLPHKAQHDIQVLGFNVPKDGQVFVNVWSMGRDPKYWEKPLEFMP 1041808

1041807 ERFMESSVDYKGRDFEFIPFGAGRRICPGMPLAIRMVNLMLASIIQPFNWKLPKGMTT 1041634

1041633 ENLDMEEQFGVTLRKAIPLVAVPNFENK* 1041547

 

>CYP76Y5 CYP76Y@4 scaffold02597 = M01000005937 LA3475 type 6, 56% to CYP76Y3

= M01000000250

1045876 MELVILLFSISLIFFIILNITKSTTKLPPGPTGFPIIGSLLQLGSKPNQSLAELAKIHGPL 1045694

1045693 MTLKLGSITTVIASSPETAKEILQKHDKTFSGRTIPDAVSSQPNREATLAWVPPDNIWRN 1045514

1045513 KRRICNTQMFTNQKLDSLQELRHQKVERLVNHIRSRCESGSAVDIGRVVFATTLNLISNT 1045334

1045333 IFSIDTVDPEFKTAHEFKELVGTIMKDAGVPNLSDFFPVLKWFDLQGVRRRIR 1045175

1045174 PAYLRLHEIFEENIEKRVKGMTMKRDGDFLDVLLDHCKDENDRKTIKPIIL

1044960 DLFIAGSDTSAITIEWAMAELLRKPEELNKVGQEIMEQIGLERAVKESDMDKLPYLQAV 1044778

1044777 VKETMRLHPATPLLLPHKAQHDVQVLGFTVPKDSQVLVNAWAIGRDPKSWERPLEFLPGR 1044598

1044597 FMESSVDYKGRDFEFIPFGAGRRICPGMPLAIRMVNLILASIIQPFNWKLPDGMTPEK 1044424

1044423 LDMEEQFGVTLKKAIPLIAIPSITTSNH* 1044337

 

>CYP704B30 CYP704B@1 scaffold02618 tomato

2928407-2933351 (-) strand

98% t0 CYP704B.1 potato

2933351   MNTQFSLLNTCHNFQYYFLILKHNKMGLLTLLACLVLSWKFINTYRQK &

2933208   NKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLA  2933110

2933109   QSPTVVVPAMTTTYTYIAHPTNVEHVLKTNFDNYPK (0) 2933002

2932442   GEVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFASKNLRDFNTVVFRDYSLKLFNIL  2932266

2932265   NQASLKNEHVDMQ (0) 2932227

2931365   DLLMRMTLDSICKVGFGVEIGTLNPNLPENSFAKAFDAANVIVTLRFIDPLWKIKQ  2931198

2931197   FLNIGSEAILDQSIKKIDDFTYSVIRKRKAELETNDK (0) 2931087

2930796   INKHDILSRFIELGKDPENNITDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEHVAE  2930620

2930619   KLYAELKSLEQVRAKEENVTLHQYDTEDHVSADSRAIQFAGLLNYDSLSKLYYLHAVIT  2930443

2930442   ETLRLYPAVPQ (0) 2930410

2929561   DPKGILEDDVLPDGTKLKAGGMVTYVPYSMGRMEYNWGSDAASFNPERWLKDGVFQN  2929391

2929390   ASPFKFTAFQ (0) 2929364

2928586   GGPRICLGKDSAYLQMKMALAILCRFYKFKLVPGHLVKYRMMTILSMEHGLKLTVSLRS*  2928407

 

F SL2.30ch01

6355289-6360236 (-) strand no frameshift

 

>CYP704A69 CYP704A@20 scaffold05858 72% to CYP704A21v2 Vitis

1412942 MEQLLLDPMKYKNCKPN (too long compared to potato)

MHKGHNIVS

MEILDCSIMSITATVVSFL

1412807 FCGFIVHLLTRKLHDKRRYHPIGGTIFNQLINFHRLHHFMTDLAGKYKT 1412661

YRLISPFRNEIYTSDPANVEYILKTNFDNYGK (0)

GWHSYSILKDLLGDGIFAVDGDKWREQRKLSSHEFSTRVLRDFSSVVFR

KNAAKFAHILSELVKSNKIVDIQ (0)

DLFMKATLDSVFKVAFGVELDSMCGSNEQGKNFNAAFDNASAMTLWRYVDVFWKIKRYLK

IGSEAKLKENIKIVDAFVCKLIRRKTEQMSAPEADLS (0)

WKKEDILSRFLQISGTNPKYLRDIILNFV

IAGKDTTATTLSWFIYVLCKYPHVQEKVAQEIKESTTEKENATDITDFAANVSEDALEKM

QYLHAALTETLRLYPAVPV (0)

DPKICFSDDTLPDGFSVKKGDMVSYLPYAMGRMKFIWGDDAEEYKPERWLDGDGFFRQENPFKFTAFQ (0)

AGPRICLGKEFAYRQMKIFSAVLLHHFVFKLSDDNKATNYRTMITLHIDGGLHVRVFSRQRN* 1410476

 

SL2.30ch01 77421032-77423456 (-) strand

added 9 aa to N-term

 

>CYP71D-se2[1] CYP71D@40P scaffold05858

1414154-1414246 (+) strand

51% to CYP71D.56v2 N-term

1414154 FKFMIIFLKNLLYASFIYFILVSFKKKRNIN  1414246

 

77424719 FKFMIIFLKNLLYASFIYFILVSFKKKRNIN 77424811

 

SL2.30ch01 77424719-77424811 (+) strand

 

>CYP704A68P CYP704A@21P scaffold05858 78% to CYP704A20

1419854 DIKICFLDDTLPDEFSVKKGDIV 1419786

 

77430420 DIKICFLDDTLPDEFSVKKGDIV 77430352

 

SL2.30ch01 77430352-77430420 (-) strand

 

>CYP704A66 CYP704A@22 scaffold05858 70% to CYP704A21v2 Vitis

77443919 MHNDILVVS

1433324 MDTLKSSITISSIILSLVFCVFLVHLLTRKLHGKKRYHPIGGTIFNQ 1433184

1433183 LINFQRLHHYMTDLAAKYKTYRLISPFRNKIYTSDPANVEYILKTNIDNYGK (0) 1433028

GWYNYSILKDLLGNGIFAVDGDKWREQRKLLSHEFSTRVSRDFSSVVFRKNVAKLAQILSESANSNKAVDIQ (0)

DLFMQSSLDSIIGVAFGAELDNTCGSNEEDKRFIDAFDNANATTTWRYTDIFW

1432032 KIKRALNIGVEGKLRDNIRTVDAFVYKLIHIRTEQMSKPENHVLS (0) 1431898

WKKEDILSRLLQITDTDPKYLRDIILSILLSGKDTTSTTLSWFIYVLCKYPHVQEKVV

QEIKEATTEKTNATDITEFAANVSEEALVKMQYLHAALTETLRLYPAVPL

DPKICFSDDTLPDGFSVNKGDVVCYLPYAMGRMKFIWGDDAEEYKPERWLDRDGFFRPENPFKFTAFQ

1431084 AGPRICLGKEFAYRQMKIFSAVLLSYFVFKLSDDKKAINYRTMINLHIDGGLHVRVFRR* 1430905

 

SL2.30ch01 77441473-77443919 (-) strand

Note: added 9 aa at N-term. This may affect other CYP704A sequences that may be

Short at the N-term.

 

>CYP704A67P CYP704A@23P scaffold05858 71% to CYP704A21v1 Vitis

1430566 HRLHHYMTDLAGKYKTYRFVSPLRKKIDT & 1430480

1430472 SDPVDVEYILKTN 1430434

 

SL2.30ch01 77441002-77441134 (-) strand

Downstream from 704A@22 a –de pseudogene

 

>CYP704A65 CYP704A@24 scaffold05858 71% to CYP704A21v2 Vitis

77451133 MAVVS

1440552 MDILHSSIISLTSIILSLLFCGFIFHLLTKKVYGKKRYHPIGGTIFNQLI 1440403

1440402 NFHRLHHYMTDLACKYKTYRLISPFRNEIYTSDPANVEYILKTNFDNYGK (0) 1440253

GWYNYSILKDLFGDGIFTVDGDKWQGQRKLSSHEFSTRVLRDFSSVVFRKNVAKLAHVLSNAANSNTTVDIQ (0)

DLFMKSTQDSIFRVACGVDLDSICGSNEESKKFGDAFDNANAMTTWRYVDVFW

KIKRALNIGVEAKLRDNIRTVDVFVYKLIQRKTEQMTKPDADLS (0)

WKKEDILSRFLQISGTNPKYLRDIILNFVIAGKDTTATTLSWFIYVLCKYPHVQEKVA

QEIKESTTEKENATDITDFAANVSEDALEKMQYLHAALTETLRLYPSIPT

DPKLCFSDDTFPDGFSVNKGDMVSYLPYAMGRMKFIWGDDAEEYKPERWLDRHGFFRHESPFKFTAFQ

1438339 AGPRICLGKQFAYRQMKIFSAVLLHYFVFKLSDDKNTVNYRTMISLQIAGGLHVDVFHR* 1438160

 

SL2.30ch01 77448726-77451133 (-) strand

Added 5 aa at N-term

 

>CYP704A64 CYP704A@25 scaffold05858 64% to CYP704A19 Vitis

1443644 MDFLYTIFTCIGTLCVISVTSFLVLILRIYAGKSIRNPKSAPVIGTVFHQLFYFKRLYDYQTEV 1443453

1443452 AKKLPTSRFLAPDESIICTTDSRNVEHILKTKFGKYSKGKRNEEIIMDLFGKGIFAVDGE 1443273

1443272 KWKQQRKLASLEFSARVLRDFSCTVFRKRADKLVRKVFQFYISNQVFDIQ 1443123

ELLMRCSLDSIFKVGFGVDLNCLDGSGEDDDSFIKAFDDSNELIYWRYVDPFWKLKRYFNIGSEALLKKN

IKFIHEFVDELIRSRRKQLEVKHDS

IDKEDILSRFLEESKKDPEKMTDQYLRDIILNFMLAGKDSTANTLSWFFYMLCKNP

LIQEKVVEEITEVIGNNVKDKEHLEYFVASITEEALEKMHYLHAALTETLRLYPAVPV (0)

DGRCADADDILPDGFHIRKGDEVNYVSYAMGRMPYIWGNDAEDFRPERWLKDGIFQPESPFKFIAFH (0)

1441467 AGPRICLGKDFAYKQMKILAMALLHFFRFKLSDETKVVTYRTMFTLHINEGLPVHAVPRRGLVGG* 1441270

 

SL2.30ch01 77451836-77454210 (-) strand

 

>CYP704A63 CYP704A@26 scaffold05858 66% to CYP704A19 Vitis

1447207 MDVLYTIFISIAILLLICVTPTLVLTVRIYAGKSIRNPKYAPVEGNVFHQLL 1447052

1447051 YFNIIYDYQTELAKKTPTFRLLAPEQSEIYTTDSRNIEHILKTNFSKYSKGKRNQEVIMD 1446872

1446871 LFGEGIFAVDGEKWKQQRKLASFEFSARVLRDFSCKVFRKGAAKLVSKVSEFSLANQVFDMQ 1446686

1446602 ELLMRCSLESIFKVGFGVDLNCLDGSSGDDNEFIKAFDDSNALSYWRYVDPFWKLKRYFN 1446423

1446422 IGSEFLLKKNIKFIQEFVDELIRTRRKQLEMKQDS (0)

        MDKEDILSRFLVESKKDPEKMTDRYLRDIILNFMLAGKDSTANTLSW 1446063

1446062 FFYVLCKNPLIQIKIVEEIREVIGNNMKDNGSVDDFVASITEEVLEKMHYLHATLTETL 1445886

1445885 RLYPAVPV (0) 1445862

DGRCADADDVLPDGFHVKKGDGVYYMSYAMGRMPYVWGNDAQDFRPERWLKDGIFQPESPFKFITFH (0)

1445038 AGPRLCLGKDFAYRQMKILSMALLHFFRFKSSDDTKEVTYRTMFTLHIKEGLQVRAVPRRGLIEA* 1444841

 

>CYP86A68 CYP86A@2 scaffold05858 78% to CYP86A8 Arab.

1926828 MDIAIALLLLFSFITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHEWIVDNLRACGGTYQT 1926682

1926681 CICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIFNSDGDT 1926502

1926501 WLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKTAQVEGKPVDLQDLLLRLTFDN 1926322

1926321 ICGLAFGKDPQTLAPGLPDNTFASAFDRATEASLQRFILPEVVWKLKKWLGLGMEVSLNR 1926142

1926141 SLVQLDKYMSDIINTRKLELMSQQKDGNPHDDLLSRFMKKKESYTDKFLQHVALNF 1925974

1925973 ILAGRDTSSVALSWFFWLVIQNPVVEQKILQEISTVLVETRGSDTSSWLEEPLAFEEVDR 1925794

1925793 LTYLKAALSETLRLYPSVPEDSKHVVVDDVLPDGTFVPAGSSITYSIYSAGRMKSTWGED 1925614

1925613 CLEFKPERWLTLDGKKFVMHEQYKFVAFNAGPRICLGKDLAYLQMKSVAAAVLLRHRLT 1925437

1925436 VAPGHKVEQKMSLTLFMKDGLKVNLRPRELTPFVNSVKEVQLIQI* 1925395

 

>CYP78A74 CYP78A@5 scaffold05858 72% to CYP78A40 Vitis

MRTDIESLWIFALASKCKSFTSIYFILFIVLFWLL

3120314 MNIIYWSHPGGPAWGKYNWSKKFRLASFNINNNNNDNYNISGPRGFPIIGSMNLMSGLAH 3120135

3120134 RKIAEMAQSCVAKRLMSFSLSETRVIITCNPDVAKEILNSSVFADRPVKESAYSLMFNRA 3119955

3119954 IGFAPYGVYWRTLRKIAATHLFCPKQIKASEAQRFQIARQMVTMFQLGGQDVVRVRDALK 3119775

3119774 LASLNNMMCSVFGRKYSLDCCNAETEELGKLVEEGYELLGMLNWSDHLPWLAEFDPQKIR 3119595

3119594 LRCSRLVPRVNKFVSRIINEHKAQSGDVHHDFVHVLLCLQGSERLSDSDMIAVLW (0) 3119430

3118863 EMIFRGTDTVAVL

3118824 IEWILARMIIHPQVQSKVQAELDSVVGKSRALMESDVSEMTYLPAVIKEVLRLHPPGPLL 3118645

3118644 SWARLAITDTTVDGYHVPAGTTAMVNMWAITRDPDVWADPLEFKPERFFNGPDFSVLGS 3118468

3118467 DLRLAPFGSGRRTCPGKTLGLTTVTFWVATLLHEFRFEPIDNNGPVDLSEVLRLSCEMV 3118291

3118290 NPLTVRVRPRHALHQTQ* 3118237

 

>CYP98A56 CYP98A@6 scaffold05858 84% to CYP98A43 Vitis

3455785 MAIPIPLPVAIPLAFIFTYVLYHLYYRL

3455869 RFKLPPGPTPWPVVGNLYQIKPVRFRCFYEWAETYGPVISVWFGSTLNVVVSSSELAKE 3456045

3456046 VLKEKDQQLADRHRSRSAAKFSRDGQDLIWADYGPHYVKVRKVCTIELFTAKRLESLRPI 3456225

3456226 REDEVTAMVESIYRDCSSP (1)

GKSLLVKKYLGAVAFNNITRLAFGKRFENFEGVIDE

QGNEFKAIVANGLKLGASLAMAEHIPWLRWMFPLDEDAFSKHGERRDRLTRAIMEEHTLA

RQKSGGAAKQHFFDALLTLQQKYDLSEDTLIGLLW (0)

3457923 DMITAGMDTTAISVEWAMAEVIKNPRVQQKAQEELDQVIGYERVMNETDFPNLPYLQC 3458096

3458097 VAKEALRLHPPTPLMLPHRANANVKIGGYDIPKGSNVHVNVWAVARDLKVWNNPLEFRPE 3458276

3458277 RFLEEDVDMKGHDYRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFRWTPSNGLSPE 3458450

3458451 EIDMGENPGLVTYMRTPLQAVATPRLPAELYKRIAVDM* 3458567

 

>CYP71AX17P CYP71AX@16P scaffold05858 = C01.6_contig20 87 kb, 70% to CYP71AX1, pseudogene

DSFIAGVDS

9584252 IYTTLEWIMIELLRNPRAMEKL*TEVRGLAQGKVEIT*DDLGNLQYFKAVIEESVRLNPPFPI 9584067

9584066 PVPRESMEDVKLLDYDIPAKTQVLINVWAIGRDPLSWDEPEVYRPKRFLNSDIDFRGL 9583893

9583892 NFELIPFEAGRRGCSGIPFAIVIIELA*ARLVNEFNFALPQGMKK & 9583758

        EDLDMS &

9583738 KCTGISIRRKLPLLAVATPCGI* 9583670

 

SL2.30ch01 85584324-85584937 (-) strand

 

>CYP736A64 CYP736A@4 scaffold02292 54% to CYP736A26 Vitis

2031 MTSIWLVS

2055 LALVAKIFLVKEFIKRKKLPPGPIRLPLIGNLHMFGENLHQDLYKIAKKYGPIMTIYFG 2231

2232 LVPTIIASSPHAAQLFLKNHDQIFASRPHHAACYYIFYKQRNLIMGKYGPYWRHMRKLCT 2411

2412 LQLLNNVKINSFQSMRKQEVQILVNFLEKAASHRDVVDLSAKLTSLSANMACLMVIGKK 2588

2589 YNNVDGDFKDMVQEMSRMAATPNLADLFPFLR & 2684

     FIDFQGLILRMKQIAKSCDEFLENVIDEHTGQYLSDQSKTSI

     DMVDTLMEIMQSGETEFEFDRRHVKAILL (0)

3120 DLLVASMDTSSTSIEWILSELFKHPNVMKKLQSELDNVVGQKGIVEEKDLENL 3278

3279 DYLNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQIPKGSRVLVNVWAIGRDPDVWHEPE 3458

3459 KFIPERFVESTIDVRGQNFQLLPFGSSRRSCPGLQLGLTIVRLVVAQLVHSFDWELPN 3632

3633 GTMPNDINMTEKFGLVTARALSLMAIPIYRLHNK* 3740

 

SL2.30ch04 46884188-46885894 (+) strand

frameshift still present possible pseudogene

 

 

>CYP736A69 CYP736A@25 scaffold04168 53% to CYP736A26 Vitis = M01000016266

23708 MTSIWLVALASVAIIFLVKEFI

23774 KRRKLPPGPIRLPLIGNLHMFGENLHQDLYKIAKKHGPIMTIYFGLIPTIVASSPYAAQ 23950

23951 QFLKDHDQIFASRPYHAACYYIFYKQRNLIMGKYGPYWRHMRKLCTLQLLNNVKINSFQS 24130

24131 MRKQEVQILVNFLIKAASNRDVVDLSAKLASLSANMACLMVIGKKYNNVDGDFKD 24295

24296 MIQQTSHMAATPNLAELFPFLRFIDFQGSVLRMKQIAESCDEFLENVIDEHT 24451

24452 RQYSSDQSKTSIDMVDTLMEIMQSGEAEFEFDRRHVKAILL (0)

25707 DLLVASMDTSSTSIEWILSELLKHPNVMKKLQSELDNVFDQKGIVEEKDLKNLDY 25871

25872 LNMVIKEGFRLHPVAPLLLPHESIEDCTLDGFQMPKGSRVLVNVWAIGRDPDVWREPEKF 26051

26052 IPERFVESTIDVRGQNFQLLPFGSGRRSCPGLQLGLTIVHLVVAQLVHSFDWELPNGM 26225

26226 MPNDINMTEKFGLVTARALPLMAIPIYRLHNK* 26324

 

>CYP736A70P CYP736A@26P scaffold04168

58254-58707 (+) strand

75% to CYP736A.20

58254   KKLPPGPRGLPLMGNLH  58304

58330   IHFGLVTVVIVASSPHAAQQFLKTHDFNICWQTIFYNRRNLVSSNYGSYWRNM  58488

58489   RKLCTLHLLSNAKIQSLSANMLCLMIFGKK  58578

        LFDEFLER  58632

58633   VIDGHVSDKFNHEQKDMVDTLMEIM  58707

QSGEGEFEFDGRHAKAILL (0) 51145553

 

SL2.30ch04 51145553-51146064 (-) strand

 

>CYP736A71P CYP736A@11P scaffold04168 62% to CYP736A26 Vitis, pseudogene, first exon not found

74652 DLLVASMDTSATTIDWILSKLLRHPNVMKKLQNELEQVVGKNRMVEESDLENLEYLDML 74828

74825 VIKESSRLHPVAPLLIPHGSIEDCEVDGFHIPKGSRILFNVWTIGRDSDIWIE 74983

74984 PEKLKPERFQGNNIDLRGRHFELLPFDSVRRSCP &75085

75085 GFTVRLVLAQLVHFFDWELPNGMTPKDIDMTEKFGFVTTRVQHLILIPKYRLHI* 75249

 

SL2.30ch04 51128256-51128853 (-) strand

 

>CYP96A53P CYP96A@4P scaffold04168 50% to CYP96A10 pseudogene with two frameshifts

999887 MGSIGYFEFFVAIFSFFVFLALGDRSGLPWNWPFLGMLPNLLFNVYRIHERCYEIFSRTSGGSF 999696

999695 LLEGPWFTNMDILGTVDPENVHYIMSANFANFPKGEEFKKIFDVLGDGIFNS 999540

999539 GLDLWKGQRKYARSLITHQRFYNCLVKSSWDKIENALVPVLENVVRDDRVVDLQDVFQRF 999360

999359 TCDTTCTLVTGYDPGCLSVEFPRVPFSRAMDEVEEVFVH & 999243

999241 RHLLLKSVWKLQKWLGIGYEGKLTRSWDVLDQVISKYISMKRDKLSNVATKTKEDEEEGC 999062

999061 DDLLTSYILNDHGLNFDDKFLRDTILNLMIAGRDTTSSGLTWFIWLAATHPEVENKIM 998888

998887 EELEAIISLTSSSSSSKWRLA & 998825

998823 FNENELKNAIYLHASLCESLRLYPPVPFQHKTPLEPDTLPSGHHVHPKMRVVFSLYAMGR 998644

998643 IESIWGKDCLEFKPERWISEKGLIKHEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAA 998473

998472 SIIHNYQVEVINGHKVCPNVSIILYMQHGFKARVKKRWT* 998353

 

>CYP96A52 CYP96A@5 scaffold04168 54% to CYP96A10 Arab. 59% to CYP96A17 Populus

1028745 MSIVGLGYIEIFVAILCFFLFHSLNHPKGYPKSWPIVGMLPSMLFHLKHIHDRLTVIMSVTGGT 1028584

1028583 FVPKGPLFAEMDILATVDPSNVHYIMSQNFMNFPKGKKFKELFDVLGDGIFN 1028428

1028427 ADMDLWKIQRKTTRSLVTHQQFYKFLIKTSRDKVEKGLVNVLDHVCNKGVIVDLQDLFQR 1028248

1028247 FTFDTTCILVTGYDPGCVSIDFPHVPFSKALDDAEEAILFRHVIPEPIWKLQRWLGIGEE 1028068

1028067 KKLSKAWETMDDVIGNYISKKRDELTKIETHDDEVEENDEGFDLLTFYLKEGQGLGVNCD 1027888

1027887 DKFLRDTILNLMIAGRDTTSSALTWFIWLVTKNPQVEKKLREEINSIIPKEEVGK 1027723

1027722 FRVFNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPLKEDTLPSGHKVHPKTMILFSLY 1027546

1027545 AMARTESIWGKDCLEFKPERWISETGTIKHEPSYKFMAFNAGPRTCLGKEVAFTQMK 1027375

1027374 AVAATIIHNYKVEVVEGQTIEPNTSIILYMRYGFKVRISRRWT* 1027243

 

>CYP92B12P CYP92B@10P scaffold04168 59% to 92A34 Vitis 79% to CYP92B3 tobacco DQ350359.1

N-term start codon not detected (BOGAS has a predicted N-term exon)

MIYNSQVLFLKIGKSKPKLLLSLYLYIPIY

TENYFWVVLAITCLVTLLVLLKLFHHH

1865862 KQNLPPGPKPWPIIGNLHLLGSVPHKSLHKLAITYGDLMLLKFGSRNVVIASSPEMTREFLK 1866047

1866044 KTNDANWASRPQLAAGKYTAYNYHDMTWAPYGPFWKQARRIYFNHIFNSKRLDSFEYIRVE () 1866226

ELIARLFDLSMLGKPILLRQH

LTRYTLTSISRTVLGGKYFSESNGGNNNEKSIISLEKLQDMLDKWFLLNGVINIGDWIPW

LGFLDLQGYVKEMKELHKNLDKFNNFVLDDHKAKRDQGDKNFVARDMVDVLLQQVEDP

NLHLKLNTDSVKGLMQ (0)

1868324 DLLAGGTDTSATTIEWAFHELIKQLNMIKKAQKELDRVIGDGRWVQERDFTQLTYIE 1868494

1868495 SIIKETLRLHPVSTMLPPRTSLEDSHIAGYDIPKGTILMVNTWSIGRNSRHWESPEEFIP 1868674

1868675 ERFEGKDIDVTGQHFALLPFGAGRRKCPGYSLGIRIIRYTLANLLHGFNWQLPHDINS 1868848

1868849 QDISMDKIYGLTTHPKLALHLIMVPRLPRHLYK* 1868950

 

SL2.30ch04 49336436-49339608 (-) strand (2 frameshifts no start codon)

49339608 KTENYFWVVLAITCLVTLLVLLKLFHHHKQNLPPGPKPWPIIGNLHLLGSVPHKSLHKLA 49339429

49339428 ITYGDLMLLKFGSRNVVIASSPEMTREFL & 49339342

49339342 KTNDANWASRPQLAAGKYTAYNYHDMTWAPYGPFWKQARRIYFNHIFNSKRLDSFEYIRVE & 49339160

49339151 ELIARLFDLSMLGKPILLRQHLTRYTLTSISRTVLGGKYFSESNGGNNNEKSIISLEKLQ 49338972

49338971 DMLDKWFLLNGVINIGDWIPWLGFLDLQGYVKEMKELHKNLDKFNNFVLDDHKAKRDQGD 49338792

49338791 KNFVARDMVDVLLQQVEDPNLHLKLNTDSVKGLMQ (0) 49338687

49337062 DLLAGGTDTSATTIEWAFHELIKQLNMIKKAQKELDRVIGDGRWVQERDFTQLTYIE 49336892

49336891 SIIKETLRLHPVSTMLPPRTSLEDSHIAGYDIPKGTILMVNTWSIGRNSRHWESPEEFIP 49336712

49336711 ERFEGKDIDVTGQHFALLPFGAGRRKCPGYSLGIRIIRYTLANLLHGFNWQLPHDINSQD 49336532

49336531 ISMDKIYGLTTHPKLALHLIMVPRLPRHLYK* 49336436

 

 

 

 

>FG644644 Nicotiana tabacum

MENSWVVLALAGLLTLALLSKFLHTPRR

KQNLPPGPKPWPIAGNIHLLGSTPHRSLHE

LAKRYGDLMLLKFGLRNVLIASSPDMAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWA

RYGPFWRQARRIYLNEIFNPKRLDSFEYIRIEERHNLISRLFALSGKPILLRDHLTRYTL

TSISRTVLSGKYFSESPGQRSMVTLEKLQDMLDKWFLLNGVINIGDWIPWLAFLDLQGYV

KQMKEL

 

>CYP92B3 Nicotiana tabacum

MENSWVVLALTGLLTLVFLSKFLHSPRRKQNLPPGPKPWPIVGN

IHLLGSTPHRSLHELAKRYGDLMLLKFGSRNVLILSSPDMAREFLKTNDAIWASRPEL

AAGKYTAYNYCDMTWARYGPFWRQARRIYLNEIFNPKRLDSFEYIRIEERHNLISRLF

VLSGKPILLRDHLTRYTLTSISRTVLSGKYFSESPGQNSMITLKQLQDMLDKWFLLNG

VINIGDWIPWLAFLDLQGYVKQMKELHRNFDKFHNFVLDDHKANRGEKNFVPRDMVDV

LLQQAEDPNLEVKLTNDCVKGLMQDLLAGGTDTSATTVEWAFYELLRQPKIMKKAQQE

LDLVISQDRWVQEKDYTQLPYIESIIKETLRLHPVSTMLPPRIALEDCHVAGYDIPKG

TILIVNTWSIGRNSQHWESPEEFLPERFEGKNIGVTGQHFALLPFGAGRRKCPGYSLG

IRIIRATLANLLHGFNWRLPNGMSPEDISMEEIYGLITHPKVALDVMMEPRLPNHLYK

 

>CYP736A65P CYP736A@12P scaffold04168 59% to CYP736A25v1 Vitis, pseudogene

87% to CYP736A.20

4320171 EDLGEKGFKSPIQDILCITGMTNFAEFFPFLRVLDLQGFTSRSKE*AKLFDEF 4320013

        DMVDMLMKIIQSGEGEFEFDRRHVKAILM (0) 4319868

4318077 DLLVAFMDTLTTTIDWILSELLRHPNVMENL*NELEQVVGKNRMVEE*DLENLEYLDM 4317904

4317903 VIKESSRLHPVAPLLIPHESIEDCEVDGFHIPKGSRILINVWMIGRDPDIWVEPEKFKPE 4317724

4317723 KFQENNIDLRGRHFELLPFGSGRRSCPDLQLGLTAVHLLLAQLIYCFDWELPNGMTPK 4317550

4317549 DIDMTKKFCLVTTRVQHLMLIPKYRLHI* 4317463

 

SL2.30ch04 46891462-46894170 (+) strand

 

>CYP736A61 CYP736A@13 scaffold04168 58% to CYP736A26 Vitis

4372513 MTLLWAILVVGLSVYALYELLNIH

4372585 KRKRYPPGPTGLPILGHLHLLGKNPHKDLQNLAKKHGPIMYMRLGLVPTIIASSADAAE 4372761

4372762 KVLKTYDHIFASRPHHEASQHLAYGQKNLVFAKYDVYWRNIRKLCTVHLLSNQKIHSFQS 4372941

4372942 MRKQEVELLIESLKQEARDRVVIDLSAKVTSLNANLTCLMVFGKKYMDEDLDKRGFK 4373112

4373113 AIVQDVVHLAGMPNLGDFFPFLGAIDLQGITRKLKDLSKVFDEFLEKIIDEH 4373268

4373269 VYAHEHKQNKDFVDTMMDIMQSGDAKFQFDRHHIKAILF (0)

4373481 DMLIAAMDTTASSTEWILTELLRHPQVMKELQKELQEVVGLDRMVEESDLENLKY 4373645

4373646 LDMVVKEGLRLHPVAPLFYHESIEDCVVDGFHIQKGTRIIINCYAIHMDPNVWPDPEKF 4373822

4373823 LPERFVGSSVDFRGRDFQLVPFGSGRRSCPGMQLAVMVVRLVVAQLVHCFEWELPNGI 4373996

4373997 ESCDLDIDEKFGIVTCREKPLLAIPTYKLNK* 4374092

 

>CYP736A62P CYP736A@14P scaffold04168 56% to CYP736A26 Vitis

4397796 ATKKKEEASQHLSYGQKNLVFAKYGVYWCNMRKWCKVHLLSNQKIHSLQSMRKQQVELLI 4397975

4397976 ESLKNEARDRVVVDLSAKVTSLNANLTCLMVFGKKYMDEDLDKRGFKDLVQDILHLARMP 4398155

4398156 NLGDFPPFLGAIDLQGITRKLKDLSKVFDEFLEKIIDEHVHAHEQKQNKDFVDTMMDIMQ 4398335

4398336 SGDAKFQFDRHHIKAILF (0) 4398389

4398455 DMLIAAVDTTASSTEWILTELLRHPHVTKKLQKELQEVVGLDRMVEESDLENLKY 4398649

4398650 LDMVVKEGLRLHPVAPILHHESMEDCVVDGFHLQRGSRMIVNCYAIYMDPNVWLSLRS & 4398823

4398820 KFLPVGRSIDFRGRDFQLVPFGSGRRSCPRMQLAVTVVRLVVAQLVHCFEWELP & 4398981

4398993 PCNLDVDEQFGIVICREKPLLAIPTYRLKK* 4399085

 

SL2.30ch04 46813088-46814377 (-) strand

 

>CYP736A63P CYP736A@15P scaffold04168 55% to CYP736A26 Vitis, pseudogene

8460738 MAYSMWLALVLVALFTYLVQELIWKKKKKFPPGPRGLPLIGKLHMVGKNIHHDLHKVS

        KKYGPIMSMRFGLVPTIVASSPYAAQQFLKNHDLVFASRTYSKVSQYIFYDQRNIMSSKYGPYWRNML

        KLCTLQLLSNAKIHSFQSMRKQELGILVDFLK*HRGVVVDLTDKISSLSANMSCLMIF

        GKKYMDEDLGLNELVKETMFIAARPNLGDYIPFLGVFDLQGLSRRMKELSKPFDEFL

        ERVINEHLHKVNEQNQAKDIVDKLMGIMNSNEAVFEFNHHHVKAILL

8461874 DLLVASTDTSSTTVEWILSEVLRHPDVMKKHQNDIERVVGRNRMVEDMD*GSLE 8462035

8462036 YLDMVIKEGFRLHLVAPLLIPHESVEDCKVDDFHIHKEF*LLINVWAIGRDPNVW 8462200

8462216 FKLERFLECNIDLRGHDFQLLPFGSGRRSCPVMQLGLTIF* 8462338

        DWELPNGIIPKDVDMTKKFDLVLARAQHLMVIPKSYRLK 8462453

 

This seq not in final pseudogene structure

EKFLPVGRSIDFRGRDFQLVPFGSGRRSCPRMQLAVTVVRLVVAQLVHCFEWELPS

 

 

SL2.30ch04 42734143-42735861 (-) strand

Added 1 aa at C-term

 

>CYP71D189P CYP71D@27P scaffold04007 70% to CYP71D47v1 Nicotiana tabacum, sequence gap upstream

82% to CYP71D.21

N-term part of this pseudogene from ver 1.03

2784196   SA*SIMYHYSDTGTCPYGDYWRKMRNICILELLSTKMVKSFDSIGQAEMLSLISSINSM  2784020

2784019   PDSLINLSDKIFWFAGSVTCRSVFG  2783945

2783943   RDKLMMLIKEITLLTG*FDLTDFFPSQKWLHGISGLKLKILEVHKEVDEILENIINEHCE  2783764

2783763   SRANGKKGNSESGGEDLIDVLLKVTESGELGTPITNNNIKAVLF  2783632

1645139 DMFLAGAETSSAKIIWALAEMIRNPSIMDKAQLEVRQVLKGKTKFDDFDLEEL 1645297

1645298 KYLKLVIKETLRLHPPLPLLHPRECREKTKIGKYTIPIKTRVLLNAWAIRRDPEYWHNPE 1645477

1645478 IFIPDRSDESSIDFRGNHFEFIPFGAGRRMCPGWLFGLMNVEHPLTQLLYHFDWKSP 1645648

1645649 YEGLLENFDMTGTNGLSARRRDDLCLIATPYN* 1645747

 

SL2.30ch03 61513135-61515442 (+) strand

 

>CYP92A50 CYP92A@1 scaffold04007 90% to CYP92A2v2 Nicotiana tabacum

4402083 MEGTTWTATAVFLATLFLLFLSKFL

4402158 RKRKLNLPPGPKPWPIIGNLNLMGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSVEM 4402334

4402335 AKIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSY 4402514

4402515 EYIRAEELHSILHNLNKSSGKPILLKDYLTTLSLNVISRMVLGKSYLDESDNSIVTP 4402685

4402686 DEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVVSKKFDKFLEHVLDEHN 4402856

4402857 MRRNAVENYVAKDMVDVLLQLADDPTLDVKLERHGVKAFTQ (0) 4402946

4403512 DLLAGGTESSAVTVEWAISELLKKPEIFKKATNELDRVIGQNRWVQEKDIPNLPYIEAI 4403688

4403689 AKETMRLHPVAPMLVPRECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPDR 4403868

4403869 FLEKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGF 4404006

4404007 NWSLPDNMTPEELNMEEIFGLSTPKKFPLSAVIQPRLSSKLYSV* 4404141

 

>CYP92A51 CYP92A@2 scaffold04007 89% to CYP92A2v4 Nicotiana tabacum

4406138 MEGSSWTAVFLATLFVLLLSKYLFQRKLNLPPGPKPWPIIGNLNLIGSLPHRSIHDLSVKYGPIMQ 4406335

4406336 LQFGSFPVVVGSSVEMAKVFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQAR 4406515

4406516 RMCLMELFSAKRLDSYEYIRAEELHSILHNLKKTSGKPILLKDYLTTLSLNVISRMV 4406686

4406687 LGKSYLDESKNSIVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVV 4406857

4406858 SKKFDKFLEHVLDEHNVRRNAVENYVAEDMVDVLLQLADDPTLEIKLERHGVKAFTQ (0)

4407303 DMLAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAI 4407479

4407480 AKETMRLHPVAPMLVPRECREDCKVAGYDIPKGTRVLVSVWTIGRDPTLWDEPEAFKPER 4407659

4407660 FLEKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGF 4407797

4407798 NWSLPDNRTPEELNMEEIFGLSTPKKFPLSTVVEPRLPSKLYSI* 4407932

 

>CYP82M3 CYP82M@2 scaffold05992 = AK329659.1, 64% to CYP82M1v4 tobacco, 52% to CYP82S3 Vitis

6222258 MFDNFYFNDLQITLATLLVFSLSIILWTRNWKSTKLPPKIPGSWPIIGHLRGFGDGENVP 6222079

6222078 LARTFGKLSNQYGPIFTIKLGMYRYCVINNWEAAKDCFTINDKELAARPISLAAEHYGYN 6221899

6221898 YARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKNVRISEVEISIKELYNIWGKGENSNT 6221719

6221718 INISKWFEKLTLNIIVKMIAGKRYISLEKDQEAQCFRRAFAKIMYLAGEFILY 6221560

6221559 DAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKIEGDNNNEQDCIDSMLS 6221392

        VTKLEDFKAYGYTRDTVIKAIVL (0)

6220519 SMILDGSDTTAVHLTWLMSLLLNNPRVMNNAQKEIDSKVGKDRWIE 6220402

6220401 ESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFANAWKI 6220234

6220233 QRDPRVYSEPDKFIPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINFA 6220084

6220083 TQVAHLTIGRLIQGFSFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSMLYEL* 6219913

 

>CYP96A43P CYP96A@9P scaffold05992 56% to CYP96A24P Vitis pseudogene

5642587 LIKCKVKRTNPELKQVSSLHLKFFFCLRKKMDVL

        YPCISRKQEELMHTSRAKDEEFIFLNAYIRMYNQWKDGDLGTLQTFLRDTFLSLLFA & 5642859

5642857 ALTWFFWLLAKNPLVEKRIREEIQQQLNLKVDENLNFFSVQETRKLVYLHGA 5643012

5643013 LCETLRLFPSVAIEHKLPHDFDILPSAHHVSPNTRVVLSLYTMGRMESIWGEDRLEFKPE 5643192

5643193 RWIS*RGGIKHEPSFKFSAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIQLGVDQI 5643363

5643364 IAPSASIIIQMKHGLKVRLEKRVPL* 5643441

 

SL2.30ch10 61332118-61332972 (+) strand

Yellow region is Solyc10g080820.1.1

Solyc10g080830.1.1 has parts of CYP96A@10, 96A@11 and 96A@9P

 

>CYP96A44 CYP96A@10 scaffold05992 52% to CYP96A18 Vitis

5644386 MDALELFLPLLIIIMCFTWWYLSNRWWRLSSVPTNWPLVGMLPGLFRNAHRVHE &

ATDVLVETKGTFEFHGPVFANLNMLATSDPANIHHILSKNFSNYPKGVEFRKIFDILGNGIFNVD

YELWEMHRKTTMSLMSHAKFQTFLERNMWDIIENALRPILDTFAEQDTLFDLQDIFQRFT

FDAISKLLLDYDPKSLSIDLPHVSCEKAFNDVVDALMYRHILPEGCWKLQKWLQIGKEKK

LIQAWEAFDQFLYPCISRKQEELMHKSSIEDEEFTFLNGYIKMYNQWKDGDLGTLQTFLR

DTFLNLMFAGRDTTSAALTWFFWLLAKNPLVEKRIREEIQQKLNLKEGENLKFFAIEEAR

KLVYLHGALCETLRFFPSVAIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGK

DCLEFKPERWISERGGIKHEPSFNFPAFNAGPRTCIGKEMASIQMKIVAATIIYNYHIQL

GEDQIISPNASIIIQMKHGLKVRLFKRVPLMSNA* 5645935

 

SL2.30ch10 61333923- 61335466 (+) strand

 

>CYP96A45 CYP96A@11 scaffold05992 52% to CYP96A18 Vitis

5646615 MSACLLFSGLIKCEVERTNPQLKQFPFLSISLKMNVLEYFLPLLVIVMCFTYSTRWYLS

NIWWKSSSAPTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGPVLANLNMLLTS

DPANIHHILSKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTMSLMNHPKFQTM

LERNMWSIIENGLWPILDGFAEQGTLFDLQDIFQRFTFDAITKLLLDHDPKSLSIGLPHV

PCENAFNDSLDAFMYRHFLPESCWKLQKWLRIGKEKKLIQAWEAIDQFIYPCISRKQEEL

MHTSRAKDEEFIFLNAYIRMYNQWKDGDLGTLQTFLRDTFLSLLFAGRDTTSAALTWFFW

LLAKNPSVEKRIREEIQQQLNLKEGENLKFFEIEEARKLVYLHGALCETLRLFPSVAIEH

KLPLEFDLLPSGHRVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISERGGIKHEPSF

KFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYYIKLEDQIILPNSSVIIQMKNGLKVRV

FKRVPLMSN* 5648267

 

SL2.30ch10 61336152- 61337798 (+) strand

 

>CYP96A46 CYP96A@12 scaffold05992 51% to CYP96A18 Vitis

5659244 MDFLEYSLLFLLIFCSTYSIWFIIYRRTKTSAPTNWPILRELPGVIGNLHRGHAYMTEVL

IEYGGTYDFKGPIFTNVDMFFTCDPANIHYIFSKNFSNYPKGPEFRKIFDMLGNGIFNVD

HELWELHRRTTMSIMSHAKFQMLLEKTMWDIIEKGLKPILDAFAKQGKTLDLQDVLQRFT

FDSITRLLLDHDPKSLSMDLPYLPYEKAFGDALDALLHRHITPQRLWKLQQWLRIGKEKK

LMHACEAFDQFIYPCIARKQEELMHKSRIKEEEFAFLNAYIKVYNQWNGGDLGTLQTFLR

DTFLNLMLAGKDTTSAALTWFFVLLAKNPLVEKKIREEIQQQLHVKEDENLKFFTKEESR

KLIYLHGALCETLRLYPSVSLEHKVPLDHDILPTGHRVSPKTRMILPFYVMGRMETLWGK

DCLEFKPERWISERGGIKHEPSFKFPAFNAGPRTCLGKEMAFIQMKIVAATIIHNYNIQV

VEPQNVYPTTSIIMQVKNGLMVKVVKRYN* 5657715

 

>CYP96A48 CYP96A@13 scaffold05992 52% to CYP96A18

5691645 MTLMDVLGYYVIPLIILCFTYWNLKNKWAKSSKPTNWPIFGMLPGLVHNAHRIHSFFTDILLETTSNFEF 5691845

5691846 RGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDS 5692001

5692002 ELWEIHRKTTMSLMNHSKFQTLLQRNVWDTIDKGIVPTLDILAKQDTPVDLQDIFQRFSF 5692181

5692182 DTISKLLLDHDPKSLSVNLPHVPCEKAFNDMVDALLYRHVLPERYWKLQKWLRIGKEKNL 5692361

5692362 MKAWESFDQFIYPAISKRQEKLINNEIKDDDFDLFSDYVKAYKEWTNEDDKNLGSVEKF 5692538

5692539 LRDTFLNLMFAGRDTTSSNLTWFFWLLSKNPLVVKKIREEIQQQLHLKEDESLKF 5692703

5692704 FNIQESRKLVYLHGALCEALRLFPPVSIEHKSPLQLDVLPSGHRVSPNTKILISFYTMGR 5692883

5692884 MESLWGKDCLEFRPERWITERGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMVAA 5693054

5693055 TMIHNYNIQLVEAQTISPTATVVIRMTNGLMVKVGKKVPI* 5693177

 

SL2.30ch10 61381654-61383195 (+) strand

 

>CYP71BG2 scaffold02745 = M01000001030 LA3475 type 6, 100% to CYP71BG2 tomato

5337494 MEASILQLLLLLSLTSCTILFYKIRGRWRRRPPSPPSLPIIGHLHLLNQMPHHTFFNLSQ 5337673

5337674 KLGKIIYLQLGQIPTLIISSPRLAELILKTNDHIFCSRPQIIAAQYLSFGCSDITFSPYG 5337853

5337854 PYWRQARKICVTELLSSKRVHSFEFIRDEEINRMIELISSRSQSEVDLSQVFFGLANDIL 5338033

5338034 CRVAFGTRFIDDKLKDKDLVSVLTETQALLAGFCFGDFFPDFEWVNWLSGMKKRLMNNLK 5338213

5338214 DLREVCDEIIKEHLMKTREDGSEDFVHVLLKVQKRDDLQVPITDDNLKALIL (0) 5338369

5339079 DMFVAGTDTSAATLEWTMTELARHPSVMKKAQNEVRKIVANRGKVEEFDLQHLHYMKAV 5339255

5339256 IKETMRLHPPVPLLVPRESIEKCSIDGYEVPAKTRVLINTYAIGRDPEYWNNPLDYNPER 5339435

5339436 FMEKDIDLRGQDFRFLPFGGGRRGCPGYALGLATIELSLARLLYRFDWKLPSGVEAQD 5339609

5339610 MDLSEIFGLATRKKVALKLVPTINKL* 5339690

 

>CYP71D202 CYP71D@4 scaffold00508 56% to CYP71D48v1 Nicotiana tabacum, runs off the end

92% to 71D.100P (ortholog)

1153 MEINYSLASLLLFLSSLFIVIKQWRTKKPKKLPPGPWK

1039 LPIIGSLHHLIGRGLPHRVLRDLSQRYGPIMYLQMGQVPTVVISSPTMAKQVLKTHDLAF 860

 859 VNRPQLTSTSIIFYNNKDIAFSQYGDYWRQMRKICTLELLSTKMVKSYGAIREDE 695

 694 LSSLISSIRSTMGNTINMTQIIFLFSNSIICRSAFGKICKNREEFLTILKEVLLLGAGFF 515

 514 VGDLFPSWRLIHNLRGEKTRMVNAHNKVDVVMEEILNEHIENKAAGKMGNGEFGDEDLVD 335

 334 VFLRVKENAELQFPIANENIKAVIF 260

 

SL2.30ch06 34325888-34326781 (-) strand (sequence gap after first exon)

 

 

>CYP736A66P CYP736A@1P scaffold00510 58% to CYP736A26 Vitis

51532 DLFPTIDLQGLTRKLKDLSKVFDEFLERIINEHVEYHDRDQTKDFVDTMM 51666

51667 DIMQSGEAEFQFDHRHIKAILL (0) 51732

51818 DMLLAAMDTTASTAEWILTELLRHP*VMKKLQNELQEVVGLERMVEESDMENLNYL 51985

51986 NMVVK 52000

51999 NEGLRLHPAVPLFFHEAMEDCVVDDLHIQKETRIIINCYAIHMDPNVWPDPEKFFPERF 52175

52176 VGSSIDFRGRELQLLPFGSG*RSCPGMQLGVTIVRIMVAQLVHCFEWEL 52322

52327 NGIDPCDLDIDEKFGMVTCREKPLLAIPTYRQKK* 52431

 

SL2.30ch04 51272968- 51273882 (+) strand

 

>CYP736A67 CYP736A@2 scaffold00510 60% to CYP736A26 Vitis

63121 MTLIWTVLVVALFVYQLLSIHKRKKFPPGPKGLPILGHLHLLGKNPHQDLQKLANKHGP 63297

63298 IMYMRLGLVPTFVASSADAAEKVLKTYDHVFASRPHHEASQYLSYGQKNLIFAKYGVYWR 63477

63478 NMRKLCTVHLLSNNKINSFQSMRKQQVQLLIESLKKEAHDRVAVDLSAKITSLNA 63642

63643 NLTCLMVFGKKYMDEDLDKRGFKSIVQDVVHLAATPNLGDFFPFLGAIDLQGLTRKLKDL 63822

63823 SEVFDEFLEKIIDEHVHSHEHKQTKDFVDTMMGIMQSGVAEFQLDRRHIKAILF (0) 63984

64086 DMLIAAMDTTASSTEWILTELLRHPQVMKKLQKELQEVVGLERTVEESDLENLKY 64250

64251 LDMVVKEGLRLHPVVPLFYHESMEDCVVDGFHIKKGSRVMVNCYAAQRDPNVWPEPEMF 64427

64428 LPERFVGSCIDFRGRDFQLVPFGSGRRSCPGMQLAVIVVRLVVAQLVHCFEWELPNGM 64601

64602 QPCDLDIDEKFGMVTCREKPLMAIPTYNLNKS* 64700

 

>CYP736A68 CYP736A@3 scaffold00510 60% to CYP736A26 Vitis

148596 MALIMWTTLIVAIAMYIFHKLLNINHNK

148512 KLPPGPWGLPILGHLHLIGKNPHQDFYKLAKRYGPFMHIQLGLVPTIVVSSPNTIEKVL 148336

148335 KTYDHVFASRPHHEASQHVCYGQRNLIFSKYGPYWRNMRKLTTMNLVSSQKINSYQPSRK 148156

148155 EEVSLMVKSIKHVADHNDQQHVVAVDLSAKVSSLNANLSCLMVFGKKFMDDDLDKRGFK 147979

147978 SLVQEVVHLAATPNLGDFFPYLGVLDLQGITSRLKTLSKVFDEFLEKIIDEH 147823

147822 VESKEQRETKDFVDTMMDIMQSGEAGFEFDRRHVKAVLL (0) 147705

147303 DMLMASMDTSATSVEWILTELLRHPHVMKKLQKELEQVVGLDRMVDESDLENLNYL 147136

147135 DMVIKEALRLHSAAPLLIHESIEDCVVDGFFVQKGSRIVVNVYAAQRDPNAWPEPDKFL 146959

146958 PERFVESSVDLRGHDFQLLPFGSGRRSCPGMQLGIIIVRLVVAQLVHCFDWELPNGMQ 146785

146784 PSELDMSEQFGVVTCRAKHLMAIPTYRLQL* 146692

 

>CYP71D190 CYP71D@5 scaffold00510 89% to CYP71D52 tobacco

2576378 MPFLSLASVFLFLSFLFLLRKWKNSN

2576456 SQSKKLPPGPWKLPLLGSMLHMVGGLPHHVLRDLAKKYGPLMHLQLGEVSAVVVTSPDMA 2576635

2576636 KEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYS 2576815

2576816 SIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFI 2576977

2576978 QLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNIA 2577151

2577152 MGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIF 2577271

2577358 DMFAAGTETSSSTLVWAMVQLMKNPSVFAKAQAEV 2577462

2577463 REAFKDRETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINGYTVPVKTKV 2577642

2577643 MVNVWALGRDPKYWDDAESFKPERFEQSSVDFIGNNFEYLPFGGGRRICPGISFGLAN 2577816

2577817 VYLPLAQLLYHFDWKLPNGMEPKDLNLTELVGVTAARKDDLILVATPYQQ* 2577969

SL2.30ch04 53799680-53801271 (+) strand

 

>CYP71D191P CYP71D@6P scaffold00510 71% to CYP71D52 tobacco, pseudogene

MPLVSIFLFICFLFLLRKWKKYSNNSQTKKLPPG

2740686 LADFHTAFIEVHRDLAEKYGPLMHLQLGEFSAVVVTSSEMAKQVVKTHDFAFASRPK 2740856

2740857 FMAMDIICYGRCDIAITPYGEYWRQMRKICVMVML 2740961

FGQVVKEQDVFIKLIREVVISLAEDLGVTDIF

 

SL2.30ch04 53960419-53960897 (+) strand

Extended seq in both directions

 

>CYP71D192P CYP71D@7P scaffold00510 67% to CYP71D52 tobacco, pseudogene

2749582-2750023 (+) strand

MQLVSIFLFICFLFLLRKWKNY &

2749582   KKSPPSP*KLPFIGSMYNLAGGLPHRVHRDLAE*YGLLMHLQL 2749710

2749745   EMAKQVVKTHDLTFASRPKFMAMDIICYGRCYIALTPYREYWRQMRKICVMVMLSAKNVR  2749924

2749925   SFSSDELVCLIDSIQSSSSSGEPVNFTERIIWF  2750023

 

SL2.30ch04 53969351-53969860 (+) strand

Extended N-term

 

>CYP71D193P CYP71D@8P scaffold00510 CYP71D pseudogene

2758317-2758513 (-) strand

2758513   DTLNNLIEYLPFGGGRRFCPGISFAFGSIAL & 2758415

          PLAQLLYHFDW

2758409   MEPKDLDLTESAGITAARKGDLYSISTPHHS*  2758317

 

SL2.30ch04 53979311-53979513 (-) strand

 

>CYP71D194P CYP71D@9P scaffold00510 70% to CYP71D52 tobacco, pseudogene

2771326 MQLVSIFLLISFHFLLRKWKKYFSNNSQTKELPPSPWKLPFIGSMHHLADGLPHRV 2771159

2771158 LRDLVKKYGPLMHLQLGKVSAIVVTSPDMAKQVLKTHDIVFA 2771033

2770929 IFKETMRLHAPVPLLVPRECREETEINGYIYCTG

2770835 VLVNVWALARDPNYWDDAESFKPERLE

        ET*ADFIGNNFEYLAFGGGRRICPGISFAL 2770675

2770673 AQLLYHFDWNGAKRLALD 2770620

 

SL2.30ch04 53991746-53992452 (-) strand

Trimmed 4 aa from N-term

 

>CYP79A43 CYP79A@1 scaffold00633 70% to CYP79A32

8237199 MKIISINILSIFLKSNNTNTLWTIFICIIFICLILKKWNSSVRNNKIPFPPSPKSWPIIG 8237020

8237019 NLPQLLLKSKPELIHWIHKIMKEMDTEIACIRFGNFNVIPVTSPELACEFLKTQDSVFSS 8236840

8236839 RPLCMSASLVNNGFLTSIFLPSGDQWMKMRRILASHVLSPTSLQWLRHKRDEEADHLNRF 8236660

8236659 IYNQPVLNVRKLTRYYCGNVVKNMIFSKRSLFGIIEKEEEQIDAVFTLIEYVYSFGVSDY 8236480

8236479 LPCLSVFDLGGDKAIIMKAYDIATKQIDIEVDHRIQIWKDGNKTLKEDILDVLIMLKDIN 8236300

8236299 GNPLMNVKEIKAQVL (0 8236255

8235461 ELFLAIVDNPSNAVEWTLAELLNQPKLMQKAIEELNIIVGINRLVQESDLPRLNYVKA 8235288

8235287 CIKETFRLHPIVAFNVPHVSVSDTIISEKYFIAKGSVVILSRLGLGRNPRVWKDPLKFNP 8235108

8235107 ERHLKMKDGSEVVLTDSKLRLLSFSLGRRGCPGVKLGSTITTMLLARLLQGFTWTLPPNS 8234928

8234927 PCNDLIKSSQTNNYCTLPFVAHAKERLAKDMYV* 8234826

 

>CYP72A199P CYP72A@1P scaffold00633

13348415-13348654 (-) strand

100% to CYP72A.41 potato

13348654   CILSEGVSKASKDLMYFPFGWGSRICLGMNVSMIQGKLVLAKILQNYSFELSPSYAHGPTM 13348460

13348459   PALVLQPQYGAPMIV  13348415

 

SL2.30ch04 25293315-25293542 (-) strand

Identical to CYP72A@7

 

>CYP72A203P CYP72A@25P scaffold05445

84550-84696 (-) strand

100% to CYP72A.41 potato

84696   LSEGVSKASKDLMYFPFGWGSRICLGMNVSMIQGKLVLAKILQNYSFELSPSYAHGPKM  84520

84519   PAIVLQPQYGAPMIV  84475

 

SL2.30ch11 37195223-37195444 (-) strand

 

>CYP72A200P CYP72A@2P scaffold00777

168197-168418 (+) strand

94% to CYP72A.41 potato

168197   LSEGVSKASKHFMYFPFGWGSQICLGMNVSMIQGKLVLAKILQNYSFELSPSYAHGPTM  168373

168374   PALVLQPQYGAPMIV  168418

 

SL2.30ch08 62863556-62863777 (-) strand

Solyc08g083160.1.1    SL2.30ch08    62863451    62863699    -    2    Cytochrome P450 (AHRD V1 *-*- B9N7U0_POPTR)

 

>CYP72A201P CYP72A@5P scaffold02706

14344310-14344525 (-) strand

94% to CYP72A.41 potato

14344525   EGVSKASKDLMYFPFGWGSRICFGMNVSMIQGKLVLAKILQNHSFELSPSYAHSPTMPA  14344349

14344348   LVLQPQYGAPMIV  14344310

 

SL2.30ch01 50277129-50277344 (+) strand

 

>CYP704A60P CYP704A@1P scaffold00980 50% to CYP704A21v2 Vitis

691881 PIKHKNNEYKPNMHKDTFVVSMDILQRSISVTTIILSLDFFVLILHLLTKKVHGK*RYH 691705

691704 PVGRTIFNHLINFHRLHHYMTHLAGEYKTCRFISFFRNYIFTSDPAKVEYIIKTNFENY 691528

690241 GIYSYNILKDILGDEIFTIDGDKWRKQRKEFPEGS*GIFAVGIQKKCR 690098

690097 KITHVLSQTVKSSKIIDI 690044

689964 DLFMKTFLDSIFRVAFEFELDNMCDSNDEGK 689872

689870 KIINVFDDANALTLWRFVDIL*KIKRFLNIGQEGMLRDNIRTIDEFVCKPIHRKIEQ 689700

689699 MSKLKVDLFVG*LSYICYFYY*GKMLIRHFNLFQVAKKERRHSVKVSANSWKISKVFA*Y 689520

689519 IIELHNSTQTYNNNHPLS*FIYVLCRYP 689436

       xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

689433 ALEKMQYLHATLLENLRIYPA 689371

       xxxxxKICFLDDTL

679822 LQDGLIVNKGDIVAYQ*YSMGRKKFIWGDDAKEYKIERWIDGDGFLTLENPSKFTPF* 679649

       AGPRICLGKEF SNQQMK 679463

679462 ILSALLLCYFVFRLSDDKKTFNHRIMINIHIDGGLHVHVFHIL* 679343

 

SL2.30ch11 28286180-28298730 (+) strand

 

>CYP704A59P CYP704A@2P scaffold00980 62% to CYP704A23 Vitis

692953 IGPRICFGKDIFNG*MKIFSDMLLSYFVFKLSDDKKPINYRKMINLHIDG 692804

 

SL2.30ch11 28285108-28285257 (+) strand

 

>CYP704A58P CYP704A@3P scaffold00980 55% to CYP704A21v2 Vitis

718310 KKIKEAINEK*DAKDIINFAANVSEYSFENMQYLHETLIETLSLHTLFPM

       NGKPCISNDTLPDGLNVNKGDILAYHSYAMGRMKFIWGD*A*RY 717951

717950 NLDRWIYGDGFFKLENPFKFTAFQVC

717739 PRIFLGKEFAYRQM*ILFALLLRYSVLRLSDDKKTFHYRTMINLHIDGALPIRVFHRL*N 717560

 

SL2.30ch11 28259752-28260502 (+) strand

 

>CYP704A57P CYP704A@4P scaffold0980 49% to CYP704A21v2

738423 KLNMHKDTFVVFMDLMSSISIIIINLSFVFFVFIHHLLTKKEHGK*RYYPVGSTILNHE 738247

738254 IMNFHLLHHYMADLAG*YKT*RFISPFRNDF

       FTSDPTN

730869 TTKLSHIFSETVKSYKIIEIK

       NLFMKEILDSIFT 730690

730689 VSFEVEQDNMFSSNDEGKSIINAFDDASALTLCRFVYILWKIK*FLNIGSESKLRHNIRT 730510

730509 IDEFVYKLIHIKTEKMSKPKANLS

730387 WKKEDIMSKFLEKAGKVLHGIILNFIIAGKVTTTTTLSCSIYVLRKYPPEKEVQ 730226

730225 EIKKEIYDKQDAPDIMDCGVNVSKHALEKMHYLHATLIETLRLYPTIPMIKRTSFIVYIR 730046

730045 GHLTRWIQFNIGDINACQSYLMGRMKFIWGDDVEEYKSERWIDGDGFFKPKNHFKFTASQ 729866

729734 VGPRIGLGRSLPIGK*KYYRLFLSHYFVFR*SDDKKTFN*RTMINLHIDGGLPILVFHRL 729555

729554 *N 729549

 

L2.30ch11 28239639-28248513 (+) strand

 

>CYP704A56P CYP704A@5P scaffold0980 66% to CYP704A21v2

739474 LWKEFIYRQTKIFSVVFLRYIVFKLSDDKKTKKYRKMINLHIDWGLHVRVFRR*EN 739307

 

SL2.30ch11 28238588-28238755 (+) strand

 

>CYP704A46P CYP704A@6P scaffold00980 58% to CYP704A21v1 Vitis

2750149 GGTIFYLVIIFDRMHHYMTDLSGKYKTYRFIRPFKNRIYISDPADVEYILKTNCEIY (1) 2750319

2750448 GGYTYYILYNLLGDGLFTVGGDKWGELGKFSSHDFSTRVFKN 2750573

 

SL2.30ch11 26218664-26219088 (-) strand

 

>CYP704A47P CYP704A@7P scaffold00980 51% to CYP704A21v2 Vitis

26192285 YKMITPFKNKI

2776974 FTSDPTKVKYILKTNFENYVKAYH

        LPNLS 2777153

2777154 RDRIFIAYGYKCWEQRMLSSHNFSTMFFRDFRSVILRKNAAMFAHTFFEAVKCNKIVKIH 2777333

        AGPRIFFGKEAIY

2777515 QMKIFSVVMFSCFVYKLSDYKKTINYMKIINLHIDEGLNVCVFCR 2777649

        AGPRIFFGKEFIY

2777898 QMKIFSVVMFSCFVYKLSDYKKTINYMKIINLHIDEGLNVCVFCR 2778032

 

SL2.30ch11 26191205-26192285 (-) strand

 

>CYP704A48P CYP704A@8P scaffold00980 59% to CYP704A20 Vitis

26190420 PIKHENNTYKPNVNKDSFVVFMDILRSSIS

2778906 HLFNFHRLHHYMIDLVGQKKT*KFIIPFRNDSFTS 2779010

2779019 ANVEYILKTNIENYVKVHHFLGILDN 2779096

 

SL2.30ch11 26190141-26190420 (-) strand

 

>CYP704A49P CYP704A@9P scaffold00980 52% to CYP704A21v1

2843174 SVVCIDNFHSSIMSITTTIISLILFFVVILHHLTRKLHGKKRYHPIGGTIFNLLITFDIG 2843353

2843354 NYYMTYLSGKYKTYRFIRPFKNRIYTSDPANVEYILKTNIKN*GK 2843488

2843611 GWYTYYILLGLVRGVIF 2843661

 

SL2.30ch11 26125560-26126047 (-) strand

 

>CYP704A50P CYP704A@10P scaffold00980 56% TO CYP704A20

2865513 YKMIRPFNNRIFTSDSINVEYILKTNFENSGK

        NWYNYYILKD*LGDGI

        FTVDGHK*REQRMLWSHDFCTGVFRDFSSLIF 2865872

2865873 RKTSTKFAHILSEAFKSIQ 2865929

2865933 RPENSFKFTAFQ

        AGSRIFFGKEFVYIQ 2866112

2866113 MRIFSVVLLSYFVFKLSDGKKTINYKKMINLHIDGGLHVSVFRR 2866244

 

SL2.30ch11 26102307-26103038 (-) strand

 

>CYP704A51P CYP704A@11P scaffold00980 55% TO CYP704A21v2

2868178 FSITTIIN*LVFCVFILHLLKKKKVHGK*RFHPVGDTIVNHLINFHRFQHYMTDLAG*YK 2868357

2868358 TYRFISPFRNVIFTYDPANIEYSLRTNIENYCK 2868456

        EHNFLDI*IIFSKLGIYLIL*RCKQEKLLN*YSEYSCLIKNN

2870768 AHILSETVQSER**TFKQ

        DMFMKAILDSILGVAFE 2870947

2870948 VELDNMCGSNDKGK

        KIINAFDKAGALTLWKFADIL*KMKRFLNIGSKAKLRDNIRTMMIL

2871128 VYKLIHRKTEQMSKPKADLS 2871187

2871271 KKEDILTRFLQIAETYSKYFCDIILNFIIAGKDTTTTT 2871384

2871384 LSSFIYVLCKYPHVQEKVAHDIKEATNEKLDATNVMDFAANVSEDALENMQYLHEALTET 2871563

2871564 LRLYAALPM

        MEKYVFSDGTLLHGLNVNKGDIV 2871743

2871744 TY*SYAMGRMKFIWDDDAEEYKPERWIDGDGSFRPENP  FKFTAF QAGPTIC

        LGKELANRQMKILSALLLHYIIFRL 2872103

2872104 RDDKKTFNYRTMINLHIDGGLPVLVFHRLSN* 2872199

 

SL2.30ch11 26096352-26100373 (-) strand

 

>CYP704A52P CYP704A@12P scaffold00980 51% to CYP704A21v2

2991530 LLFCVFILHFLTKNIHGKKIYHPVNATVINLVIDFDGVHHYMSDLPGK*KTYKLSSPFKN 2991709

2991710 RIYTAHSTNVEYILKTISKKYGK

2991880 WYSY*IL*DLLGDGFFTINRDKSGEQKKF 2991966

2994305 AGPRIFLGKKLV*RQVEIFSNVL*SYFVLKLSGDKKTINYRKMINLQIDEGFHDPVFRR 2994481

 

SL2.30ch11 25972710-25975661 (-) strand

 

>CYP704A53P CYP704A@13P scaffold00980 50% to CYP704A20 Vitis

2995290 YRHKNQNMHKDTFVVSMDILQSSIFITTIIASLVFCLFILHLLTK 2995424

2995424 KLHGK*RYHLVGGTIFNHLINFHGLHHYITDHFGE*NTYRFISTFRNDNFTSDPYNVKY 2995600

2995601 ILKTIFENYGKLHHFLEILDN 2995663

3005777 IANILVETVKSSNIIDIQ

        DLFMEAILDSILRASF 3005956

3005957 IVELDSICGSNVEGKIFINVFDDPRLTLWIDILWKIKILPNIGSEAKLRDNIRTIDE 3006127

3006128 FVYKLNHKKTEQMSKQKLIDL

        LQWKKEDILLRFMQ 3006307

3006308 IAGIDPKYSRDIILNFIIAGKDTASTTL 3006391

3006394 WLIYVLFKYPHAHEKV

3013373 RICLVKEISNRQMKILPALLLS*FVFLLGVDKKNFN*RTVINLHID 3013510

 

SL2.30ch11 25953681-25971901 (-) strand

 

>CYP704A54P CYP704A@14P scaffold00980 52% to CYP704A21v1

3047005 VVCMDILYSSIMSIKDTITSIFLFCVLILHFLTKKLHGKKKPSNWLQRFQTTFQVRRM 3047178

3047179 HHYMTDLAGKYKTYRFISPFYRRIYSFDPANVEYFLKTQFEIYGKVQH 3047322

        ELLGDGIFIVEGDMLMEQWKLSSHDFIIRVCKVLKGENGK 3047584

3047585 *RAANF 3047602

 

SL2.30ch11 25919587-25920184 (-) strand

 

>CYP704A55P CYP704A@15P scaffold00980 44% to CYP704A21v1 Vitis

3093009 VVRMDILNSSIMSITTIIISLLLFCVLKFHFLTKKLYGKKRYNQNWSHHFQSGINVDKEH 3093188

3093195 MTDIAGKYKNYRYISPLNNWIYTSDLANVEYILKTNLENFGK 3093320

3093401 GGHSHYIL*DFSGDGSFRVDGDKWGMHRKLSSHIFSTMVCQVLKGVNGK**VANF 3093538

 

SL2.30ch11 25874172-25874728 (-) strand

 

>CYP92B15P CYP92B@1P scaffold00980 67% to CYP92B1 Petunia

4234083 DFFAGGADTSATRVEWAFQE

4234172 LMRNPNMIEKANEELDRTIGKGRWVEEDDLSQLP*IEAIIKETFRLHLLTP*IPPPYSIE 4234351

4234352 EFNAAGYDIPKGIIVYVNIWSLGRNHNY*DRAEEFIPGRFLENDINIKEKNFIILPFG 4234525

4234526 SRIRRCPG 4234549

4234555 LEIQLVGTTLNNLLHGFSWRLTGDINPDKICMKEIYGLTTHPEKPIFMIMEPRHHLHLY* 4234728

 

SL2.30ch11 24739039-24739690 (-) strand

 

>CYP82E11 CYP82E@9 scaffold01956 71% to CYP82E5 Nicotiana tabacum

82% to CYP82E.4 potato (ortholog)

MKFDLLLLLLSP

254007 MEAAIVALLTLAFLFYFILSTKKSSKLPLPPEIAGGWPVIGHLFYFNDGDNRPLARKLSD 254186

254187 LADKYGPVFTFRLGLHRMLVISSYDAVKECYTKNDAVFANRPACLYGEYIGYNNAILFLA 254366

254367 NYGSYWRNIRKLIIQEVLSNSRLEKLKHVKIEKIRNEIKNLNSRIQNSEVKSVINLTDWL 254546

254547 EKMNFGLIVKMIAGKNYESGGDGDEEVERFRETFKKFLVLSMEFVLWDAFPIRLFKWIDF 254726

254727 QGHVKLMKETFKDIDSISQRWLDEHVKRNTEVNEDEKYERDFIDVMLSKMSDERLHQGHS 254906

254907 RDNAIKATIF (0) 254936

255702 SMVMDAADTVPHHINWGMTLLINNQHVLKKAQEEIDTKVGKARWIDDNDIKNLVYLQAIVKETLR 255896

255897 LYPPSPLLVPHENTEECVVSGYRIPKGTRLYANVMKLQLDPKVWPNPEQFNPDRFLSTD 256073

256074 INFRGQDYEFIPFGSGRRSCPGISYALQMEHLTIGHLIQGFNYQTPSNEPLDLQEGIG 256247

256248 MTMPKVNPVEVIITPRLATELYEKLS* 256328

 

 

SL2.30ch04 1587278-1589635 (-) strand

Added 12 aa at N-term

 

>CYP82E11-de2b CYP82E@10P scaffold01956

257179-257397 (+) strand

93% to CYP82E.4

KVVGFKEAFRKFLVLSMEFVLWDAFPIPLFKWIDFQGHVKLMK

KTFNDIDSIFQKWLNEHAKRRDTSLMEFNGSGNETDFIDVMLSKMSSEHLHEGYSRDTVIKATVF (0)

257176   DIDFRGQDYEFIPFGSGRRSCPGTTCALQVEYLTIGHLIQGFDYKTRLDEPLDMKEGP  257349

257350   GMTMRKVNPVEVIITPRLTPDLYKI* 257427

 

SL2.30ch04 1586179-1586864 (-) strand

Added a new piece to this pseudogene, downstream from CYP82E@9

 

>CYP71BN3 CYP71x@4 scaffold02156 48% to CYP71D48v2, runs into a seq gap

filled in from ver 1.03

MEVSSFIFTFFLIFLPSCDR

592201 KNHKKSKNLPPGPWKLPIIGNLHQLDISRPYITLKELSKKHGPLMHLKLGERSTIVISSY  592380

592381 KILKELMKTSDTILSHRPELLVSKTMAYNGGDIAFAPYGDY*  592506

617840 KQMRKICTSEILTTKRIHSNYPLMEEEISRLVK & 617742

617742 NIKETSSKGTLINLYKCLNSLSCAIIC 617662

617661 RATVGATCNDSDSLISTIRKITPLVGLFNISDLFPSLKFLDRYITGSNQKLLKMHHELCD 617482

617481 RLLEEIVHEHEESIQKNNVDEEDLLHLLLRVREKESHNFQVPITRDNIKAVIL (0) 617323

616543 DMFIGGTDTTSILLEWAMAELLKNPNMMKKAQVEVREAL 616427

616415 KVDHIDVQNLKYLKLIVKETLRLHPPGPLASPRESIEEIAINGYVIPNKTIALMNLYAMG 616236

616235 RDPEYWHDPEKFMPDRFNNYVDNDVDDVKMIKGSSNVPMEFLAFGFGKRVCPGMLFATAS 616056

616055 SELTLARLLYHFDWTLPNGMNPQDLDMTESFGAAATMKNNLYLVATPYD* 615906

 

SL2.30ch08 588625-594567 (+) strand

Added N-term, completed seq.

 

>CYP71BN3 CYP71y@1P scaffold02156 note: this is part of CYP71x@4

622116-622421 (-) strand

93% to CYP71y.1P 100% to CYP71x@4 same gene

622421   RKNHKKSKNLPPGPWKLPIIGNLHQLDISRPYITLKELSKKHGPLMHLKLGERSTIVIS  622245

622244   SYKILKELMKTSDTILSHRPELLVSKTMAYNGGDIAFAPYGDY  622116

 

SL2.30ch08 588682-588987 (+) strand

 

>CYP71BN2P CYP71z@1P scaffold02156

651059-651226 (+) strand

78% to CYP71z.1P

ILYKIFSLREVTQTSTIIEWALMRKSPNRL*KVEK

LKLVVKETLKLFSY*DRNN*VSLSRESTKRCEVNGYIIQNKTIALV

651059   MGRDP*Y*DDSEKFFPN*FNNYIDNDDDVKIKGL*NLSNEFLAFGFGKRICPIMLF  651226

 

SL2.30ch08 557668-558118 (-) strand

 

>CYP71BN1 CYP71x@5 scaffold02156 EST SGN-E1280249 92% to scaffold02156 661-617 kb

3 AA DIFFS TO AK326514.1, 48% TO CYP71BE5 VITIS

694289 MEVSSFIFTIFLIFLPLLLA

694349 IVKNHKKSKKLPPGPWKLSIIGNLHQLEISRPYITLKELSKKYGPLMHLKLGERSTIVIS 694528

694529 SYKILKELMKTSDTILSHRPELLVSETVAYNGRDIAFAPYGDYWKQMRKICTSEILSTRR 694708

694709 IHSNYPLMEEEISRLVKNIKESSSKGTLINVYECLNSLSCAIICRVTVGTTCNDSDSLIS

       TIRKITPLVGLFNISDLFPSLKFLDRYITGSNQKLLKVHHELCDRLLEEIVHEHEESIRK

       NNVDEEDLLHLLLRLREKESHNFQVPITRDNVKAIIL (0)

695427 DMFIGGTDTTSILVEWAMAELLKNRNMMKKAQVEVREVLKGKKKVDHIDVQNLKYLKL 695600

695601 IVKETLRLHPPGPLAIPRESIEEIAINGYVIPNKTIALMNLYAMGRDPEYWHDPEKFMPD 695780

695781 RFNNYVDNDVKMIKGSSNVPMEFLAFGFGKRVCPGMLFATASSELTLARLLYHFDWTLPN 695960

695961 GMNPQDLDMTEGFGAAATMKNNLYLVATPYD* 696056

 

>CYP78A76 CYP78A@1 scaffold02484 69% to CYP78A37 Vitis

996536  MKLFMLALFILVISYYAYPWPFTLATLLFSLLLNFLLNYWLVPGGFAWRNYTYYHRNPNKLHGP 996715

996716  FSWPFLGFLPQMGSCAHRKLAKIASSLGSTRLMTISLGATQVIISSHPDTAKEILWSASF 996895

996896  SSRPLKESTKLLMFERAIGFAPYGSYWRNLRRIATNHMFSPRRISCFESLRQLIADKMIG 997075

997076  EVVKEMNESGFIEIRGLLRQGSLSNILESVFGSSLGLEGERLGLMVKEGYELIGEFNWSD 997255

997256  YFPLDFWGTKRRCYKLGAQVNEVVGEIMKKRRREGELVNMKNDFLSVLLSLAKEDQLKDE 997435

997436  DMVAILW (0) 997456

999930  EMVFRGTDTIAIL

999969  VEWILARTILHQDVQEKAQEEIDTCVGQNRNVQDSDIQNLPYLQAIVKEVLRLHPPGPLL 1000148

1000149 SWARLAMHDTYIDKCFIPAGTTAMVNMWAITHDPTIWEDSWAFKPERFINKEDFSIMGS 1000325

1000326 DLRLAPFGSGRRVCPGRVLGLATVHLWLARLLQRFKWLP 1000442

1000443 NKPVDLSECLKLSLEMKKPLACRALNRSSI* 1000535

 

SL2.30ch05 10425822-10429833 (+) strand

 

>CYP81C11 CYP81C@4 scaffold02587 81% to CYP81C6v1 Nicotiana tabacum

179434 METHYSSYLFYLAI

179476 FSFFTPILFRYFFHRKRNLPPSPFSFPIIGHLYLVKNALHLTLTSLSAKYGPVLYLKLG 179652

179653 YNMPVIVVSSPSAVEECLTRNDVIFANRPKTLAGDKFTYNYIVYVWAPYGQLWRILRRLT 179832

179833 VVELFSSQSLSKSCTLRDEEITTFIRCLYRFSTINSSKKVDLTNWAFTLVFNLMTKIIAG 180012

180013 KHIVKEEDAGMEKGIEIIEKLRGTFLVTISFLNMIDFLPILRWFGYKGLEKKMDVIHSKR 180192

180193 NEFLNTLLDEFRRNKISGLKSNSSNTLIETLLSFQESEPEFYTDDIIKSIML (0) 180348

180997 VVFVAGTETSSSTIQWVMRLLLAHPEVLHKLRADIDNKVGNKRLVRESDLTKLPYLRCVVNET 181176

181177 MRLYPPVPLLLPHYSTEDCTVGGYDVPKHTMLLINAWAVHRDPKVWDDPEKFKPERFE 181350

181351 ATQGETERFNYKLIPFGMGRRACPGTDMGLRAVSLALGALIQCFE 181485

181486 WQIEEEESLEASYHARMSMQNKPLKAICTPRKDLVDLLSQL* 181616

 

>CYP81C12P CYP81C@5P scaffold04429

4654946-4655358 (-) strand

90% to CYP81C.5, 88% TO CYP81C@4

4655358   MENHYSSYLFYLTIFSFFTPILFRYFYHRRRNLPPSPFSFPIIGHIYLLKNTLHL  4655194

4655193   TLTFLSAKYGPVLYLKLGYNMPVIVVSSPSAVEECL  4655086

4655098   TKNDVIFANRPKTLAGDKFTFNYIVYVWAPYGQLWRILRRLTVVELF  4654946

SSQSLSKSSILRDQGIGTFIRSLYRFSTSNGNGSKKVDLTNWAFILVFNLMTKIIAGKHVV

EQDAGMEKGIEIIEKLRGTFLVNISFLNMIDFLPILIWFVYKELEKKMDVIHDKR

NEFFNSLLDEFRHNKISGLKSNGTTLIE

TLLSFQESEPEFYTDHIIKSIMLV

 

SL2.30ch09 23993658-23994576 (-) strand

Extended seq.

 

>CYP82U1 CYP82x@1 scaffold02895 55% to CYP82L2 Populus

612705 MALKFHYNINMYFLSHLLALSIAWFLAVFIARKYKSRNITSAAPKAPGAWPFIGHLHLLS 612884

612885 GHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEMVKDCFTAKNDKIFASRPNMAISK 613064

613065 YLGYNGAIFALAPYGPYWRNIRKMVTLELLTNSRLEKLKHVRTSEVNSCIKELYSNNCPG 613244

613245 QVNLSSWFENITCNIIIRMLAGKRFTGSAEEMNFKESIKKALYLGGTFVFSDSIPWFEWM 613424

613425 DIGGHIKAMKDTYKEVDSVFDSWLKQHINSIGDGEQSDFIDIMLSTLPEETNMESGYNRD 613604

613605 AIIKATTL (0) 613628

614847 ILIMTASESTAETLIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIKNLPYLQAIVKET 615035

615036 LRLYPPGPLAGPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKDPNEFKPERWFLK 615215

615216 EHTNINFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNV 615356

SMLKEEPVDLSEGLGIALPKVKPLQPLLSPRLAVELYQSL* 615479

 

>CYP76B32P CYP76x@1P scaffold02895 55% to CYP76B7 Pastinaca sativa (wild parsnip), pseudogene

53% to CYP76F12 Vitis

59% to CYP76B@20

7047520 MDYNILIGV*FAYFLVYGVVICSLRRSKRVAPGPFPLPIIGNLHLLGDKPHISLTQLAIKYG 7047335

7047334 PIMNLKLGQINTVVISSSVLAKQVMQKQDLSFSSRSVSDALYACNQSDFSVVWLPVNSQW 7047155

7047154 RTFRKIMNSHIFS (1) 7047116

7046675 RHNLDVGKHLRSEKVQQLIDYCHKSGQNCEAVNIGRAAFRTTLNLLSNTIFSKDLTDPFSDS 7046520

7046519 AKEFKDLVWNIMVEAGEPNLVDYFPFLRKIDPQGRRRHMTNHFTKVLQLMSGLIDERLNE 7046340

7046339 RKIRNHINSDVLDSLLNIFPQEIDRNHIEHLFL (0) 7046241

7046140 DMFVAGSDTTSNTLEWAMAELLKNPHTLEKAQEELADVIGRGKLIHPP 7045997

7045996 VPFLIPRKTVEDVEFCGYIIPKDSQVLVNIWAIGNDSSLWEDPLDFKP 7045853

7045852 ERFWESDIDVRGRDFELIPFGAGRRICPGLPLAIKMVPVTLGSILNTF 7045709

7045708 NWKLHGGIAPKDLDMEEKFGITLAKAQPLLAIPVPL* 7045599

 

SL2.30ch09 55930579-55932503 (-) strand

 

>CYP76B31P CYP76B@21P scaffold02895 54% to CYP76B7 pseudogene

7056090 MDYMNILIGLLFAGFWVHGVVSFSLKRI & 7056007

7056007 QIAPGPFPLPIIGNLHLLGDKTHISLTQLAKKHGPIMNLKLGHINTVVTSSSILAKQVTQ 7055828

7055827 RQNLSFSRRSIPDGLYACNHSVVWLPVNSQWRTLRKNMNSHI 7055702

7055621 SGNNIDVSKHLRREKVQELIENCHKSVRNCEAVNVGRAVFRTTLNMLSNNIFS*DLTDPF

        SNSAKEFKDLMGNIMVEAGKPNLVYYSPFLEKIDPQGRRRRLIYHFTKIIQLMSGLIDERINERKLGN & 7055238

7055238 LKNVNFLDSLLNICPQEIDRNHIKHLIL (0) 7055155

7055012 DLFVAGTDATSNTFEWAMAELLKNLHILEKAQEELAQVIVKGKLIDEADVTELPYLRCIV 7054833

7054832 KETIRIHPQSPFLIPRKAEEDVELSGYIISKDSQVLVNVWEIGHDASLWEDPLDVKPERF 7054653

7054652 WESDMDIRDPDFELIPFDAC*RICPGLSLAIRMAPAGLG 7054536

7054531 SILNTFDWKLYGGIAPKDLDMEEKFGIRWQKLNLC* 7054424

 

>CYP71BP3P CYP71x@6P scaffold02932 51% to CYP71D55, 83% to potato CYP71x.1v1 (intact gene)

SIDLGVLPLLSCQAFFVSALSFPT

1955435 KLGPGPCKLPIIGNLLQM & 1955488

1955488 GNLPHISLANLATKHGPLMHLKLGESSEIVVSSPQLAKEIMITHDITFANRPQLSVAKIM 1955667

1955668 CYNFQDIDFSRYGDYWKQIRKICVMELLSTKNVTSFFPMMLDETNILVNIIKDMYGRPIN 1955847

1955848 FSEKMYLLTSAIICRASIGRTCKDQESV & 1955931

1955931 IMLMKQVASFAGVFNVVDLFPSLKILHFISGTNRKLLQLHRKV 1956059

1956138 EMFVAGSATSSTVLGWSMSELMKNPSMMRKAQTEVREAFNRKATIDQTDFKKLKYLKMVVKQT 1956326

1956327 LRFHPAGPLPLSIPRESTQQCEINVYTIPNKIIGIVNTWALWRDSEYWEESEKFEPERF 1956503

1956504 NGSPLDVGGNHFQLIPFGAGRRICPNMNFSIASMELCLAQ*LCHFD 1956641

YKLVNGVTPQQLDMSVNFGNVASRKNSLYLLASPFVKQDAH*

 

SL2.30ch08 27785425-27786829 (-) strand

 

>CYP92B14 CYP92B@2 scaffold03025 91% to CYP92B2v2 Nicotiana tabacum, 60% to CYP92A32

318070 MEVFVAFAGVVVLAFLCKVSTCRRPVNR

318154 KLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLVASSAEMAKQFL 318330

318331 KIHDANFASRPLLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNEIFTPKRLESFEYIRV 318510

318511 EERQTFISQLNSLAGKTFFLKDHLSRFSLCSMTRMVLSNKYFGESTVRVEDLQHLVD 318681

318682 QWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFHNIVLDDHRAK 318834

       KNAFVPKDMVDVLLQMAQDPNLEVKLTDDCVKGLMQ (0)

       DLLTGGTDSLTA

318041 AVQWAFQELLRQPRVIDKAIQELDQVVGKERWVEERDCSQLSYIEAILKETLRLHPLGTM 319220

319221 LAPHCAIEDCKVAGYDIEKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLEKDIDMDGH 319394

319395 NFSFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFNWKLPQGVNTESVSVEEQYGLTTHP 319574

319575 KFPVPVILEPRLSSHLYSPK* 319637

 

>CYP82M2 CYP82M@1 scaffold03134 79% to CYP82M1v1 Nicotiana tabacum

3439304 MDYHLEAILGILAFVFFAIIIWRRSNTLTTEKLAPQVPGAWPIIGHLHQLSGIDKNVPFA 3439125

3439124 HTLAALADKYGPIFTLRMGMYPYLIINNWEGAKDCLTTHDKDFAARPTSMAGQSIGYKYA 3438945

3438944 RFTYSNFGLYYNHVRKLALTQVLSSTKLEKMRHIRVVELENSIKDLYSLTQVANKNNEVI 3438765

3438764 NITQWFHQLTLNTIVKTICGKRYNNIEKDEEAKRFRKAFKGIMYVVGQIVLYDVVPFPLF 3438585

3438584 KYVDFQGHIKLMNNIYKDLDSILQGWLEDHMKKKDLNNDDDEDAIDAMLKATYVDEFKAY 3438405

3438404 GYSQATVIKSTIL (0) 3438366

3435855 SLILDGSDTTAVHMIWIMSLLLNNPHAMKQAQEEIDTKVGKSRWVGESDVKNLVYLQAIVKETSRLY 3435655

3435654 PPVPLLLPHEAVQDCKVAGYDIPKGTRTYINAWKIHRDPKIWSESEKFMPERFLTSKSSV 3435475

3435474 DARGQHFEFIPFGSGRRSCPGINFATLVTHLTFARLLQGFAFSTSSNTPIDMTEGVGI 3435301

3435300 TLPKVNQVEILVTPRLSSNFYVF* 3435229

 

>FI033502.1 tobacco FH434438.1, FI006728.1, FH605148.1, FH346097.1, ET755410.1|

80% to scaffold03134 tomato, 55% to CYP82S.1

MDYHISFHFQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNI

PFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGY

KYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN

MQKVNISKWFEQLTLNIIVKTICGKRYSNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIP

FPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEF

KAYGFSQATVIKSTVL (0)

SLILDGNDTTAVH

LIWVMSLLLNNPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVPFL

LPHEAVQDCKVAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPERFLTSKANVDARGQN

FEFIPFGSGRRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKVNQV

EVLISPRLPSKLYVF*

 

>CYP79A47 CYP79A@2 scaffold03496 73% to CYP79A32 tomato

88981 MKIPNLLLMVISNNTTLFFIILTIFISIILKKWNTSVRNYNKPFPPGPKSWPIIGCFPQI

      ILKNKHALINRIHKIMEEMNTEIACIRVGNYHVIPVTSPELACEFLKSQDSVFSSRPICM

      SANLISNNYITSI

88582 FLPIGDQWMKMRRILASHVLSPTTFQWLSCKRDEEADNLHRFVYNNQCISINLRRVT 88412

88411 RCYCGNVIRNMIFSKRSSFGSTIEEEEQVDAVFTLLEYLHSFGISDYLPW 88262

88261 LSFFDLDGHKAIIKKAYAKATKHIDIEVDKRIQIWKDGNKTLKEDILDVLIMLKDTNG 88088

88087 NPLMNVKEIRAQVL (0)

      ELMLATVDNPSNAVEWTLAE 87908

87907 MLNEPKLMQKAIEELNTVVGINRWVQESDLPRLNYVKTCIKEAFRLHPISPFNVLHVSVS 87728

87727 DTIVGEKYFIPKGSIVLLSRFGLGRNCRVWEEPLKFKPERHLKMEDGGKVVLNLRLLSF 87551

87550 SIGRRGCPAVKLGSTITTMLLARLLQGFTWSLPPISPCNDLIESSKINHFSTLPLLAQA 87374

87373 KPRLAKAMYL* 87341

 

>CYP79A46 CYP79A@3 scaffold03496 72% to CYP79A32 tomato

94237 MKIPNLLLMVTSNNTTLFFIILTIFISIILKKWNTSVRNYNKPFPPGPKSWPIIGCFPQI 94058

94057 ILKNKHALINRIHKIMEEMNTEIACIRVGNYHVIPVTSPELACEFLKGQDSIFSFRPLCM 93878

93877 SASLVSNGYLTPIFVPSGDQWMKMKKILTSHVLSPTSFQWLHCKRKEEADHLHRLVYNQC 93698

93697 SNQLVINLREVTRYHCGNVIRNMIFSKRSLFGIIEQDEEQIDAVFTLIEYVYSFSISDYL 93518

93517 QWLSFLDLDGHKAIIKKAYAIATKYIDIEVDKRIQIWKDGNKTLEEDILDVLIMLKDTNG 93338

93337 NPLMNVKEIKAQVL (0) 93296

      EFFMATVDNPSNAVEWALAEMLNEPKLMQK 92892

92891 AIEELNTVVGINRWVQESDLSRLNYVKACIKEAFRLHPFMAFNVPHVSVSDTIIGEKYFI 92712

92711 PKGSIVLLSRLGLGRNSRVWEDPLKFKPERHLKMKDGGEVVLTDSNLRLLSFSIGRRGCP 92532

92531 AVKLGSTITTMLLARLLQGFTWDLPSNSPCNDLIESSKINHFSTLPLLAQAKPRLAKAMYL* 92346

 

>CYP79A52 CYP79A@4 scaffold03540 70% to CYP79A32 tomato

125034 MVIYNVLSTFSKSNNNTTLWKIIISTILSKWNSKLVRNNKSFPPCPKSWPIIGILPQIFT 124855

124854 KNKSSFVYWIHKTMEEMNTEIACIYVGNVHVIPVTSPELACEFLKIQDSVFSSRPICMSA 124675

124674 KLISNNYLTSVFLPIGDQWMKMRKILASHVLSPSSLQWLRPKRDEAIDDLVEFVYKQCIN 124495

124494 QQFINLRKVTRCYCGNAIRNMVYNKRSLFASREEDEQQVDALFTLLKYLHCFGISDYLPW 124315

124314 LSMFDLDGHKAIIKKAYDIATKQIDIEVDHRIQIWKDGYKNLEQDILDVFIMLKDDNGNP 124135

124134 LMNAKEIKAQVL (0) 124099

123555 ELMLATVDNPSNAVEWTLAEMLNQPKLMQKAIKELDDVVGMNRLVQESDLPRLNY 123391

123390 IKACIKEAFRLHPISPFNVPHVSVSDTIIGEKHFIPKGSIVLLSRLGLGRNPRVWKNPLK 123211

123210 FKPERHLKKKKKDDGEVVLTDSKLRLLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTWS 123031

123030 LPPNSSSNDLLESSKVDHFCTLPLLAQAKPRLANNMYHF* 122911

 

>CYP76B27P CYP76B@22P scaffold03587 53% to CYP76B7, pseudogene

1077409 ESGKEFRELVYKFMEEFGKPNIVDFFPILRRMDPQGIRRLISIHARNFLKLFEGLIDECVE*R 1077597

1077598 KLHTNTRSNDNVLDVFLNVNQKDPAVIERKDIKHMFL 1077708

1078259 DLFVAGTETTSNTVEWAMSEVMKTPEVMKKAQIELEKVIGKVKI 1078468

1078469 IEERNVPLLPYLKYIVKETMRLHPPGPLFLRTAKQDVELCGYVIPKGSLVLIHVWFIAR 1078645

1078646 SLTIWEDPLVFNP*RFWGSEFEV & 1078714

1078714 GKDFELIPFGGGRRISPRLPLAMRTVLVILG*LLKSFDWKVKGEIEPKDLDMEEKFGLTLAKSRPL 1078911

        PVSNTQR* 1078935

 

SL2.30ch03 14436402-14437946 (-) strand

Added 3 aa at N-term

 

>CYP76B30 CYP76B@23 scaffold03668 53% to CYP76B7 = M01000000220

691821 MIPSIDMFYIGIICVLLLLAWTSIRVRNNKKLPPGPIPLPL

691944 VGNLHNIFGAPPHKSMERLANKYGPILSLKLGRLPTVVISSSAVAKEAVKKHDSAFSSKT 692123

692124 PKDAVEAHNHHKFSVVWLPVDSSRRKNLRTILNSCIVTANKLDANQDLRSTKISELIAYC 692303

692304 HRCSQTGDAVDFGIAASDIAINVLSNTIFSADLVDLCAESEKKFKDVIRSITFQIGKFNM 692483

692484 VDYFPVLKWIDPQGINRSTCADFAKMFRIFRDFIDERLEQRKKNQKTKDVLDILLNMSEE 692663

692664 KDGNGEGNNIATDRNQIEHLCL (0)

694229 DLFIAGTDSSSATLEWAMLELMKNPHAMKKAKAELAQVIGKKEAIKEADLVRLPYL 694396

694397 HCILKETLRIHPPVPLLSRKAEQEFELCGYFVPKGSQVMVNIWSIGRDPTIWEDPLVFK 694573

694574 PERFWGSNVMDIRGQDDFKLIPFGVGRRMCPAISLAMRTVPIMLGSLLNSFDWVVEGND 694750

694751 DLDAEEKSGLIVGKLRPLRLVPISL* 694828

 

SL2.30ch09 63982658-63985665 (+) strand

 

>CYP71D188P CYP71D@29P scaffold04121

3641040-3642145 (-) strand

78% to CYP71D.74

23571007  MEFHYLVSFFLFISFLFLLIKK*SNSNTLKKIF

3642145   LPRGPWRLPIIGSLHHLTNGVP

3642080   HRVLKNLSEKYGPIMYLQLGKVPTVIASFPHMEK*ILKTHNLAFASRTQTMMGKIICYDC  3641901

3641900   KDIAFSPYGDNWRHMRK*CTLEQLSAKMVKTFSLIRQEEHSTLLSSIASMDVDSPINLPQ  3641721

3641720   KLLWCMNASM*RSAFGNVCKDQKELITLIHQAQSLSGGFQLADFFPSKKFLNGTSGM*T  3641544

3641543   KLMKDRTKVDKVLDNIINVHRExxxxv  3641478

3641464   KNCNSESGAEDLTDVFLRVMESSEFPFLLTNDNIKAVIL (0) 3641348

3641183   DMLVAGSDTSSSTVI*ALSEMIKSPNVMEKAQAKVRQVFKGKKKTFDD  3641040

xxxxxx

 

SL2.30ch03 23569803-23571007 (-) strand

 

>CYP71D188P CYP71D@28P scaffold04121 76% to CYP71D50v1 Nicotiana tabacum

3631523 KKLTYSKLVIKKTLRLHPHTSLLVP*ECREETNINGLTISLKSKVLVNVWAIGRYPESWEN 3631344

3631343 PEFFIPEGFENNCIEFTCNHFQFLPFGGGRRICLGILFCLALLTLPLAHLLYNFDWKL 3631170

3631169 PQGINAKDFDMTEENGISARR*SDLYLISTPYVPL 3631065

LHKLHLKI*

 

SL2.30ch03 23559801-23560289 (-) strand

Note: 71D@28P and71D@29P are probably parts of the same pseudogene

 

>CYP76B33P CYP76B@24P scaffold04295

4926042-4926230 (+) strand

71% to CYP76B.34

VMKRV*AQIIQSLGKGNPIE*ADIV*LP*

4926042 LQLIMKENF*LHPQTPLLVPQKIEEDDKVYGYTVPKGLKVLINVWDTGRDSTIGEDPLVFNPD 4926230

*SVQED  26750871

 

 

SL2.30ch12 26750578-26750871 (+) strand

 

>CYP77A2 = old CYP77A19 CYP77A@1 scaffold04337 76% to CYP77A14 Vitis

92% to eggplant CYP77A2 (ortholog) only 70% to eggplant CYP77A1

5438716 MDSFSTSSLSPYYHLIF

5438665 TILAFVISTLIYSLTKKNKSKKLRLPPGPPGWPVVGNLLQVARSGKPFFQIMRELRQKYG 5438486

5438485 PIFTLRMGTRTMIIISNADLVHEALVQKGQIFASRPRENPTRTVFSCDKFTVNAAVYGPV 5438306

5438305 WRSLRKNMVQNGLSSIKLKEFRAVRKSAMDKMIDKIRAEADANEGLVWVLKNSRFAVFCI 5438126

5438125 LLAMCFGVEMDEKTIETIDQMMKSVLIALDPRLDDYLPILSPFFSKQRK 5437979

5437978 RAMDVRKQQIETIVPFIEKRKKILESPEIDETAASFSYLDTLFDLKIE (1) 5437835

5437141 GRNSVPTNTELVTLCSEFLNGGTDTTATAIEWAI 5437040

5437039 GRMIENPSIQSRLYEEIKNTVGENKIDEKDIEKMPYLNAVIKELLRKHPPTYMSLTHAV 5436863

5436862 TEPAKLGGYDIPTDVNVEIFLPGISDDPNLWSEPEKFDPDRFFTGKEEADMTGVSGVKMI 5436683

5436682 PFGMGRRICPGLNMATVHVSLMLARLIQEFEWSDPENTRVDFTEK 5436548

5436547 LEFTVVMKNTLRAKIKPRM* 5436488

 

$

 

>CYP76B28 CYP76B@25 scaffold04684

805440-805985 (+) strand

91% to CYP76B.43P

first exon of CYP76B sequence shown below with one frameshift

805404 MDNYTTLVLGSTLALSFLYIIIAKICSIRGIKKLPPGPSPWPIIGNFHLLGTKPHRSLVNLAQIYGPIM  805610

805611 SLKIGQKTIVVISSSTMAKQVLQKQDLAFSNRFITNALQAHMYSKFSVACLPVCPQWRML  805790

805791 RKILNKSVFSSNKLDANEHLRSQKVKELIAYCAKCSQQGKALDICQAVFKTNFNLMCSTL  805970

805971 FSKDLADPFSDS  806006 &

KVELKDMIWGVMNEAA

KINLADYFPILEKIDLQRTRYRANYHFGKLFKFLDDLIDERLEEKQRSHGEKNDVLEVLL

NFSAENPKEMDQNHIKSMLL (0) 805720

 

>CYP76B28 CYP76B@25 scaffold04684 = M01000000487 LA3475 type 6, 68% to CYP76B5

first exon is in a seq gap, seq from M01000000487

MDNYTTLVLGSTLALSFLYIIIAKICSIRGIKKLPPG

PSPWPIIGNFHLLGTKPHRSLVNLAQIYGPIMSLKIGQKTIVVISSSTMAKQVLQKQDLA

FSNRFITNALQAHMYSKFSVACLPVCPQWRMLRKILNKSVFSSNKLDANEHLRSQKVKEL

IAYCAKCSQQGKALDICQAVFKTNFNLMCSTLFSKDLADPFSDSKVELKDMIWGVMNEAA

KINLADYFPILEKIDLQRTRYRANYHFGKLFKFLDDLIDERLEEKQRSHGEKNDVLEVLL

NFSAENPKEMDQNHIKSMLL (0)

810778 DLVAGGTDSPITILEWAMSELIRQPEIMKKVQLELGEVIGKGKQVEESNIPKLPYLQ 810948

810949 FVVKETLRMHPPTPFLIPRKVVEQDVELCDYIIPKDSSILVNVWAIGRDPTFWKDPLVFR 811128

811129 PERFQNLEVDVRGRDFELIPFGAGRRICPGLPLAMRLVQTMLGSLLNSF 811275

811276 NWKLEGDIEPKDLDMEETFSFISSKARPLRVIPSPL* 811386

 

$

 

>CYP89A73 CYP89A@1 scaffold04857 55% to CYP89A35 Capsicum annuum, no introns

60958 MDSWFIIFLITLIFLFNFLFLFFSNSKTKK

61048 KLPPGPFSFPFIGNLPLLINKSLYDIEIILQKLIPKYGPIITLKIGTTISIFISSHSLAY 61227

61228 KSLIQLGARCSDRPLESPTSLLLSSNQRTINTASYGPTWRVLRRNLRAEMLRTTSQSKFR 61407

61408 VDWALNILVQKINHESDSKTGVILLDHIKHAIFSLLAFMCFGEKLDDVQIN 61560

61561 QIMDVQHRALLATIRFKILDIFPRVGKLIFRNRWKELIALRKEVDSVFTPLIERRIKYKI 61740

61741 ERFNSGVRQEEEETVSYIDTLLNLELPEEKRRVTNEEIVTLCVEFLGAASDTTSSALQW 61917

61918 IMAYLVKYPAIQEKVYEEIVKAEDSMKLYYLKAVILECLRIHPPSHFLLPH 62070

62071 RVTEEMELNGYALPKNAIIYFMAREMGLDPNVWEDPMEFRPERFLVDDETFDIRGSREIK 62250

62251 MMPFGVGRRICPGYDFAMFHLEYFVANLIRCFE 62349

62350 WKTVEGDDVDLTERLDFTFTMKNPLRARISPRQN* 62454

 

>CYP89A72 CYP89A@2 scaffold04889 65% to CYP89A40 Vitis

892184 MEIWFIVVVTLC

892148 VAFWLKSICNIIVSPNSNTKRNLPPGPYSFPVIGSLLWAKRTFSDLEPILRDLKAKYGPL 891969

891968 ITLNIGSRSAIFVASHSLAYQALVQQGAIFSNRPKAGPTSAVVNSNQRNISSAPYGPIWR 891789

891788 LLRRNLTSEILHPSRIKSYSKARSWVLGILIQQLRNAQVDSVKLIDHFQYAMFCLLV 891618

891617 LMCFGDKLEETQIRQIENIQRKLLLGFTRFNIINIFPRVGKIIFRNRWKELIEL 891456

891455 RQEQESIIIPLIEARSRAREQRTEHGDEFVVAYVDTLLNLEFPEEKRNLNHGEIVTLCS 891279

891278 EFLSAGTDTTSTALQWIMANLVKNPSIQEKLYQEIATVVGEKQSKLTDEEVVKEEDLQKM 891099

891098 PYLKAVILEGLRRHPPGHFVLPHTVTEEVELNGYVIPKDVTINFMVAEMGLDPKVWEDPL 890919

890918 EFRPERFLVEGSDNEGFDITGSREIKMMPFGAGRRICPAYALAMLHLEFFVANLIWHFQW 890739

890738 KPVEGDDVDLTEILEFTVVMKNPLRARICPRVNSV* 890631

 

SL2.30ch03 52801410-52802963 (+) strand

 

>CYP89A71 CYP89A@3 scaffold04889 60% to CYP89A38 Vitis

899393 MENWIFILLFSLCISFLLKSFVFFISANSKSKKKLPPGPYIFPVIGSLLWSNAKLEPKLRVLK 899581

899582 AKYGPLITLNIGSRPTIYIGSHSLAYQALVRQGSIFSDRPTAESSNQCVISSAP 899743

899744 YGSIWRLLRRNLTSEILHHSRFKSYSKARSWVLGILLQQIRHAQVDSVKLIDHFQYA 899914

899915 MFCLLVLMCFGDKLEETQIKQIQNMQNNLVLGFRRYRDVLKFFPGVGKIMFRN 900073

900074 RWKKLIEVQREQRNILIPLIEARRRAKEEKTEPADELVVAYVDTLLNLELPEEKRNLNV 900250

900251 GEIVALCSEFLSAGTDTTSTALQWIMSNLVKSPSIQEKLYRQIASVMGEKQSKLSTDEEV 900430

900431 VKEEDLQKIPYLKAVILEGVRRNPPGHFVLPHTVTEEVELNGYVIPKNATINFMVGEMGL 900610

900611 DQNVWEDPMEFRPERFLVEGSDKVVDFDITGSKEIKMMPFGAGRRICPAFALAMLHLEYF 900790

900791 VANLIWQFQWNPVEGDDDVDLSEKQEFASPLRARISPRVKSL* 900919

 

>CYP89A70P CYP89A@4P scaffold04889 48% to CYP89A1, pseudogene, C-term from Ver 1.03

905163 MESWFIIVVVTLCIAVLLKFLFNNTNSSSRKKLPPGPYSFPVIGGLLWAVKIFINVE 904993

904992 SILRDLKAKYGSLFTINIGSRPNIYVSSHSLAYQALIQQGAVFSDRRKALPTHAILSSNQ 904813

904812 RSISSAPYGPIWRLLRRNLTSEMLNPSRIKSYSKARLWVLGILIQHLRHAQVDSVKL 904642

904641 IDHFQYAMFCLLVLMCFGDKLEESQIKDIENIQRKYIVNYR*FYILNFFSGFGKIIFR 904468

904467 NRWKELVELRRE*ESIIIPLIEARRRNKEQNTEQSDEFVVAYVDTLLNLELPEENR 904300

904299 KLNVGEIVTLCRELLSAGTDTTSTALQWIMANLVKNPSIQEKLYREIANVVGEKQRKLST 904120

904119 DEVMVKEDDFQKMPYLKAVLLEGLGRHPPSHVLFPHTVTEEVELNGYIVPKNATINFMVA 903940

903939 DMGLDPNVWDDPMEFRPERFLVEGSDKVADFDITGSKEIKMMPFGAGRRMCPAYALAMLH 903760

903759 LEYFVANLV &  903733

3218709 WQFQWDPVEGDDVDLSEKLEFTTVMKNPLRARICARVNSV*  3218819

 

SL2.30ch03 52788363-52789917 (+) strand

 

 

>CYP736A59 CYP736A@17 scaffold04956 59% to CYP736A26 Vitis

430682 MALIFLQVLALLAILYILQDLH

430616 NKFIRKKKKLPPGPRGLPVIGNLHMIGKNIHQDLHKIAKKYGPIMSMKFGVIPIIVASS 430440

430439 PHAAEQFLKKHDLIFASRPNNRAMRIVAYNQRNLTFAKYGPYWRNIRKLCMLELLSPIKI 430260

430259 KSFQDMRKQQVTNFVTFINRAASCHDEVDISANLSLLSANMSCLMIFGKKYMDDEF 430092

430091 NERGFKDVIQEALIIAATPNIGDFFPFLDKFDFQGLIPRTKKLAKVFDEFLERVIDEH 429918

429917 VQNSKEEKQTKDIVDTMMNIMQSGEAEFEFDRRHIKAILL (0)

429350 DLLIASIDTSATSIDWIFSELVRHPKVMKKLQKELEQVVGMNRIVEESDLEK 429195

429194 LKYLDMIIKEGFRLHPIAPLLIPHESIKDCIIDGFNITRGSRILVNTWAIGRDPEVWPEP 429015

429014 EKFMPERFVGSDIDLRGRDFQLLPFSSGRRSCPGLQLGLIVVRLVIAQLVHCFDWKLP 428841

428840 NDMMPNDLDMTEKFGLVVSRAQHLVAIPTYRLHV* 428736

 

>CYP736A60 CYP736A@18 scaffold04956 62% to CYP736A26 Vitis

434586 MALFWTTFSIGLALLYLLHELWRN

434658 NKRKKLPPSPKEIPILGHFHHLLGKNPHQDLNNLAKKYGPIMYLKLGFVDNIIASSPHVA 434837

434838 EQFLKTYDQNFASRPPHEAAKYISYDQKNLTFGTYGPYWRNMRKLCTLELLSTLKINSFQ 435017

435018 SMRREELNLLIETLKKKSHEKIVVDLSEIVTRLSVDISCRMIFGKKYKDEEFGC 435179

435180 KGFKSVVNEGLQLAAAPNLGDFFPFLGKLDLQGLTRRMKAVSKVFDNFLEKIIDEHE 435350

435351 ESDKKGQHQNNKDFVDTMLNIMKSGETEFQFDRGHVKAILL (0)

437418 DMLIASMDTSATTIDWILSELLRQPNIMKKLQKEFEEKIGMKRMVEELDLEKLEYLNMVIKES 437606

437607 LRLHPVAPLLLPHQSIEDCTIDGYFIPKKSRILVNTYAIGRDPKVWPNNPDEFIPERFVG 437786

437787 SSIDLRGHDFELLPFGSGRRRCPGLQLGLIIIRLIVAQLVHCFDWELPNGMLPNDLDM 437960

437961 GEEFGLVVSRAKHVMAIPNYRLSM*  438035

 

>CYP96A51 CYP96A@6 scaffold04956 = C00.9_contig53 101-102 kb 57% to CYP96A28 Vitis

576105 MAFNFLVLASIGYIEIFVAIFLFFFVLAFGGKGDFGWKWPFFGEFPSLFYHINTIHQSLTILFSRI 575908

575907 GATAFVKGPCFANMDILGTVDPKNVHYIMSANFQNFQKGPGFKKIFDVLGD 575755

575754 GIFNADFDLWKDQRKIAKTLITHHTFHKFLVKTSCDMVKNGLVPVLEFMAKEGIVFDLQD 575575

575574 VFQRFTFDTTCILVTGFDPGSLSVDLNNIAFMKAMNDMGEVMVIRNLLPRCVWKLQKWLG 575395

575394 IGPEKKLRDAREVIDRVIGKYITMKRDELRAKGKKLNKNEEEEGVDLLASYIANDDGETK 575215

575214 TGLMFDDKFLRDTILNFMIAGRDTTSSGLTWFIWLVVTHPEIEKKIREELKSIISLGE 575041

575040 EGEKPRLFKGGEFKNAIYLHAALCESLRLYPPVPFQLKTPQEPDVLPSGHRVHPKM 574873

574872 RVMVILYAMGRMESVWGKDALEFKPERWISERGTVKHEPSYKFFSFNAGPRVCLGKEV 574699

574698 AFTQMKAVAASIIHNYHVEMVKGHEVCPNVSIILYMKNGFKVRIRNR* 574555

 

>CYP96A50P CYP96A@7P scaffold04956 pseudogene, 86% to CYP96A.4P

SWPVVFSLIQKGFHVKFLVSLFSHFIFITFTIFTF

578355   GTFLVKGLWFTNMDILGTVDPAKVHYIMSANFPNFPKGLELKKIFDVLGDGIFNSDLELW  578176

578175   KSQRKLAREMIIHMRFHKCLVKTNVDKVENGLILVLE

         FIRHLFPESVWKLQQWLGFEP*KKLS  577849

577848   KAEEDLDQVLGKYISMKREELSNAIKSEEDDEGYDLLTSYMVNDAETKTGLKFDNK  577681

577680   FLRDTILNFMFAGHDTVASGLTWFIWLVVTNP  577585

577586   PAIEKKIREELKAIVLLGEGEKRRLFKADEVKNAIYLHAALCESLRLYPPVAIQHKTPL  577410

577409   EPDIFPSGHHVHSNMRVMIPLYAMGTMEYIWGHDASKLKPERWISDRGTVKHEPSYKFFS  577230

577229   FNAGPRTCLGKEVAFTQMKIVASTIIHN*QIEMVKGHIVCPNISFMLYMKHGIKVRIKRR*  577047

 

SL2.30ch04 4304397-4305863 (-) strand

 

>CYP96A49 CYP96A@8 scaffold04956 = C00.9_contig53 111 kb, 64% to CYP96A18 Vitis

585059 MTLLGLGYIEIFLALFCFLLFYCFRHSNY

585972 PINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVD 585817

585816 PANVHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKF 585640

585639 LVKTSCDKVEKGLIPVIDHVCNKGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFPDV 585460

585459 PFSKAMDDAEEAILFRHALPEIVWKLQRWLRIGEEKKMINAQEVLDYTIDKYISMKREDL 585280

585279 KEVDHDLKESEEGFDLLTFYLKDEKELGVKCDDKFLRDNILNLMIAGRDTTSSALTWFIW 585100

585099 LVSTNPQVEKKIRDEINFVIPNEEGEKFRLFNVQELNKLVYLHGALCDSLRLYPP 584935

584934 VPFQHKEPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISERGTIK 584755

584754 HEPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHIVEPNASIILY 584584

584583 MRHGFKVKINKRWT* 584539

 

>CYP736A58P CYP736A@19P scaffold05223 63% to CYP736A25v1 Vitis

54793 LEYLDMVIK*CYRLHPVAPLLIPHESIEDCTIDVFDIPKGSKL*VNTWAIGRDPKFWSEP 54614

54613 MKFMSERFVDSNIDFRGHNF*FLPFGS*GRSCLGLQLGLTTTCLVLAQLVHCFDWKSP 54440

54439 NDMMPNDLDMAEKFSLVMSRAQHLVVIPTYHLNVYV* 54329

 

SL2.30ch04 105928-106389 (+) strand

 

>CYP71D208 CYP71D@36 scaffold05390 86% to CYP71D50v2 Nicotiana tabacum

601263 MDFQHLVSFFLFISFLFLLIQ

601326 KWRKPKNRLPPGPWRLPIIGSVHHLTSGLPHQVLKKLSFKYGPIMYLQLGEVPTVVVSSS 601505

601506 HMAKQILKTHDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVK 601685

601686 SFSPIRQDELSNLLSSIRSMNLDSPINLVEKLLWFMNAATCRSAFGNVCKDQRE 601847

601848 LITLIHQAQSLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDQVLDNIIN 602006

602007 VHRENRANGKSCNGESGAEDLIDVFLRVMESGQFPVPLTNDNIKAVIL (0) 602150

602467 DMFVAGSDTSSSTVIWALSELMRNPNIMAKAQAEVREVMGKKTCDDDIDTDLENVS 602634

602635 YLMLVIKETLRLHPPTPLLVPRECREETKIDEFTIPLKSKVMVNVWAIGRDPENWENPEC 602814

602815 FVPERFENSSIEFTGNHFEFLPFGAGRRICPGIQFGLALVTLPLAHLLYNFDWKLPQG 602988

602989 ISASDLDMTEANGISARREKDLYLIATPYVSPLH* 603093

 

>CYP706C@5Pb scaffold05428 = C08.17_contig39 165-166 kb

715 IYYGQEMVLGGTGSTSNTIEFAMAEIMNKPDVLRKLQQEVDTVVGKDNIVEESHIQQLPC 536

535 IYAVMKEVLRMHPATPLLVPHCPSETVTVGGYTVPEGSRVFINVWAIQRDTSIWKSPTEF 356

355 CPERFLENKWDYSENDFNYFPFGSGRRICAGIAMADRMFTYSLASIIHSFDWKLPQGE 182

181 TLDVTEK 161

 

>CYP71D203P CYP71D@37P scaffold05575

5457241-5457836 (+) strand

73% to CYP71D.46

5457241   LRKICMIELLSTKMVKTFVAIRKDEISSLASSIRSMRGSTINMTEKISLFSNYIICRSA  5457417

5457418   FGKICKDRDEFITILKEILLLTGGFDVADLFPSWKL  5457525

5457564   HKKVDIVMEEILNEHIENKAAGKKGNGEFGDEDLVDVFLRVKENAELQFPITNDHIKAVI  5457743

5457744   FVSLLRTLAMIIIFSTHFLSTTWYQSQVHSN  5457836

 

>CYP71D203P CYP71D@37P scaffold00648 ver 1.03 67% to CYP71D@38

LNFNLLSLLLFLSSLFIILFTRQWKHQK

KDIAFSPYGDY

403477   LRKICMIELLSTKMVKTFVAIRKDEISSLASSIRSMRGSTINMTEKISLFSNYIICRSAF  403656

403657   GKICKDRDEFITILKEILLLTGGFDVADLFPSWKLQDNxxxxxxxx &  403770

403797   AHKKVDIVMEEILNEHIENKAAGKKGNGEFGDEDLVDVFLRVKENAELQFPITNDHIKAV  403976

403977   IFVSLLRTLAMIIIFSxxxxxx &  404024

409042   LIWAFAENSDIMAKAQSEVRRIFKGKKKYDEEDFEELTYLKLVVKEALRVHLPAPLI  409212

409213   TPRKCREQTNINRYIIPIKTRVLVNAWALARDPQSW & 409320

409323   DPESFIPERFENSSIDFKGNHFEFFPFGAGRRMCPEMLFGLANVTHPLAQLLLHFKWDLP  409502

409503   NGTNSKDLDMTETGGIATTKKKNLLLVATCHRNEEEF*  409616

 

SL2.30ch06 34345197-34351474 (+) strand

 

>CYP71D204 CYP71D@38 scaffold05575 62% to CYP71D48v1 Nicotiana tabacum

5650142 MFSSLFNLVSLLLFLSSLVIIR

5650076 QNKKQRLPPGPWRLPFIGNLHHLIGGGLPHRVLRDLSQRYGPIMYLQLGQVPTVVITSPT 5649897

5649896 IAQEILKTHDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKS 5649717

5649716 FSGIRQDELSSLISSIRSTRGTTINMTEKVFQFTNCVTCRSAFGKICKDRNEFVALLKK 5649540

5649539 ILVFAGGFDLADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNG 5649360

5649359 EFGDEDLVDVFLRVKENAELQFPITKEHIKAVIS (0) 5649258

5649071 DIFIAGTETSSATIIWALSELMKNPNVMAKAQSEVRQVLKGKKNYGEEDIEKLTYLKLVI 5648892

5648891 KETLRLHTPVPLIGPRECREKTNIDGYTIPHNARVLVNAWALARDPKNWDKNPESFIPER 5648712

5648711 FENSSIDFMGNHFEFIPFGAGRRICPGIQFGLANVALPLAQLLYHFEWELPYGVNPKD 5648538

5648537 LDMSETHGLTASKAKDLYLNATNYKNDEGH* 5648445

 

>CYP71D222P CYP71D@39P scaffold05600 76% to CYP71D55 Hyoscyamus muticus

1073 DLFIAGTETSTTTIIWAMTEMIRNPSVLAKAQTEVREAFKGKETFNEDVIEELKYLKQV 1249

1250 IKETLRLHPPLPLLIPRECREDTNINGYTIPLKTRVIVNVYSLGRDPKY*EDAGSFIPER 1429

1430 FEHNSVDFMGNNFEYLPFGAGRRMCPAMSFGLINVYLPLANLLYHFDWKLPHGVKLEDVD 1609

1610 MNEFSGIAAARKSELYLIALLNILLMNDIYYRSRGVLCNS*

 

SL2.30ch12 32247452-32248111 (-) strand

 

>CYP71D223P CYP71D@30P scaffold04295 64% to CYP71D55

10402166 MEFQFPSNLIFLFLFLSFLYLLVVQWK

10402085 KSRNLNKKLPPGLWKLPFIGSAHHLALEGGLPHHALTNLGKNHGPFMHLQLGKISTIIVF 10401906

10401905 SMDMAREILKTHDLAFTSRPKILALDIICYKSTDIAFSPYGDYWRQMRKVCVLEFLTTKN 10401726

10401725 VRSFSSIRQDEASHLVQFIRSSTCGEL 10401657

 

SL2.30ch12 32242730-32243251 (-) strand

 

>CYP76A19 CYP76A@3 scaffold06070 81% to CYP76A12 Vitis

3076901 MDWDWNYVVWSIIIIVSTTLIIVFSKRNSSCYKLPPGPPGIPIFGNMFDLGALPYQTIAQ 3076722

3076721 YKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIMDTMLVHDYNLGSLAIA 3076542

3076541 RYGTYWRVLRRICTVEMFVHKRINETMDIRRKCVDDMIHWIENEVSSKEVKGSGIEVTRF 3076362

3076361 VFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIMVLSSIPNISDIFPCLRRFDLQGL 3076182

3076181 KKKMHREIGIALGIASTFVKERMKEREHGEVKKKDFLDVLLEFEGSGKDEPSKLSEHQIT 3076002

3076001 IFIL (0) 3075990

3075786 EMFLAGSETTSSSVEWTLTELLRHPEAMGRVKAEISRIVVQKKKFEESEIDNLP 3075625

3075624 YMQAVVKEVLRLHPPLPFLVPRRAMHDTNFMGYDIPEDTQVFVNVWAIGRDPEYWDDPLD 3075445

3075444 FKPERFLNSKTDFKGQCYEFLPFGAGRRMCVGLPLGNRMLHFVLGSLLHEFDWELPSN 3075271

3075270 VTPVSMDMKERMGMTVRKFNPLTAVPTKTSG* 3075175

 

>CYP76A20 CYP76A@4 scaffold06070 69% to CYP76A6 tomato

3079472 MFSYAYLRYHTTIVKYKNQSIFFLKFLREKMDWEFNFYILCSTIIFLLAFIFLIYQKNSS 3079651

3079652 FSKYNLPPGPNGLPIFGNYLILL & 3079720

3079720 GSEPYKKIASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNIVDVNLA 3079899

3079900 HNFYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTLIRQKSMNRMLGWIEKKASSGG 3080079

3080080 GVIEGIEVTRYVFLASFNMLGNMILSKDLVTDPESEKGSMFFNAMMGIMEWSGVPNISDI 3080259

3080260 FPCLKMFDLQGLRKKMKRDMGKAIEIIKNFIEERIEERKKGEENKSIKDLLDVLLDFEGS 3080439

3080440 GKGEPAKLSEHEITIIIL (0) 3080493

3081346 EMFLAGTETTSSSVEWALTELLRHPRAMTKVKLEISQVIGPNKKFKERHIDSLPYMQAILKES 3081534

3081535 LCLHPPLPFLIPRKAIQDTKFMGHDVPKGTQVLVNVWAIGRDPECWNDPFEFKPERFLES 3081714

3081715 KVDVKGQNHELIPFGAGRRMCAGLPLGHRMMHFAFGSLLHEFD 3081843

3081844 WELPNNVSPKSINMEESMGITARKKQPLKVIPKRV* 3081951

 

SL2.30ch09 2300139-2302618 (-) strand

 

>CYP76G10 CYP76G@1 = CYP76G@2

scaffold06070 75% to CYP76G6 Vitis, EST = SGN-E306491, N-term in a seq gap

blue seq from EST, then found on scaffold02027, join with scaffold06070

373 MEYEILGLLLLLLAWAAWAILTERRQRRLEEYGRLPPGPRWWQLLANIFQSGFAPHVSFA 194

193 KLANKHGPMMTLWLGSMTTIVISSNEVAREMFKNHDIVLA (1) 74

3084812 GRKIYESMKGDIGNEGSLITNQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTK 3084654

3084653 CIDQMLEFMEDAANSSTTSIDVGRFFFLMSFNLIGNLMISKDLVDPTSDRGAKFFYHAGK 3084474

3084473 VMEYAGKPNIADYFTILRCLDPQGIRRKTQFHVRRAFAIAGEYLRERMEDIENSDERKKD 3084294

3084293 YLDVLLRYRGDGVEGPSRFSSQTINTILF (0) 3084207

3083602 EMFTAGTDTTTST

3083563 LEWAMAELLHNPTTLQKVQDELRRVINPSKKLEEEDLDKLSYLNAVIKETLRLHPPLPFL 3083384

3083383 VPHMAMDSCNMLGYHIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMVDYKGHH 3083207

3083206 FEFIPFGSGRRMCPAVPLASRMLPLTLGSILHKFDWVLANGVKPQDLDMNERMG 3083045

3083044 TLKKAIPLKAIPCLYIKNIPQRTKK* 3082967

 

SL2.30ch09 2296170-2299126 (+) strand

 

>CYP736A57P CYP736A@21P scaffold06097 57% to CYP736A26 Vitis pseudogene

337242 EKKKKIPPGPKGLPIVGNLHMIDKNVHQALYKIAK & 337138

337138 RYDPIMSMRFDLVPIIVASSPHAAEQFLKKHDLIFASRPNNRVAQFAAYNQRNLTFAK 336965

336964 YGPYWRNMRKVCTLELLSTLKINSFQSMRTKEVRNFVT 336851

336849 LQGVVRHIKELANFFDEFPERVIEQHFQDSKNE 336745

336749 KKTKDIVDTMMDIMNSGKGEFEFDRCHIKAILM (0)

336258 DMLMASMDTSATSINWIFSEIIRHSKVMKNLQKELEQVVGINRMVEESDLEKLEYFQM 336085

336084 AIKECFRLHPVGPLLIPHESIEDCTIDGFDIPKGSRLLVNTWEIGRDPEVLSKPEFILE 335908

335907 RFIGSNIDLLGREFQLLPFVSGRRSCPELQLGLTIVRLC & 335791

335788 AQLVHCFD*ELPNGMKPNDLDMTEKFGLVMYRDQYVRVIPTYRLQVY* 335645

 

SL2.30ch03 17027373-17028970 (+) strand

 

>CYP736A56P CYP736A@22P scaffold06097 55% to CYP736A26 Vitis

MASIFLQVLALLVVL &

KFFKYCIINSS

350483 KRREKIPPGPKGLPIIRNLHMIDKNVHQELYQIAKKYGPIMIMRFGLVPIIVASSPHAAE 350304

       QFLKKHDLIFACRTNNR 350253

       ICAYNQRNLTFAKYGPYWRNM

       RKLCTLELLSILKINSFQSMRNKEVRNFVTFINQAATGGVEVDINAKVATLNANVACLMI

       FGKKYIDDDFDKRRFKDVIQEIMIITATPNIGEFFPFLDVFDLQGVVRRIKELAKVFDEF

       SERVIDEHIQDSKKEKKTKDIVDNIMDIMNSGKAEFEFDRPHIKAILM (0)

       DILMASMDTSA

349263 QHPKVMKNLQKE*EQVVGINRMVEESDLEKLDYLEMVIKEVFSLHPVGPLLIPHESIEDC 349084

349083 TIDGFDIPKGSRILVNSWATGRGPEVWSAPEFVPERFIGSNIDLLGRDFQLLPFGSG 348913

348912 RRNCPGLQLEFTIVCLVPAQLFHYLDWELPNGMKPNDLDMTEKFG 348778

348777 LVTYRAEHARVIPTYRLNVY* 348715

 

SL2.30ch03 17014053-17015900 (+) strand

 

>CYP736A55P CYP736A@23P scaffold06097 56% to CYP736A26 Vitis, 81% to pseudogene on scaffold06097 348-350 kb

IFQVLHNKFM

373249 KKKKKIPPGPKVLRIIGNLHMIDKNVHQDLYKIAKRYGPIMSMRFDLVPIIVASSPHAAE 373070

373069 QFLKKYDHIFASRPNNR &373019

ICAYNQRNMTFAKYGPYWRNM*KLCTLELLSTLKINSFQSMRKKEVRNFVTFINRAATSG

VEVDISAKVAPLNANMACLMIFGKKYMDDDFDK &

RGFKDVIQENMIITATPNIGEFFHFL &

DVFDLQGVVRRIKELAKVFDEFLERIIDEHIQDSKKEKK

KGEKTKDIVDTMMDIMNSGKAEFEFDRRHIKAILM (0)

372054 DMLMASMDTSPTSIDWIFSELISHPKIMKKLQKELEQVVGINRMVEESDLEKFEYLEM 371881

371880 VIKEGFRLHPIGQLLIPHESIED 371812

371816 ITIDGFDIPKGSRVIVNTWAIGRDPEVWSEPEKFVPKL & 371700

371699 LPFGSGRRSCPGLQLGLTTLHLVLAQLVHCFDWELLNGMNPNDLDMTEK 371553

371552 FILVMYRAEHARVIPTYRLNVY* 371484

 

SL2.30ch03 16991337-16993132 (+) strand

 

>CYP71AX15P CYP71AX@17P scaffold06183 66% to CYP71AX1

17087 YGEYWRQIRSVTVLHLFNNKRILSYSHVREEETSNMIEKISKECYSSSSVID & 17242

17244 LRDCFCSLTNNIVSRVALGRKYNDTEGGMNAKVTLDEFLKLLGTFSIGDYIPRLEWVNRI 17423

17424 TGLDTKVEKVAKDLNTFLESVIEEHISRHRKGEYSTKDFVDVLLEIQNGKETGFLL*RDS 17603

17604 MKAIIL (0) 17621

17793 DNFAGGTDTTYTALEWIMTELLSHPRAMEKLKNEVRGLAQGKAEVTEDDLGNMHYLKAVIKDT 17981

17982 LRLHPPIPLLVPQE*IEDINILGYHIVAETQFIINAWTIGRDPLSWENSEEYQ 18140

18137 PERFLNSPIDVKGLNFELIPFGAGRRGCPGNAFAVVMNELALARLVHKFNFALPEGLK 18310

18311 LEDLDMTEVSGIAIRRKSPLLAVATTWSI* 18400

 

SL2.30ch03 8223954-8225267 (-) strand

 

>CYP80M1 CYP80x@1 scaffold06183 51% to CYP80K1 Vitis, 54% to CYP80C1 Populus

309407 MEYYTLPASFLIFIPFFLLIFKQLVPKSTNLPPGPRPWHLLGNLLQIGKTPHVSLAKFAQ 309586

309587 IHGPLISVKLGTQLVVVASSPASAAEILKSQDRLLSVRSVPKVATYELSVIDQHSIVFSS 309766

309767 DLSNQWKFLRAFCRTHLFSPKAVESQAALREKKVSEMMNFLRSRKGETVKISEILFGTIL 309946

309947 NTLGNLFFSKDLCDLDYETNTSGIKHVIRKFVELGAMPNISEFYPLFDALDLQGLRKQTE 310126

310127 IYQNRLVNIWSEIVKEKRQAISRSSSDFLDAMIDNGFSDLQVDILLM (0) 310267

310390 ELISAGSDTTTSTIEWAMAELLRNKGAMRKLKAELASKLGE 310512

310513 NDIITESNVSELPYLAACVKETLRIHPPTPFLIPRRAPETCKIMDYTIPKNSKLFVNAWA 310692

310693 IGRDSNTWEDALSFRPERFLNSNVDFRGQDFEFIPFGAGRRICPGLGFARQEIQLILA 310866

310867 SLIHYFEWSLPNGEDPMQIDMKEKFGVTLQKEKSLLAVPK* 310989

 

>CYP80M2 CYP80x@2 scaffold06183 51% to CYP80E3, 53% to CYP80C1 Populus

86% to 80x@1, 91% to CYP80E.6P potato, 86% to CYP80E.1

315871 MEYYMLPPSFLIFIPLLFLIVKQFIPKSGNLPPGPRSWPLLGNILQIGKNPHISLAKFAQ 316050

316051 IHGPLISVKLGTQLVVVASSPASAAEILKTQDRLLSARSPPSVAPYELSVINQHSIVFSS 316230

316231 DLSNHWKLLRAFCRTHLFSPKAVESQTALREKKVSEMIHFLKSKKGETVMISEILFGTIL 316410

316411 NTFGNLFFSKDLCDLDHETKTSETKRVFRKFIELGAMPNISEFYPLLEALDLQGLSKQTK 316590

316591 MYQNQLINIWSQIVKEKRQAVNRRSSDFLDVMIDSGFSDLQINILLT (0) 316731

316907 ELISAGSDTTTSTIEWAMAELLRNKGAMHKLQAELTSKIGENDIITESNISDL 317065

317066 PYLAACVKETLRLHSPTPFLIPRRAPETCKIMDYTIPENSKLFVNAWAIGRDSNTWEDAL 317245

317246 SFRPERFLNSNVDFRGQDFEFIPFGAGRRICPGLGFARQEIQLILASLIHYFEWSLPN 317419

317420 GEDPMQLDMEDKFGVTIQKEKPLLIVPM* 317506

 

note: there is no CYP80N1 in tomato or pimpi but it is in potato

 

>CYP76A23Pv2 CYP76x@2P scaffold05529

44188-44400 (-) strand

54% to CYP76A.8, 57% to CYP76A@3

2 aa diffs to CYP76x@3P probable alleles

10861818 FLA*SETTSSSMAWVLTELLRLPEAI*RVKAVI & 10861720

10861718 TYFMQVVVKEPLRLHTLLSFLSPRRVMPNTNFMGYDISKNTQVLFDIWVICQVP 10861557

 

 

SL2.30ch00 10861557-10861818 (-) strand

 

>CYP76A23Pv1 CYP76x@3P scaffold06217

22362-22574 (+) strand

51% to CYP76A.8

21903810 FLA*SETTSSSMAWVLTELLRLPEAI*RVKAVI 21903908

21903910 MQVVFKEPLRLHTLLSFLSLRRVMPNTNFMGYDISKNTQV 21904038

21904039 LFDIWVICQVP 21904071

 

SL2.30ch06 21903810-21904071 (+) strand

 

>CYP71D201P CYP71D@41P scaffold06217

119619-120344 (+) strand

78% to CYP71D.76

MYFSLVTIVSLLLFLSFLVILFS

119619   KSKKQINLPPGPWTLPFIGSLHHLIGTGLLHRTLRNLAQRNGGVMYLQRGEISVVIIS  119792

119793   SPTIAKELLTTHDLAFSDRPPSMSTNIIFYNNKDIAFYP & 119909

119909   MRDNYWKQMRKICNVQRWSSPLVR  119980

119968   SFGAIRKDEISNPVSSIRYMRGSPINITEKIFWFTNSVTCSAALGKMFKDRDEF  120129

120130   IKLLKDIFILVSGFNVADLFPFLEVLRKLSGTES  120231

120225   RIHKKVDEIMEDILKEHLENKGNGDQFGGEDLVDVLLRVME  120344

ESAITNDHMKVVIL (0)

 

 

SL2.30ch06 22001076-22001917 (+) strand

Added N-term and extended C-term to an intron

 

>CYP71D201P CYP71D@42P scaffold06217 63% to CYP71D50v1, pseudogene

127120 TIMAKAQKEVR*IFRMMK 127173

127167 DEENLEKLT*LNLMIKEKIR*HTPVPLLPPREFREQTHIDGWTIPLKTRILVNAWALARD 127346

127347 PESWHDPESFIPKRFENCFIDFTGNHFEFIPVGAGIRICPKILFGLFNVKLPLAHLLY 127520

127521 HFEWELPYGMNPKDLDMTETHGLSMIKYK  22008288

 

 

SL2.30ch06 22007795-22008282 (+) strand

join

 

>CYP71D200P CYP71D@43P scaffold06819

718420-720705 (-) strand

CYP71D pseudogene

51% to scaffold05575

720705   MYSSLFTIVSLVIFFLYFILVSKNKK &

720667   KKETRLPPGPWRLPFI*SLHHLIGRGFLHPT  720535

720534   LRNLAQRYGGVMYLQIGEIPVVIVSSSTIAKQLLTTHDLAFSDRPQSTSTTILFYNNKDI  720355

720354   VFSLYDNYCKQMRKICKV & 720301

720299   QLFSTKMVKSFSTIRKDEISSLISSIRSTKGSPVNMTEKIFWFTNSVTCSAAFGKMFK  720126

720125   DRDEFIKLLKDILILASGFYVTDLFPSWKLLHKLSGAESRLMNVHKKIDEIMEDILKEHL  719946

719945   ENKANRNKRIGDQLGGEDLVDVLLNLMEDAELECPITNDHIKAVIL (0) 719808

         DVFIAESDTSSTVTIWV &

718883   MMKNPNIMAEVREVFRGKKNYDDEEDLEKLTYLKLVIKETLRLHTPAPLLGPRD &  718722

718720   QTNVDGYTIPLKTKVLINKNPESFIPERFDFMENHFEFIPFGAG  718589

718588   RRMCPGMLFGLTNIELPLAQLLY & 718520

718518   HFEWELPYGMNPKDLNMTETCGLGGWKQKDCF*  718420

 

SL2.30ch06 20691639-20693924 (-) strand

 

>CYP80F3 CYP80x@3 scaffold06819 51% to CYP80K1 Vitis, 57% TO CYP80F1

1636191 MMYYLITPILLSLVFVITLRYFYRSKTKLPLPPGPFSWPFIGNLFHVGRKRPHASLAKLA 1636370

1636371 QSHAPDLMSLRFGTRLVVVASSPAAAAAVLKTHDRLLSGRFVSHPIRVEGSKLHNVSTAF 1636550

1636551 LEECDENWKNVRTIYRGALFSNKALESQVSLRENKIREMMQYLDTKMGQVIKIKFVVFVT 1636730

1636731 ALNVLANLLLSVDLIDFEGKGIGAGLTEYLRKFTEAGGILELSDLYPVLGILCTDLQGTY 1636910

1636911 KKLIGMFDTICAVWGDIVQDKRKRDSQPSLDSVDFVDALVKNGFTDKHVNALLL (0) 1637072

1637166 EIFAAGTESTTATSEWMLVELLRKPQALQKLRDEISQVVGGSKGIIKESDLPSLPYLDAC 1637345

1637346 FKETLRLHPPGPLLLPHRAVQTCEVMGYRIPRNTQVLVNMWAIARDSKIWDDPSSFKPER 1637525

1637526 FINSKFDNKGQKFEYIPFGSGRRICAGEPLASRFIPLAVASLIHKFDWILP 1637678

1637679 NEIDPAKINMDEVLDVTMFKKDSLLVIPKLRNV* 1637780

 

SL2.30ch06 21596360-21597949 (+) strand

 

>CYP80F4P CYP80F@1P scaffold06819

1742025-1742396 (+) strand

94% to CYP80F.1 potato (ortholog) 58% TO CYP80F1

21704860   QITETCEVMGYRIPKDTQLMVNMWAIARDPKVWDDPSSFKPERFMNSNMDYKGRYFEYIPFGS  1742204

1742205   GRRMCAGEPLASRFVPLLVASMIHKFDWFLPNDMNLDQIDMDEILDLIISKKDPILVIPKLRK*  1742396

 

SL2.30ch06 21704860-21705240 (+) strand

 

>CYP80F2P CYP80x@4P scaffold00934

52% to CYP80x@3, 55% to CYP80F.2 potato, 57% TO CYP80F1@P

MSKTGEDIFSITLQFYLNI

3431771   FLVITFKYLFSLSKKLPLPPAPFSWPLIGNIFQVDRRRPHAS

3431644   LAKLAQVHAPDLMSIRFSTRFVVMASSPVVAAEVLKTNYRMLSGR  3431510

          TIPFSFILSPGMETSQFFT

3431420   QSLRNVMIIGKVFRAELFNSKAKVSMR*KKIAEMMQHLVVKQGQVVKIRGRGVCDN  3431253

3431252   FQCNWFNLILSKDLMDYEGNGVG  3431184

3430724   ARDPKNWDDSNSKYLSIQKGRYFKSIPCGSGRRVCVGF  3430611

3430618   LASRFVPLVVASLIHGFDWIFPNDMDPAHIHRNEILVITMFKNGPLDLVIPK  3430463

LRKKVREFFIFFG*

 

SL2.30ch06 21557310-21558717 (+) strand

Added N-term

Solyc06g035730.1.1    SL2.30ch06    21557485    21558905    +    2    Cytochrome P450 (AHRD V1 *-*- B9I4D1_POPTR)

 

>CYP86B12 CYP86B@1 scaffold06498 72% to CYP86B1 Arab. 94% to CYP86B.1

previously CYP86B11 but that is a soybean seq

4554573 MLITATTNNIFYHLNLMNTTFTSINMTCSSSSLEHLSLFLW

4554450 PHIQIMEIFIALVVFIAIHSLRQAKKQGLPNWPFVGMLPSLILGLRKDMYEWISDVLCHM 4554271

4554270 NGTFTFRGPWFTNLNCVVTSDPRNLEYLLKTNFSNFPKGDYFRNTVRDL 4554124

4554123 LGDGIFNADYDIWQKQRKPASIEFHSAKFRNMTADSLLELVHSRLLPVLEDSIKQSIPID 4553944

4553943 LQDVLLRLTFDNVCMIAFGVDPGCLHPHLPQIPFAKAFELATEATVLRFVTPTLVWKTMR 4553764

4553763 CLGLGTEKTLKHSLKKVDEFADEVIRTRKKELCLADSKQRSDLLTVFMGLRDEQGQPFSD 4553584

4553583 KFLRDICVNFILAGRDTSSVALSWFFWLLDRNPEVEQRILAEICKILNERGDAIDE 4553416

4553415 TPLIFKPAEIKKMEYLQAALSEALRLYPSVPVDHKE (0) 4553308

4553227 VVEDDVFPDGTVLKKGTKVVYAIYTMGRMEGIWGKDCREYKPERWLRDGRYMSEPAY 4553057

4553056 RFTAFNGGPRLCLGKDFAYYQMKFTAASILYRYHVKVVKGHPVMPKLALTMYLKYGLQVK 4552877

4552876 LSRRDQSQLPLNNNNYFL* 4552820

 

>scaffold02053 N-term of 79A@5P

212923   VIIPELACEFLKSQDSISHLHVQFLSKVVKKILTCHVLSP  213042

213043   TSFHRLVYNQCSNNQLVINLRKVTSWYHCGNEYDF  213147

213148   QQEIMRNKLMQFLNLLNICLNILFDLDGHKAMQLSRKHMIKQQNILILKLIRGF  213309

213310   KYGKMANKKTLEEDILDVLIMIKDTN  213387

 

>CYP79A51P CYP79A@5P scaffold07059

283250-283594 (+) strand

77% to scaffold03496 CYP79A

scaffold02053 ver 1.03

N-term part of CYP79A@5

4547577 KIMEEKNTEIACI

212923   VIIPELACEFLKSQDSISHLHVQFLSKVVKKILTCHVLSP  213042

213043   TSFHRLVYNQCSNNQLVINLRKVTSWYHCGNEYDF  213147

213148   QQEIMRNKLMQFLNLLNICLNILFDLDGHKAMQLSRKHMIKQQNILILKLIRGF  213309

213310   KYGKMANKKTLEEDILDVLIMIKDTN  213387

283250   YFIPKGSIVLLSRLGLGQNFRVWKESLKFKPKCHLKVEDDDELVLTDSNLHLLSFSIGRR  283429

283430   GCPAVKLVQQLLARLLQGFTWALPSNSPCNDLIESSKINHFSTLPPRLAKVMYL*  283594

 

SL2.30ch07 4546583-4547577 (-) strand

 

>CYP71D207-de1b2b CYP71D@44P scaffold07059

2641207-2641350 (-) strand

2641350   ISGMKSKLMKARNKIDILLDNIINVHRENRANRKNCNGESETEDLIDI  2641207

 

2170210 MEFHHIISFSLF &

SKTFLHG

2170268 ISGMKSKLMKARNKIDILLDNIINVHRENRANRKNCNGESETEDLIDI 2170411

 

SL2.30ch07 2170210-2170411 (+) strand

 

>CYP71D207 CYP71D@45 scaffold07059 77% to CYP71D50v2

2645669 MEFHHVVSFSLFIFFLFLTIQNWSRNSKILKK

2645573 KLPPGPWRLPIIGSVHHLTRGTPHRVLRNLSQKYGPIMYLQLGEVPTIVVSSQHMAKQIL 2645394

2645393 KTHDLAFASRSVTMLGKIICYNCKDIAFSPYGDYWRHMRKLSVLELLSAKMVKSFSSIRY 2645214

2645213 NELSNLLSSIGSTVGSPINLS & 2645151

2645149 KKLFLFTNASTCRSIFGKTYKNQNELVMLIQRAVSLSRGFELADLYPSKTFLHGISGMKS 2644970

2644969 KLMKARTKVDMLLDNMINVHRENRANGKNCNGESVTEDLIDVFLRVMESGEFQFPLTNDN 2644790

2644789 IKAIIL (0) 2644772

2644703 DMFVAGSETPCSTAIWALSEMMKSPSVIAKAQAEVREVFKGKETCNDDTVLEK 2644545

2644544 LNYLKLVIKETLRLHPPTPLLVPRECREETKIDGFTVPLKSKVLVNVWAIGRDPMSWEKP 2644365

2644364 ECFVPERFENSSIEFTGNHFQFLPFGAGRRMCPGIHFGIALVTLPLAYLLYKFDWKLP 2644191

2644190 QGTNLREFDMTKSNGITARRENDLYLIATHSY* 2644092

 

>CYP97A29 scaffold04168 77% to CYP97A3 Arab.

1994665 MASSLPLFQFPTHHYSKSRLTLSPKFKGSVSNFTIRCSNSNGKQPESVDEGVKKVEKLLD 1994844

1994845 EKRRAELSARIASGEFTVEQSG (2) 1994910

2004257 FPSLLKNGLSKLGVPKEFLEFFSRRTGNYPRIPEAKGSISAIRDEPFFMPLYELYLTYGGIFR 2004445

2004446 LIFGPK (0)

2004564 SFLIVSDPSIAKHILKDNSKAYSK (0) 2004635

2004748 GILAEILDFVMGKGLIPADGEIWRVRRRAIVPALHQK (0) 2004858

2005053 YVAAMIGLFGKATDRLCKKLDVAATDGEDVEMESLFSRLTLDIIGKAVFNYDFDSLTVDT 2005232

2005233 GIVE (0)

        AVYTVLREAEDRSVAPIPVWE 2005412

2005413 LPIWKDISPKLKKVNAALKLINDTLDDLIAICK (0) 2005511

2007475 RMVDEEELQFHEEYMNEKDPSILHFLLASGDE 2007570

2007648 VSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSK (0) 2007749

        EPSVMAKLQDE (0)

        VDSVLGDRLPTIEDLKKLRYTTRVINE (0)

        SLRLYPQPPVLIRRSIEEDVVGGYPIKR (2)

2009257 GEDIFISVWNLHRCPNHWEEADRFNPERWPLDGPNPNETNQNFS (2) 2009388

2010402 YLPFGGGPRKCVGDMFATFE (0)

2010570 NLVAVAMLVQRFDFQMALGAPP (0)

2010747 VKMTTGATIHTTEGLKMTVTRRSRPPIVPNLEMATLEVDVNSVSSDRAEAEASTVRP* 2010920

 

>CYP97B22 CYP97B@1 scaffold02484 83% TO CYP97B15 Vitis DB718119.1

6134620 MATGFCSSITCLVLNRRSDSIFRHFPSSYPTSWSTQKRSSIR 6134745

6136017 TMKCRCQSTGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLK (0) 6136211

6136930 YGSVYKLAFGPKAFVVVSDPIVARHILRENAFSYDK (0) 6137037

        GVLAEILEPIMGKGLIPADLDTWKQRRR (1)

6139173 VIAPGFHSSYLEAMAKVFTECADRTMLKFDKLIEQEESGGGKLIELDLETEFSNLALDII 6139352

6139353 GLGVFNYDFGSITKESPVIK (0) 6139412

AVYGTLFEAEHRSTFYIPYWNIPLARWIVPRQRKFQSDLKVINDCLDGLIKNAKETRQ (0) 6139834

ETDVEKLQQRDYLNLK (0)

DASLLRFLVDMRGVDVDDRQ (0)

LRDDLMTMLIAGHETTAAVLTWAVFLLAQ (0)

HPVKMKKAQSEIDAVLGQGRTTFESLRKLE (2)

YLRLIVVESLRLYPQPPLLIRRSLTSDILP (1)

GGYNGDKNGYEIPAGTDVFLS (0)

VYNLHRSPYFWDKPNEFEPERFLVQKESQGIEGWGGFDPSRSPGALYPNE (0)

IISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI* 6143064

 

>CYP97B23P CYP97B@2P scaffold05126 97% to scaffold02484 CYP97B,

with 2 frameshifts = & and one bad boundary (no GT in phase) (pseudogene)

5085327 MATGFCSINTCLVLNRRSDSIFRHFPSSYPTSWSTQKRSSIR (2) 5085202

        TMKCRCQSTGTDEPKTKVHSFDNASNLLTNLL &

                                  SGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLK (0) 5083737

5083019 YGSVYKLAFGPKAFVVVSDPIVARHILCENAFSYDK (0) 5082912

        GVLAEILEPITGKG &

                     LIPADLDTWKQRRR (1)

5077476 AIAPGFHSSYLEAMAKVFTKCADRTMLKFDKLIEQEESGGGKLIELDLETEFSNLALDII 5077297

5077296 GLGVFNYDFGSITKESPVIK (0) 5077237

5072341 AVYGTLFEAEHRSTFYIPYWNIPLARWIVPRQRKFQSDLKVINDCLDGLIQNTKETRQ (0) 5072168

ETDVEKLQQRDYLSLK (0)

DASLLRFLVDMRGVDVDDRQ (?)

LRDDLMMMLIAGHETTAAVLTWAVFLLAQ (0)

HPVKMKKAQSEIDAVLGQGRTTFESLKKLE (2)

YLRLIVVESLHLYPQPPLLIRRSLTSDILP (1)

GGYNGDKNGYEIPAGTDVFLS (0)

5069380 VYNLHRSPYFWDKPNEFEPE (0) 5069321

5069322 RFLVQKESRGIEGWGGFDPSRSRGALYPNE (0)

        IISDFAF 5069143

5069142 LPFGGGPRKCVGDQFALMESTIALAMLLQKFDVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI* 5068942

 

SL2.30ch11 30037212-30053163 (+) strand

 

>CYP97C11 scaffold01435 75% to CYP97C1 Arab.

1968824 MPVSVTISSFSLLTDTHHRTTVIRPKNPLQNRSQLTIKSSIDNKKPPSTKPTSWVSPDWL 1968645

1968644 TKLTRSLTLGQNDDSNIPIASAELDDVSELLGGALFLPLYRWMNLYGPIYRLAAGPRNFV 1968465

1968464 IVSDPAIAKHVLKNYGKYGKGLVAEVSEFLFGSGFAIAEGPLWT (0) 1968333

1967332 ARRRAVVPSLHKKYLSVIVDRVFCRCAERMVEKLLPDAISGSAVNMEAKFSQLTLDVIGL 1967153

1967152 ALFNYNFDSLTTDSPVIDAVYTALKEAELRSTDLLPYWQ (0) 1967036

1966952 IKALCKFIPRQIKAENAVSLIRQTVEELIAKCREIVETEGERINEDEYVNDRDPSILRFL 1966773

1966772 LASREE (0) 1966755

1966415 VSSLQLRDDLLSMLVAGHETTGSVLTWTAYLLSK (0) 196634

1965274 DPSSLEKAHEEVDRVLGGRSPTYEDMKNLKFLTRCITESLRLYPHPP (0) 1965134

1965050 VLIRRAQVADVLPGNYKVNVGQDIMISVYNIHHSSE (0) 1964943

1964770 VWDRAEEFDPERFDLEGPVPNETNTDFR (2) 1964687

1964600 FIPFSGGPRKCVGDQFALLEATIALAIFVQNFSFELIPDQTISMTTGATIHTTN (0) 1964439

1964343 GLYMKVKQREKVSVLAAAP* 1964284

 

>CYP710A11 scaffold03187 4 aa diffs to AB223043, 60% to CYP710A Arab.

3280751 MASIWGLLSPWIPYFISFIAFLLLLEQISYIKKKRFLPGPTLVFPFLGNVIPLVTNPTKF 3280930

3280931 WDLQSALAKSTSHGFSVNYIIGKFILYIHSTDLSHKVFANVRPDAFHLIGHPFGKKLFGE 3281110

3281111 HNLIYMFGQEHKDLRRRIAPNFTPKALGTYTDIQQRIIIKHFKSWLDEASKSPNTPIPLR 3281290

3281291 LLCRDMNLDTSQTVFVGPYLDGESRKRFNVDYNYFNVGLMKLPVDLPGFAFRNARLAVGR 3281470

3281471 LVDTLSVCVEQSLNKMKNEEEPTCLIDFWMQENLREINEAKINGLQKPFQYSNKELGGYL 3281650

3281651 FDFLFAAQDASTSALLWAIVLLDSHPQVLEKVRSDVARFWSPESEEPLTAEMLREMKYLE 3281830

3281831 AVAREIIRIRAPATMVPHIAGEEFRLTEDYVIPKGTIVFPSVFDSSFQGFPEPEKFEPDR 3282010

3282011 FMEERQEERVYKKNFLAFGAGPHACVGQKYAINHLMLFIAMFTALIDFKRHKTDGCDDIS 3282190

3282191 YIPTIAPKDDCKVFLAHRCTR* 3282256

 

>CYP71AX16P CYP71AX@1P scaffold02302 = C08.17_contig19 161 kb, 64% to CYP71AX1, pseudogene

LFCNGLVV

7885213 DSLCTTLEWIMIELLRNRRAMEKLQNEVRGLAQGNVEITEDDLGNMQYLKAIIKESIRL & 7885389

7885398 VPIPVPRESMKGVKLLDYDKPTKSQVLINVWAIERDPLS*DEPEVYRPKRFLNSNIDFR* 7885577

7885578 LNFQLIPFEAGRWGCPGISFAIVIIELALTSLVNEFNFALPKGMKRE 7885733

NLNMSECT

 

 

SL2.30ch08 49024001-49024545 (+) strand

Revised C-term

 

>CYP71AX1 Lycopersicon esculentum (tomato)

         GenEMBL BT012875.1

         52% to CYP71AQ1 cottonwood

YFLLVPLLAFIYFLHQCFFSPSNTQKRLLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKY

GPVMLLHLGSKPVIIASSVDAARDIMKTHDLVWSNRPKSSMADGLFYGSKDVTFSPYGEY

WRQIRSITVLHLLSNKRVQSYRRVREEEISNMIDKIRQKCDSVIDLRDVFSCLANNIISR

VNIGRTYNEGECGIAVKSLIEELLILIGTFNIGDYTPWFKWVNKIKGVDSRVKKVAKDLD

AFIESVIEERLIRNKKAECSAVEAKDFLGVLLEIQDGKETGFPLQRDSLKALLLDAFVAG

TDSTYTVLEWTMTELLRHPRVMTKLEDEVRELGQGKTEITEDDLRNMHYLKAVIKESLRL

HAPVPLLVARESMEEVKLLDYDIPAKTEVLINAWSIGRDPLLWDHPEEYMPERFLSSDID

VKGLNFELIPFGAGRRGCPGIPFAIMVNELALANLVYKFNFALPKGIKGEDLDMTECNGL

AVRRKSPLLVVATPKSMV*

 

>CYP711A21 scaffold02302 73% to CYP711A1 Arab.

8439094 MMFLSSAIQESPIASTIFTILAGVLVYLYRPYWRVRKVPGPPAFPLVGHLPLMAKYGPDVFSVLAKQYGPIYR (2) 8438876

        FHMGRQPLVIVADAELCREVGIKKFKDIPNRSIPSPIAASPLHQKGLFFTR (2)

        DSRWSTMRNTILSVYQPSYLAKLVPIMQSYIESATKNLDSEGDLTFSDLSLKLATDVIGQASFGVDFGLSKPISD 8438348

8438347 KMSHHQDDSEVQEFIKQHIYSTTQLKMDLSGSVSIILGLLVPILQEPFRQVLKRIP 8438180

8438179 GTMDWKVERTNKNLSSRLDEIVAKRIEEKDRSSKDFLSLIMQARESEKLAKNVFTSDYIS 8438000

8437999 AVTYEHLLAGSATTSFTLSSIIYLVACHPEVEQKLLAEIDAFGPDDNMPTANDLQQKFPYLDQ (0) 8437811

        VIKEAMRCYIVSPLVARETSAEVEIGGYKLPK (0) 8437586

8437431 GTWVWLALGVLAKDPKNFPEPEKFKPERFDPNCAEEKQRHPYANIPFGIGPRACIGQKF 8437255

8437254 SIQEIKLSLIHLYRKYIFQHSPLMESPLELEYGIVLNYKHGVKVHAIKRK* 8437102

 

>CYP711A32P CYP711A@1P scaffold05597

2016996-2017217 (-) strand

55% to CYP711A21

2017217 KFKDIPHRTIPSSVAVLPS*KLISLTRTRLMLC*LYMDSRWSTTMRNTILFVYQPSHLVK

LLSTMQHYIDFVTK 2016996

 

SL2.30ch05 35909575-35909796 (+) strand

 

>CYP79A32 scaffold02302 C08.17_contig26 257-259 kb, = CYP79A32 tomato

12836773 MFFFKISNLVDLLFRIFIFIVLKITNLWNSLIIIMRKTSSLPPGPKPWPIIGNFPQMLLN 12836952

12836953 KEPPFHWIHKMMEKMNTEIACIRLGNIHVITVTSPELAREFLHTQDSIFSSRPICMSASL 12837132

12837133 INNGYLTPIFAPMGDQWKKMRRILASHVLSPTSLEWIRSKRDEEADNLHRFIYNQCENQS 12837312

12837313 IINLRNLTRYYCGNVIRNMTFSKPFFDITEEDRDEQVDAVFTLLKYLHALGILDYLPWLS 12837492

12837493 VFDLNGHKKIINNAYVTATKDMDVEVDQRIQIWKDGKKTMEEDILDVLITLKDTNGNALL 12837672

12837673 SAKEIKAQVL 12837702

12837830 ELMLAALDNPSNAVEWVIAEMLNQPKLMQKALEELNTVVGINRLVQESDLPMLNYVKACI 12838009

12838010 KEAFRLHPITPFNVPHVSISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPER 12838189

12838190 HLIEDGVGGEVVLTDSKLRLLSFSTGRRGCPGVKLGSTIATMLLARLLHGFSWSLPPNST 12838369

12838370 CNDLIVSSKIDPFDTLPLLAKAKPRLAKAMYP* 12838468

 

SL2.30ch08 54022287-54023982 (+) strand

54022287 MFFFKISNLVDLLFRIFIFIVLKITNLWNSLIIIMRKTSSLPPGPKPWPIIGNFPQMLLN 54022466

54022467 KEPPFHWIHKMMEKMNTEIACIRLGNIHVITVTSPELAREFLHTQDSIFSSRPICMSASL 54022646

54022647 INNGYLTPIFAPMGDQWKKMRRILASHVLSPTSLEWIRSKRDEEADNLHRFIYNQCENQS 54022826

54022827 IINLRNLTRYYCGNVIRNMTFSKPFFDITEEDRDEQVDAVFTLLKYLHALGILDYLPWLS 54023006

54023007 VFDLNGHKKIINNAYVTATKDMDVEVDQRIQIWKDGKKTMEEDILDVLITLKDTNGNALL 54023186

54023187 SAKEIKAQVL (0) 54023216

54023344 ELMLAALDNPSNAVEWVIAEMLNQPKLMQKALEELNTVVGINRLVQESDLPMLNYVKACI 54023523

54023524 KEAFRLHPITPFNVPHVSISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPER 54023703

54023704 HLIEDGVGGEVVLTDSKLRLLSFSTGRRGCPGVKLGSTIATMLLARLLHGFSWSLPPNST 54023883

54023884 CNDLIVSSKIDPFDTLPLLAKAKPRLAKAMYP* 54023982

 

>CYP74B3 scaffold04722, 1 aa diff to CYP74B3v3

215140 MNSAPLSTPAPVTLPVRSIPGSYGLPLVGPIADRLDYFWFQKPENFFTKRMEKHKSTVFR 214961

214960 TNVPPCFPFFGSVNPNVVAVLDVKSFSHLFDMEIVEKANVLVGDFMPSVVYTGDMRVCAY 214781

214780 LDTSEPKHAQ (0)

210224 IKNFSQDILKRGSKTWVPTLLKELDTMFTTFEADLSKSNTASLLPALQKFLFNFFSLTI 210048

210047 LGADPSVSPEIANSGYIFLDSWLAIQLAPTVSIGVLQPLEEILVHSFAYPFFLVKGNYEK 209868

209867 LVQFVKNEAKEVLSRAQTEFQLTEQEAIHNLLFILGFNAFGGFSIFLPTLLGNLGDEKNA 209688

209687 DMQEKLRKEVRDKVGVNPENLSFESVKEMELVQSFVYETLRLSPPVPSQYARARKDFKLS 209508

209507 SHDSVYEIKKGELLCGYQPLVMKDPKVFDEPEKFVLERFTKEKGKELLNYLFWSNGPQTG 209328

209327 RPTESNKQCAAKDMVTLTASLIVAYIFQKYDSVSFSSGSLTSVKKAS* 209184

 

>CYP74A1 scaffold02164 3 aa diffs to CYP74A1

1912314 MASTSLSLPSLKLQFPSHTSSSSRKNS

SSYRVSIRPIQASVSEIPPYISSPSQSPSSSSSPPVKQAKLPAQKVPGDYGLPLVGPWKD

RLDYFYNQGKNEFFKSRIQKHQSTVFRTNMPPGPFISFNPNVVVLLDGKSFPVLFDVSKV

EKKDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAKLKKLMFYLLSSRRNEVIPEFHNSYS

ELFETLENELSTKGKAGLNAANDQAAFNFLARSLYGINPQDTELGTDGPKLIGKWVLFQL

HPLLILGLPKVLEDLVMHTFRLPPALVKKDYQRLYNFFYENSTSVLDEAEKIGISREEAC

HNLLFATCFNSFGGIKIFFPNMLKWIGRAGAKLHSQLAQEIRSVISSNSGKVTMAAMEKM

PLMKSVVYESLRIEPPVASQYGRAKHDMVIESHDASFEIKEGELLYGYQPFATKDPKIFD

RSEEFVADRFIGEEGEKLLKHVLWSNGSETENASINNKQCAGKDFVVLVSRLLLVELFLR

YDSFEIEVGASPLGAAITLTSLRRASF* 1910713

 

>CYP74A2 scaffold06004 no introns 100% to CYP74A2

1341106 MALTLSFSLPLPSLHQKIPSKYSTFRPIIVSLSDKSTIEITQPIKLSTRTIPGDYGLPGIGP

WKDRLDYFYNQGKNDFFESRIAKYKSTIFRTNMPPGPFITSNPKVIVLLDGKSFPVLFDA

SKVEKKDLFTGTFVPSTELTGGYRILSYLDPSEPNHEKLKKLMFFLLSSRRDHVIPEFHE

TYTELFETLDKEMEEKGTVGFNSGSDQAAFNFLARSLFGVNPVETKLGTDGPALIGKWIL

LQLHPVITLGLPKFLDDVLLHTFRLPPILVKKDYQRLYDFFYTNSANLFIEAEKLGISKD

EACHNLLFATCFNSFGGMKIFFPNMLKSIAKAGVEIHTRLANEIRSEVKSAGGKITMSAM

EKMPLMKSVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEILFGYQPFATKDPK

IFDRPGEFVADRFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEF

FLRYGTLNVDVGTSALGSSITITSLKKA* 1339574

 

>CYP74C3 scaffold05603 100% to CYP74C3

MANTKDSYHIIT

363940 MDTKESSIPSLPMKEIPGDYGVPFFGAIKDRYDFHYNQGADEFFRSRMKKYDSTVFRTNV

PPGPFNARNSKVVVLVDAVSYPILFDNSQVDKENYFEGTFMSSPSFNGGYKVCGFLGTSD

PKHTTLKGLFLSTLTRLHDKFIPIFTTSITSMFTSLEKELSEKGTSYFNPIGDNLSFEFL

FRLFCEGKNPIDTSVGPNGPKIVDKWVFLQLAPLISLGLKFVPNFLEDLVLHTFPLPYIL

VKRDHQKLYNAFYNSMKDILDEAEKLGVKRDEACHNFVFLAGFNSYGGLKVFFPSLIKWI

GTSGPSLHARLVKEIRTAVKEAGGVTLSAIDKMPLVKSVVYETLRMDPPVPFQTVKARKN

IIITNHESSFLIKKDELIFGYQPLATKDSKVFKNAEEFNPDRFVGGGEKLLKYVYWSNGK

EIDNPSVNDKQCPGKDLIVLMGRLLVVEFFMRYDTFEVEFGKLLLGSKVTFKSLTKATS* 365379

 

SL2.30ch10 2121096-2122571 (-) strand

 

>CYP74D1 scaffold05477

220637 MSSYSELSNLPIREIPGDYGFPIISAIKDRYDYFYNQGEDAWFHNKAEKYKSTVVKINMAPGPFTS 220834

220835 NDYKLVAFLDANSFVCMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFIDTKDPNHAALK 221014

221015 GYILSSFAKRHNLFIPLFRNTLSDHLFNNLEKQVTEQGKADFNALLPTMTFDFIFRLLCD 221194

221195 QKNPSDTVLGAQGPEHLRKWLFPQLIPSLSAKKLPNIIEDMLFHNFLIPFGFIKSDYNK 221371

221372 LVDAFSKSAVSMLDEAEKLGIKREEAVQNILFLVGINMFAGLNAFFPHLFR (2) 221524

221673 FVGEAGASLHTQLAKEIRSVIKEEGGAITLSAINKMSLVKSVVYETLRLRPPVPLQYGKAKKE 221861

221862 FMVQSHDASYKINKGQFVVGYQPMASRDPKIFANPDEFVPDRFMNDGEKMLKHVLWSNG 222038

222039 RETESPAPDNKQCPGKDLVHLLGRLILVEFFIRYDTFTLEITPLFRAPNVAFNTLTKASK* 222221

 

>CYP74C4 scaffold05477 1 aa diff to CYP74C4 AF461042.1

233311 MSSVSSKYPAIASSSDNESCKPL

233380 LQVREIPGDYGFPFFGAIKDRYDYYYSLGADEFFRTKSLKYNSTIFRTNMPPGPFIAK 233553

233554 DPKVIVLLDAISFPILFDCSKVEKKNVLDGTYMPSTDFFGGYRPCAFLDPSEPSHATHKG 233733

233734 FYLSIISKLHTQFIPIFENSVSLLFQNLEIQISKDGKANFNDISDAMSFDFVFRLLCNNT 233913

233914 NPLDTKLGTTGPKCFDLWMLPQLAPLVTLGLKFVPNFLEDLMLHTFQLPFFIIKSKYQK 234090

234091 LYDAFNEHAGSTLDDAEKSGIKRDEACHNLVFLA (1) 234192

234400 GFNAYGGMKILFPSLMKWVASGGKSLHTPLANEIRTIIKEEGGSITL 234540

234541 SAINKMSLVKSTVYEVLRIEPPIPFQYGKAKEDIMVQSHDSNFLIKKGEMIFGYQTFATK 234720

234721 DAKIFENPEEFIAERFMGSEGEKLLKYVYWSNARETDSPTVDNKQCAGRDLAVLLCR (2) 234891

234981 LLLVEFFMRYDTFTVESSKYLAGPLITFKTLEKKAI* 235091

 

>CYP74C27 CYP74C@1 CYP74Cxx scaffold05477 84% to CYP74C4, 59% to CYP74C3

240969 MSSFCSKSPAISNCSNDEYSNS

241035 SLPVGEIPGDYGFPFFGAIKDRYDYFYNLGTDEFFRTKSRKYNSTVFKTNMPPGPFIAK 241211

241212 NPKVIALLDSKTFPILFDNSKVEKKNVLDGTYMPSTNFFGGYRPCAFLDPSEPKHARLK 241388

241389 GFYLSIISKYHTQSIPIFETSVSALFQNLEIQISKNGKANFNDISDAMSFDFVFRLLCDK 241568

241569 TTRNVGPKYFDKWMLPQLVPLVTLGLKFVPNFMEDLILHTFPLPFCLVKSNYQ 241727

241728 KLYDAFSEHAGSILSEIEKSGIKRDEACHNLVFLS (1) 241832

242425 GFNAYGGMKVVFPSLIKWVASAGKSLHTRLANEIRTIIKGEGGSITLSSVNKMSLV 242592

242593 KSTVYEVLRIEPPLPFQYGKAKQDIMVQSHDSNFLIKKGEMIFGYQTFATKDAKIFENPE 242772

242773 EFIAERFMGSEGEKLLKYVYWSNARETDDPTVDNKQSPAKDLVVLLCR (2) 242916

242988 LLVVEFFMRYDKFTVESNKFLFGSSVTFKTLDKKTT* 243098

 

>CYP75B49 scaffold02749 = C03.12_contig18 180-185 kb, = M01000000040,

76% to CYP75B32v3 Vitis also sent by Alain Hehn 1/8/2010

762407 MAIFFLILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWP

762530 IIGNIIQLGPKPHQSTASMARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRP 762709

762710 PNSGAKHMAYNYHDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQ (0) 762856

       EEVRTLTRALANAGQNPIKLGQLLNVCTTNALARVMLGKRVFADGTNGMDPQAEEFKLM

       VVEMMVLAGVFNIGDFIPALDWMDIQGVAEKMKKLHARFDAFLTTILEEHKEKRVGESKE

       QGDLLNTLISLKNEEDDNGGKLTDTEIKALLL (0)

       NLFIAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGKNRLVMESDLA

767110 QLTYLEAIVKEIFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLVNVWAIARDPNQWAD 767289

767290 PIEFRPERFLPGGEKPKVDVKGNDFEVIPFGAGRRICPGMSLGIRMVQLMTATLIHSFNW 767469

767470 ALPTGQLPDKLNMEEAFGLTLQRADPLVVHPIPRLEAQVYGG* 767598

 

SL2.30ch03 59055264-59060452 (-) strand

 

>CYP78A75 CYP78A@2 scaffold02749 = C03.12_contig19 56 kb, 75% to CYP78A41 Vitis

974112 MYPEYSLLFIPSTVVLNLELLLFFLLFFAVFAFWLTPGGLAWSFSKARVSIPGPSGLPLL 974291

974292 GLVLTFTGSLTHRMLAKLSNGLKAESLMAFSVGFTRFIISSNPETAKEILGSSAFADRPV 974471

974472 KESAYELLFHRAMGFAPYGEYWRNLRRISATHLFSPKRIACFGDFRREIGSKMVTEIASL 974651

974652 METDGHVKVKRVLHFGSLNNVMKTVFGKTYDFHEEDGRELEYLVSEGYELLGIFNWSDHF 974831

974832 PLLGWLDLQGVRRRCKELVARVNTFVGKIIEEHRLNRVINAGNAADEDFHDFVDVLLDLE 975011

975012 KENKLSDSDMIAVLW (0) 975047

975450 EMIFRGTDTVAILLEWILARMVLHPDIQTKVQSEIDAEVGTDRAVCDSDLPNLQYLQA 975623

975624 IVKETLRVHPPGPLLSWARLAIHDTSVGHHFIPAGTTAMVNMWAITHDEKIWSQPEEFMP 975803

975804 ERFLEEDVSIMGSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQLLQEFKW 975953

975954 FPSDKNNVDLSECLKLSLELNQPLICKAVSRVH* 976055

 

>CYP71AU32 CYP71AU@1 scaffold02749 = C03.12_contig13 92-94 kb, no introns 96% to CYP71AU2 tomato

3154401 MISSFADFFFLFFLSFVLLSFF

3154335 RLSSKKSKKNLPPSPPKFPFIGNFHQLGQQPHRSLQKLTNEYGPMMMLQFGSVPVLIASS 3154156

3154155 AEAATQIMKTQDLGFANKPKSIIPSKLFFGPKDVAFTPYGEYWRNARSVCMLQLLNNKRV 3153976

3153975 QSFSKIREEETSLLLRKINHSIDNSQVVDLTDLFVSMTNDVLCRVALGRKYCDGGEGKKF 3153796

3153795 KSLVIELVELLGVFNIGDYMPWLVWVNHFNGLNAKVDKVAEEFSAFLEGVIEEHNEKIKT 3153616

3153615 DEKEEGSADFVDILLQVQKENKSGFNFEMDSIKAIIMDMFSAGTDTTSTLLEWTMNELIR 3153436

3153435 NPNTLRKLRDEVRQVTQGKSDVTEDDLEHMPYLNAVMKESLRLHSPVPLLPREAIKDTKV 3153256

3153255 LGYDVAAGTQVFVCPWAISRDPTIWENPEEFQPERFLDSCVDYKGLHFELIPFGAGRRGC 3153076

3153075 PGITFAKVVNELALARMLFHFEFSLPNGIKAEDLDVDEALGITVRRKFPLLVVATPRI* 3152899

 

>CYP71AU2 scaffold02749 C03.12_contig13 84-86 kb, 100% to CYP71AU2 tomato

72% to CYP71AU1 tobacco no introns

3161045 MISLFAVFPFLIF

3161084 LGFILLSFFQLSSKKSKKNLPPSPPKLPLIGNFHQLGQQPHRSLQKLTNEYGPMMMLQFG 3161263

3161264 SVPVLIASSAEAASHIMKTQDLGFANKPKSIIPSKLFFGPKDVAFTPYGEYWRNARSVCM 3161443

3161444 LQLLNNKRVQSFSKIREEETSLLLRKINHSIGNSQVVDLTDLFVSMTNDVLCRVALGRKY 3161623

3161624 CDGEEGKKFKSLLLEFVELLGVFNIGDYMPWLAWVNRFNGLNAKVDKVAEEFSAFLEGVI 3161803

3161804 EEHKEKIKTDEKEEGSADFVDILLQVQKENKSGFNVEMDSIKAIIMDMFSAGTDTTSTLL 3161983

3161984 EWTMNELIRNPNALRKLRDEVRKVTQGKSDVTEDDLEHMPYLNAVMKESLRLHSPVPLLP 3162163

3162164 REAIKDTKVLGYDVAAGTQVFVCPWAISRDPTIWENPEEFQPERFLDSCVDYKGLHFELI 3162343

3162344 PFGAGRRGCPGITFAKVVNELALARMLFHFEFSLPNGAKAEDLDVDEALGITVRRKFPLL 3162523

3162524 VVATPRI* 3162547

 

>CYP71AX2P CYP71AX@2P scaffold02749 = C03.12_contig13 82 kb, 68% to CYP71AX1 pseudogene

3164425 DIFAAGTDTTYSTLEWIMTELLRHPRAMETLQNEA*GLAQGKAEITEDDLGNMHYLKAVI 3164604

3164605 KESRRLHPPIPLLVPRESIEDIILLGYKIPAKTGVIINSCSVGRDLLSWEKNPEEYRPER 3164784

3164785 FLDNNIDLKGLNFELIPFGAGRRGCPGIVF &

        NRASISKDCAQVQFSI &

        SEGLKPEELN 3164964

3164965 MTGGSGITIRRISPPLAVATPCSTS* 3165042

 

SL2.30ch03 56624912-56625529 (-) strand

 

>CYP71AX3 CYP71AX@3 scaffold02749 = C03.12_contig13 77-79 kb, 74% to CYP71AX1

3167477 MDLTWYALLVPLFFFLHK

3167531 CFFSTSNKLPPSPTKLPIIGNLHQLGSLPHRSLHKLSKKYGSLMLLHFGSKPVIVASSVD 3167710

3167711 AARDIMKTRDLVWSNRPKSSIADRIFYGSKDLAFSPYGEYWRQIKSITVLHLLSNKRVQS 3167890

3167891 YRVTREEETSNMIEKIRQACDSNSSSSVINLRDCLCSLTNNIVSRVALGRKYNEEGQGGI 3168070

3168071 NAKVILHELGELLGTFSIGDYIPWLEWINKINGLDNKVEKVAKELDTFLESVIEEHVSRK 3168250

3168251 NRGENSTGEAKDFVDVLLEIQNGKETGFLLQRDSLKAIIL (0) 3168370

3169253 DNFAAAGTDTTYTALEWIMIELLRHPRVMKKLEEEVRELAGGKTEITEDDLRNMQYLKAVIKET 3169444

3169445 LRLHPPIPLLIPRESTEDIELLGYHIPAKTQVIINAWAIGRDPLSWDDPEEYRPERFLNS 3169624

        NIDLKGLNFELIPFGAGRRGCPGISFALVVIELALARLVHKFNFSLPKPEELDMTEASGV

3169805 AIRRKSPLLALATPNIL* 3169858

 

>CYP71AX4P CYP71AX@4P scaffold02749 = C03.12_contig13 71-73 KB, 68% to CYP71AX1, PSEUDOGENE

3174096 MYALLLLLFLFTLFL

3174141 HRCFFSTSNNKKKLPPSPTKLPIIGNLH 3174224

3174225 QLGSLPHRSLHKLSKKYGSVMLLYFGSKPVIVASSVDAARDIM 3174353

3174354 KTHELVCSNRPKSSIAERLFYGSKDVAFSPYGEYWRQIKSVTVLHLLSNKRVQSYRDIRE 3174533

3174534 EETSNMIVKIRQECDSNSSSSVIDCLCSLTN &

        NIVSRVALGRKYNEGQEGINAKITLHELGELLGTFSIGDYIPWLEWINKINGLDNKVEK

        VAKELDTFLESVIEEHVSRRNRGEYSTGEAKDFVDVLLEIQNGKETGFLLQRDSLKAIIL (0)

3175184 DIFAAGTDTTYTALE*KMTELLRHPRAMETLQNEVRGLAQGKAEVTEDDLGYMQYLK 3175354

3175355 AVIKETFRLHPPDPLLVPRESTQDIKLFGYHIPSKTQIIIDAWTIRRDPLSWENPHDFLP 3175534

3175535 ERFLDSTINLKGLN & 3175576

3175578 ELIPFGAGRRRCPGISFAIVVIEVALARLVHNFNFSLPTPEELDMTESNGVTIRRKSPLL 3175757

3175758 ALATPCSTYN* 3175790

 

>CYP71AX5 CYP71AX@5 scaffold02749 = C03.12_contig13 63-64 KB, 75% to CYP71AX1 tomato

3182607 MEFPWYSVVVPLFVFLFFLHNCLFAIFNNNKRLPPSPRKLPIIGNLHQLGL 3182759

3182760 HPHRSLHKLSEKYGPVMLLHLGSKPVVVASSVDAARDILKTHDLVWSTRPKSSIGDGLFY 3182939

3182940 GSKGVASSNYSEYWRQVRSVMVLQLLSNKRVQSFRDIREEEVSNMIDEIRKRCTSSSNSV 3183119

3183120 IDMRDVLSCMTSNIISRVTIGRTYNEGETGIAVKGLIEELLALFGTFNIGDYIPWLIWLN 3183299

3183300 KINGLDNREKKVAKDLDAFLDSVIEERLVRNNKEKYRTGEAKDFVDVLLEIQNGKETGFP 3183479

3183480 LQRDSLKAILL (0) 3183512

3183740 DSFIGGVDSMYTTLEWIMIELLRNPRAMEKLQNEVRGLVQGKAEITEDDLGNMQYLKAVI 3183919

3183920 KETLRLNPPFPIPIPRESMEDVKLLNYDIPAKTQVLINVWAIGRDPLLWDEPEEYQPERF 3184099

3184100 LNSDIDFRGLNFELIPFGAGRRGCPGIPFSIVIIELALARLVHKFNFTLPQGMKKEDLDM 3184279

3184280 SECTGISIRRKLPLLAVATPCSI* 3184351

 

SL2.30ch03 56605606-56607350 (-) strand

 

>CYP71AX6P CYP71AX@6P scaffold02749

3185076-3185565 (+) strand

90% to CYP71AX.9

scaffold02749 C03.12_contig13 59 kb, 57% to CYP71AU4, 60% to CYP71AX1, pseudogene

3185076   IKKKLPPSPTKLPIIGNLHQLGSLPQ & 3185153

3185155   SLHQVSKKYGPVMLLHFGSKPVLIASSVDAARDIMKTHDLVWSNRPKFSITDKLFYGSKD  3185334

3185335   VAFSPYGEYWRQIRSVTVLHLLSSKRVQSYRDIREEETLNMIVKIRQVCDSNSSSSVIDL  3185514

3185515   RDCLCSLTNNMVSRVAL  3185565

3186606 GRK*NEEGQGGMNAKIILNEFGELLGTFSIGDYIPWLEWIK*INVLDNKVEKVAK 3186770

3186770 ELDTFLESVIEEHVSRKNRGENSTGEAKDFVDVLLEI*NGKGTGFLLQRDSLKVII 3186937

3187380 DIFYGGTDTTYTSLEWIMIKLLRHPKAMEKLHNEMRGLAQGKQ 3187508

3187508 EVTEDDLVYMQYLKAVIKETFRLHPPGPLLVPRESTQDIKLLG

        HHIPAKTQIIIDAWTIGRDLLSWENPERFLDSNIDLKKLNFELIPF

        EAGRRGCPGIAFAVVVIELALARLVHKFNFS 3187867

3187868 LPKPEELDTNY* 3187903

SL2.30ch03 56602054-56604881 (-) strand

>CYP71AX7 CYP71AX@7 scaffold02749 = C03.12_contig13 55-56 kb, 75% to CYP71AX1 tomato

3190379 MEFPWYSVVVPLIVFLFFLHNCLFTIFNTSNKKLPPSPRKLPIIGNLYQLGLHPHRSLYKLSKKY 3190573

3190574 GPVMLLHLGSKPVLVASSVDAARDILKTHDLVWSTRPKSSIADGLLYGSKGVAFSNYSEY 3190753

3190754 WRQVRSVIVLHLLSNKRVQSFRDIREEEVSNMIDEIRKRSTSSSNSVIDMRDVLSCMTNN 3190933

3190934 IINRVTIGRTYNEGESGRAVKALLEDLLALLGTFNIGEYIPWLKWLNKINGLDNRVKKVA 3191113

3191114 KDLDAFLDSVIEERVVRNKKAENSTGEAKDFVDVLLEIQNGNETGFPLQRDSLKAILL (0) 3191287

3191526 DSFIAGVDSIYTTLEWIMIELLRNPRAMEKLQNEVRGLVQGKAEITEDDLGNMLYLKAVI 3191705

3191706 KESLRLNPPFPIPVPRESMEDVKLLDYNIPAKTQVLVNIWAIGRDPLSWDEPEEYRPERF 3191885

3191886 LNSDIDFRGLNFELIPFGAGRRGCPGIPFAIVIIELTLARLVNKFNFALPQGIKKEDLDM 3192065

3192066 SECTGISIRRKLPLLAVATPCSV* 3192137

 

SL2.30ch03 56597820-56599578 (-) strand

 

>CYP71AX8P CYP71AX@8P scaffold02749 = C03.12_contig13 53-54 kb, pseudogene 65% to CYP71AX1

3192497 MELPWYSVVVPL

3192533 FVFIFFLHNCFTTSNNNKKNIPPSPTKLPIIGNLHQLGSYPHRSLN*LSKKYSPVMLLHL 3192712

3192713 GSKPVIVVSSAEVARDIMKTHDLVWLNRLKSSIADGLLYGSTDMTFSPYGEYWRKIEALL 3192892

3193008 TDSIYTTLE*IMTELSRHPRAMEILHYEVWELVQGKTEVTKDDLGNMQYLKAVIKEFLRL 3193187

3193196 VPLLVPRESMENVRLLDDDIPPKT*VLINAWAIGRYPLSWDDPDEYRPERFLNSNIDFRG 3193375

3193376 INFELIPFGASRRGCPGINFNRASISKDCTQVQFSIRKGTKNEDLDMSECTGITIHRKLP 3193555

3193556 LLAVATL 3193573

 

SL2.30ch03 56596381-56597460 (-) strand

 

>CYP71AX9 CYP71AX@9 scaffold03823 = C03.12_contig13 27-28 kb 72% to CYP71AX1 tomato

4637 MDYALYSVIVPLFVFIFFLHKCFFTTSKNQNKLLPSPTKLPIIGNLHQLGSHPHRSLHELSNK 4825

4826 YGPVMLLHFGSKPVIVASSVDAARDIMKTNDLVWSNRPKCKMADRLMYDSKDVAFSPYGE 5005

5006 YWRQIRSVTVLHLLSNKRVQSYRRVREEETSNMIDKIRQQCDSVIDLRDVLSCMSNNIIS 5185

5186 RVALGRKYNDEQSGIDAKATLNMFVELLGTFNVGDYIPWLEWVNRITGLDTKVDKVAKDL 5365

5366 NTFLELVIEQHIIRNEKGENRAGEAIDLADVLLEIQNGNETGIPLQRDSLKALIL (0) 5530

     DTFSAGTDTIYTALEWTITELLMHPRAMEKLQNEV 5725

5726 RELAQGKAEVTEDDLGNMQYLKAVIKETFRLHPPIPLLVPRESMEDVKLLGYHIPAKTQV 5905

5906 IINAWAIGRDPLSWDDPEDYRPDRFLNSNIDIKGLNFEVIPFGAGRRGCPGTVFAIVAIE 6085

6086 LAVARIVHKFNLALPKEKELDMTECTGLTIRRKSPLLALATPCST* 6223

 

>CYP71AX10 CYP71AX@10 scaffold03823 = C03.12_contig13 21-23 kb, 92% to CYP71AX1 tomato

11831 MEYFLLVPLLAFIFFLHQFFFSPSNTQKRLS

11738 PPSPTKLPIIGNLHQLGSLPHRSLHKLSQKYGPVMLLHLGSKPVLIASSVDAARDIMKTH 11559

11558 DLVWSSRPKSSMADGLFYGSKDVAFSPYGEYWRQIRSVTVLHLLSNRRVQSYRHVREEET 11379

11378 SNMIDKIRQQCDSVIDLRDVLSCMTNNIISRANIGRTYNEGESGIAVKNLLEETLILAGT 11199

11198 FNIGDYIPWLKWVNKIKGLDTRVKEVAKDLDAFLESVIEERLIGNKKAECSAGEAKDFLG 11019

11018 VLLEIQDGKETGFPLQRDSLKAILL (0) 10944

10828 DAFVAGTDSTYTVLEWTMTELLRHPRVMKKLEDEVRELGQGKTEITEDDLGNMHYLKAVT 10649

10648 KESLRLHAPVPLLVARESMEDVKLLDYDIPAKTQVLINAWAIGRDPLLWDHPEEYMPERF 10469

10468 LNSDIDVKGLNFELIPFGAGRRGCPGIPFAIMVNELALANLVYKFDFALPKGIKGEDLDM 10289

10288 TECNGLAVRRKSPLLVVATPSPWSS* 10211

 

>CYP71AX11 CYP71AX@11 scaffold03823 = C03.12_contig13 14-16 kb, 81% to CYP71AX1

19306 MEYFLLVPLLASIYFLHQLFFSPSNTQKRL

19216 LPPSPTKLPIIGNLHQLGSLPHRSLHQLSNKYGPLMLLQFGSKPVIVASSVNAARDIMKT 19037

19036 HDLVWSNRPKSSITDKLFYGSKDVAFTSYGEDWRQIKSIFMFHLLNNTRVQSYRRVREEE 18857

18856 ISNMIDKIRQQCDSVIDLRDVLSCMTNNIISRVTTGRTYNEGESGIAVKALLEQLLVLTG 18677

18676 TFNIGDYIPWLKWLNKINGMDCRVKKVAKDLDAFLESVIEERVIRNKKGGCSVGEAIDFV 18497

18496 GILLEIQNGKETGYTLQRDTLKALLL (0) 18419

18039 DAFVGGTESVYTSLEWTMTELLMHPRVVKKLEDEVRELGQGKTEITEDDLRNMHYLKAVI 17860

17859 KESLRLHPPNPLLLPRESREDVKLLDYDIPAKTQGLINAWAMGRDPLLWDDPDEYRPERF 17680

17679 LNSDIDVKGQNFELIPFGAGRRGCPGITFAIIINELALARLVHKFNFALPKEEDLDMTEC 17500

17499 NGLSVRRKLPLFAVATPSSS* 17437

 

>CYP71AX@12P scaffold03823

25469-25407 (+) strand

90% to CYP71AX.20

25469 WAMTELLRHPRVVKKLEDEVR  25407

 

56551566 MEWAMTELLRHPRVVKKLEDEVR 56551634

 

SL2.30ch03 56551566-56551634 (+) strand

 

>CYP71AX12 CYP71AX@13 scaffold03823 = C03.12_contig13 5-7 kb, 86% to CYP71AX1

29291 MEYFLLVPLLLLTYFLHQWFFSPSNTQQRLS

29198 PPSPTKLPIIGNLHQLGSVPHRSLRKLSKKYGPVMLLQFGSKPVIVASSVDAARDIMKTN 29019

29018 DLVWSGRPKSSMTDGLFYGSKDVAFSPYGEYWRQIRSITVLHLLSNKRVQSYRRVREEEI 28839

28838 SNMIDNIRQKCDSVIDLRDVFSCLTNNIISRVNIGRTYNEGECGIAVKSLIEELLILIGT 28659

28658 FNIGDYIPWLKWLNKINGLDSRVKKVAKDLDAFIESLIEERVNRNKKVECSAGEAKDFLG 28479

28478 VLLEIQDGNETGFPLQRDSLKALVL (0) 28404

27460 DAFVAATESTYSALEWIMTELLRHPRVMKKLEEEVRELGQGITEDDLRNMQYLKAVIKES 27281

27280 LRLHPPAPLLIPRESMEDVKLLDYHIPAKTQVIINAWAIGRDPLLWDDPEEYRPERFLNS 27101

27100 DIDVKGLNFELIPFGAGRRGCPGTAFAIVVIELALARIVHKFDFALPNEEELDMTECNGL 26921

26920 TVCRKSPLLAVATPWSI* 26867

 

>CYP71AX13 CYP71AX@14 scaffold03823 71% to CYP71AX1

34714 MDLPCSWYSL

34744 LIPLFVFIFLIIHHCFFTTSNTQNVLLPPSPTKLPIIGNLHQLGLHPHRSLYKLSKKYG 34920

34921 PVMLLHLGSKPVIIASSVEAARDIMKTHDLVWATRPKSSIVDRLFYGSKDVGFSPFGEY* 35100

35101 RQVKSIVVLHLLNNKTVQSFRCVREEETANMIGKIRDGCDSSSSLINLGDHLGSLTNNII 35280

35281 IRVALGRIHNERESGRAVKALLEELLALLGTFNIGEYIPWLK 35406

      WLNKINGMDCRVKKVAKDLDEFLDSVIEEHIIKREYSAGEAKDFLDVLQEIQNGKETGFPLQRDSLKAILL

35760 DSFAGGTDTIYTALDWTMAELLRHPRAMKTLQNEVRGLTQGKSEVTEDDLKNM 35918

35919 EYLRAVIKESFRLHPPNSLLVPRESREDVKLLGCYHIPVRTQAIINVWAIGRDPLLWENP 36098

36099 DEFRPQRFLNSNIDFKGLNFELIPFGAGRRGCPGSTFAIAVIELALARLVHKFNFAL 36269

36270 PKEEDLDMTECTGITTRRKSPLLVVAIPCST* 36365

 

SL2.30ch03 56541014-56542665 (-) strand

 

>CYP71AX14P CYP71AX@15P scaffold03823

36906-37793 (+) strand

74% to CYP71AX.13

        MDLPCYSLLLPLFVFIFFLHKWLFT

36906   PKKLPIVGNLHQLGLHPHRSFHKLSKKYAPVMLLYFGSKPVLVASSAEAARDIMKTHN  37079

37080   LVCSSRPKSRMSDKLVCG & 37103

37105   QINSFVAFSPDGEYWRQIRSVTVLHLLSNKRVQSYRDSL  37230

37344   FAAGTDTTHTALEWTMTELLRHPRATETLQNEVSGFVQGKAEIKEDDYGK

        NMQYMKAAIKESLGLHQPIPLLIPRE &

        PQEFRPKRFL  37664

37665   NSDIDVKGLLIPFGGGKRGCPGSTFAIMVNELALPRIVHKFNFA  37793

        TGITIPRKSP*LAIATPCSN*

 

SL2.30ch03 56539512-56540561 (-) strand

Added last amino acid and some interal seq

 

>CYP71AU33 CYP71AU@3 scaffold03823 67% to CYP71AU4

42872 MNMNMFISLQWLENCTNLSYVLAFSLLISF

42962 LVMSLLMSKSKTKKNLPPSPPKLPFIGHMHKLGVYPHHSLHKLAQQYGPLMFLKLGSV 43135

43136 NTLVVSSAEAASEIMKTHDLVFCDRPKSNVNKKLLYDFKDVSVAPYGEYWRQMRSICVLQ 43315

43316 LLSNKRVQGFRIVREEESALLVKKIKERSPEAVNLSELFMTLTNDVVSRAAFGRKYS 43486

43487 GGESGEKFRKLMKEFVGILGGFDFGTFLPSLAWIDRVSGLEAKVDRVAREMDEFLEGVV

      EEHLDSHKRVKELLGDKVENENREDFVDVLLGIYKQDMVDGFSIDRDGIKALIV (0)

45369 DIFAGGTDTTYTVLEWAMTELLRHPGAMKKLQNEARGITKSKNEIVCEDDLDKMHYLKAV 45548

45549 IKETLRLHPPIPLLVPRQAREDVVVMGYDVGAGTMVITNGWAIGRDPEIWDDAEEFKPER 45728

45729 FLNSSIDFKGHDFGLIPFGSGRRGCPGISFAMATNELVLANVVREFDWELPNGAKGDH 45902

45903 LDMTECTGLTIHRKVPLFAVATSNTS* 45983

 

>CYP71AU34P CYP71AU@2P scaffold03823

30649-30741 (+) strand

90% to CYP71AU.3, 90% to CYP71AU@3, only 60% to CYP71AU2

30649   VCEDDLYKMHYLKAVIKETLQLHPPIPLLVPQQ  30741

 

SL2.30ch03 56546637-56546729 (-) strand

56546735 VCEDDLYKMHYLKAVIKETLQLHPPIPLLVPQQ 56546637

 

>CYP94B20 CYP94B@2 scaffold03823 65% to CYP94B10 Vitis

605179 MFLSLFLFFILGFIT

605134 HSLKLHLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQR 604973

604972 FGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWNAQRKL 604799

604798 ASHEFSTNSLREFVVKTLEEVVENRLVPLLIQAANSGKVLDLQDVLRRFAFDTICKVSLG 604619

604618 TDPHCLDDLSHVPVLVDSFDTASRACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVH 604439

604438 CCIDEIIEEKKQKIATENGGDQMDLLSRLLLAGHDNEVVRDMVISFLMAGRDTT 604277

604276 SSALTWLFWLTTNHRDVKDEMIKEITSINNGDKALEFDELKEMKHLAACL 604127

604126 NESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDR 603947

603946 WIDENGGLKSVSPYEYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVNVEKP 603776

603775 VFLPLLTAHMVGGFNVRIYGRVE* 603704

 

>CYP94B20 CYP94B@2 scaffold00924 ver 1.03

602616   THSLKLHLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPR  602437

602436   TIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWNAQRKLASHEFST  602257

602256   NSLREFVVKTLEEVVENRLVPLLIQAANSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLD  602077

602076   DLSHVPVLVDSFDTASRACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVHCCIDEII  601897

601896   EEKKQKIATENGGDQMDLLSRLLLAGHDNEVVRDMVISFLMAGRDTTSSALTWLFW  601729

601728   LTTNHRDVKDEMIKEITSINNGDKALEFDELKEMKHLAACLNESMRLYPPVAWDSKHAAK  601549

601548   DDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDRWIDENGGLKSVSPYEYPVF  601369

601368   QAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVNVEKPVFLPLLTAHMVGGFNVRIYGR  601192

 

>CYP94B19 CYP94B@3 scaffold03823 64% to CYP94B10 Vitis

614259 MFLSPIIFFILGFLTHYLKLHLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSE 614435

614436 SPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGR 614591

614592 GIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQTANSGKVLDLQD 614771

614772 VLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAPVYAIWKSKRAL 614951

614952 NLGSEKKLKENVKRVHCCIDKIIEEKKQKIATENGGNHMDLLSRLLLAGHENEV 615113

615114 VRDMVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKA 615263

615264 LEFDELKEMKYITACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGR 615443

615444 MEEIWGKDRLEFKPERWMEENGELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLA 615614

615615 SVLRRFEIKPVKLEKPVFLPLLTAHMVGGFNVRIHHRASALG* 615743

 

>CYP94B19 CYP94B@3 scaffold00924 ver 1.03

611879   MFLSPIIFFILGFLTHYLKLHLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSES  612058

612059   PTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGEL  612238

612239   WSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQTANSGKVLDLQDVLRRFAFDT  612418

612419   ICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAPVYAIWKSKRALNLGSEKKLK  612598

612599   ENVKRVHCCIDKIIEEKKQKIATENGGNHMDLLSRLLLAGHENEVVRDMVISFLMA  612766

612767   GRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKALEFDELKEMKYITACLNESMR  612946

612947   LYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPERWMEEN  613126

613127   GELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVKLEKPVFLPLLT  613303

613304   AHMVGGFNVRIHHR  613345

 

>CYP94B18 CYP94B@4 scaffold03823 65% to CYP94B10 Vitis

619675 MFLSLFIFFILGFLTHSLKLHLKFTPIYAPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQ 619863

619864 TILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELW 620037

620038 SAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQVANSGKVLDLQDVLRRFAFDTI 620217

620218 CKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAPVYAIWKSKRALNFGSEKKLRE 620397

620398 NVKRVHCCIDEIIEEKKQKIATENGGNQMDLLSRLLLAGHDNEVVRDMVISFLI 620559

620560 AGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSIYNGDKALEFDELKEMK 620709

620710 YLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRL 620889

620890 EFKPDRWIDENGALKMVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKP 621060

621061 VVNVEKPVFLPLLTAHMAGGFNVRIYHRDC* 621153

 

>CYP94B18 CYP94B@4 scaffold00924 ver 1.03

617292   MFLSLFIFFILGFLTHSLKLHLKFTPIYAPSSYPILGCLISFYKNRHRLLDWYTQLLSES  617471

617472   PTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGEL  617651

617652   WSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQVANSGKVLDLQDVLRRFAFDT  617831

617832   ICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAPVYAIWKSKRALNFGSEKKLR  618011

618012   ENVKRVHCCIDEIIEEKKQKIATENGGNQMDLLSRLLLAGHDNEVVRDMVISFLIAG  618182

618183   RDTTSSALTWLFWLTTNHRDVKDEMIKEITSIYNGDKALEFDELKEMKYLAACLNESMRL  618362

618363   YPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDRWIDENG  618542

618543   ALKMVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVVNVEKPVFLPLLTA  618722

618723   HMAGGFNVRIYHRD  618764

 

>CYP94K1P CYP94x@1P  CYP94x.1 CZ990667.1 Tomato GSS genomic clone (not in the 366 set)

73% to potato CYP94x.1

MDILLPFDLIIFFLPIIIFLFTYYENESFSKLRLPKSYPLIGCTFSLIKNHKRFLQWTAQ*LQNSPSLTITLTSPFGK &

KICLDNKPTNVNHTLKTRFN &

VYKKSTTLRSPLHDLLGRGLFVVNGKEWKSHRQLVSPIFKVDTF  403

404  HHLIEYVTMKEISSHLLRIFVDASITSSTIVLDLHDIFHRFTFDIVFKEGFGHDQQYLLP  583

584  SLPKTL & 601

604 LPDAVKTTFKIYMGK*AHP (this seq does not match)

6150481 LADAVNTTIKIYMGRYASP 6150537

IGSEKNLSLAIKDLQEFIKK 6150629

 

SL2.30ch07 6149852-6150629 (+) strand

 

>CYP94K1P pimpi WGS contig 6694566

4543 MDILLPFDLIIFFLPIIIFLFYTYYENESFSKLRLPKSYPLIGCTFSLIKNHKRFLQWTA 4722

4723 Q*LQNSPSLTITLTSRFGK

     KICLDNKPTNVNHTLKTRFN &

     VYKKSTTLRSPLHDLLGRGLF 4902

4903 VVNGKEWKSHRQLVSPIFKVDTFHHLIEYVTMKEISSRLLRIFVDASTTSSTIVLDLHDI 5082

5083 FHRFTFDIVFKEGFGHDQQYLLPSLPKTL 5169 &

5172 LADAVNTTIKIYMGRYASP 5228

5255 ASIGSEKNLSLAIKDLQEFIKK 5320

 

>CYP94K1 CYP94x@1P scaffold05266

858001-858640 (+) strand

73% to CYP94x.1 potato, 36% TO 94A4 TOBACCO

C-term is slightly different from ver 1.03

858001   IIIFLFX &

858021   TYYENESFSKLRLPKSYPLIGCTFSLIKNHKRFLQWTAQ*LQNSPSLTITLTSPFGK &

         KICLDNKPTNVNHTLKTRFN &

         VYKKSTTLRSPLHDLLGRGLFVVNGKEWKSHRQLVSPIFKVDTFHHL  858392

858393   IEYVTMKEISSHLLRIFVDASITSSTIVLDLHDIFHRFTFDIVFKEGFGHDQQYLLPSLPKTL & 858581

         LPDAVKTTFKIYMGK*AHP 858640

354351   LADAVNTTIKIYMGRYASP  354295

 

>CYP85A1 scaffold01656 end modified from DQ374443 to add last exon

2483812 MAFFLIFLSSFFGLCIFCTALLRWNQVKYNQKNLPPGTMGWPLF

GETTEFLKLGPSFMKNQRARYGSFFKSHILGCPTIVSMDSELNRYILVNEAKGLVPGY

PQSMIDILGKCNIAAVNGSAHKYMRGALLSLISPTMIRDQLLPKIDEFMRSHLTNWDN

KVIDIQEKTNKMAFLSSLKQIAGIESTSLAQEFMSEFFNLVLGTLSLPINLPNTNYHR

GFQARKIIVNLLRTLIEERRASKEIQHDMLGYLMNEEATRFKLTDDEMIDLIITILYS

GYETVSTTSMMAVKYLHDHPKVLEELRKEHMAIREKKKPEDPIDYNDYRSMRFTRAVI

LETSRLATIVNGVLRKTTQDMEINGYIIPKGWRIYVYTRELNYDPRLYPDPYSFNPWR

WMDKSLEHQNSFLVFGGGTRQCPGKELGVAEISTFLHYFVTKYR (2)

2481330 WEEIGGDKLMKFPRVEAPNGLRIRVSAH* 2481244

 

>CYP88B1 scaffold03540

926952 MDFYNLALFFIALILGIFTFYAILMRINGWYYAIKFCSNKYNIPN

GYMGLPYFGNTLSYFKASMCGDPKSFIDFFATR ()

FGEGGMYRAYIFGKPTIMVTKPEIIRKVLMDEEYLERGLPNYMKKLIGLTTSIEED

KYFRRLTAPVKSHGLLSDYFDYIDKTVSSTLEKYATTEEPVEFLHK

MHKLTFEVFMRLLIGDEVNQELFDEMFEEITAVISGVHNLPINLPGFAYHKGLK ()

ARKVLGEVFKKLIDERREAMKDGKSMPKANIIDMLL

SNNNQDYEANMLSDKKIIEILVLFSFAGFEPVALMSVKAIFHLQKHPHFLEKAK ()

EEQEEIVKRRASSNAGLSFDEIRQMTFVSK ()

IINETLRIATDQSVFLRDTSTTFNIN ()

GYTIPKGWKFFAVVWNIHMNPDVYVQPKEFNPSRWD ()

DIETKPGIFLPFSMGPKSCPGSNLAKLQISVILHYYLLHYR ()

VEQINPEARCYPPENCLVKFKKLSISSNGN* 922260

 

>CYP88B1-de7b7c CYP88B@1P CYP88B1 pseudogene scaffold03540, 82% to CYP88B1

919846 DIQTKPGYFHPFPMGPKSCPGSNWAKLQ 919763

             919763 MGPKSCPGSNWAKLQ

ISLILH 919656

 

SL2.30ch12 932645-932835 (-) strand

 

>CYP88C2 CYP88C@1 scaffold05603 55% to CYP88C1 Petunia x hybrida, 38% to CYP88A4, 41% to CYP88A24 Vitis

417538 MEYNLVLLYTSLAIGILTLICVLKRVNGWFFTFFTKKCNLPPGDMGWPLVGNMIFFLLSF 417359

417358 KDNNLSSFFTYFVTR (2)

       FGEGGMYKAFLFGKPS 417179

417178 IIMTKVEISRKIFMDDENYDRGMPNYILKILGQAQVGGFTREESKTLHRITTLIKSDISL 416999

416998 LSNYFDFANEIVKKSFVKLVEMEEPIDVILAIKRPAFEVLMRILIGDGVDNDMVNILFEE 416819

416818 TIYLIHGCHGLPFNIPGSAYNRGLK (0) 416744

416397 ARKAMSKIYKYILDERKVMIGKNKTREKSNILLDMMLNTQDDDNEGFNDEKIIAMLV 416227

416226 SYTFAGFESVALVASTAIMYLEKHPHFLDKAK 416131

415719 EEQEDIVKRRSSPNEGLNFHEIKEMKYLSN

415536 VINESLRIATAKTIFFREARTTININ

415368 GYTIPKGWKFLSFSWNYHFDPHTYVRPKEFNPSRWD 415261

415083 DLKTKPASFLPFGVGPKMCPGANLARLEVSVILHYFLLNYR 414961

414677 VERVNSESKIEPPRSCLVKFKKI* 414606

 

>CYP88G1 CYP88A@1 scaffold02257 48% to CYP88A4, 50% to CYP88A24 Vitis, 52% to pea CYP88A6

402340 MVCDFGLIFFTSFAIGIFAIYFSLKRANDLFYTSKFNSKVYNIPPGDMSLPFIGNMFTFFTTFKYGD 402140

402139 PESFISYFTSR (2) 402107

401342 YGQGGMYKAFMFGTPSIIVTKPQVCKKILMDDENFELGWPQSVLNLIGRKALHGITSQE 401166

401165 HKRLRRITTSPIKGKHTLSLYLSLIEEVVKSSFEKWNAIEDEPIEFLSEMKKSTFEVIIR 400986

400985 IMIGSEIDPQWLDMVEKVYTIYLKGFLALPINLPGFAYHSAFK 400857

400389 ARENLVKIFQSVIDERKVMNMKDESRSKGNMIDLIMAIEDDEGRRLNDEEIIDLLIVY 400216

400215 VFAGHETTAHTAAWSIMYLEQHPEFLQKAK 400126

399957 EEQEEIVQRRHPDSDKKLSYDEMIQMKYLSK 399865

399787 VIDETLRCSNVTLAIYRNAKRTINMN 399710

399596 GYTIPKGWKVLTWIRQVNLDPNNHVNPKEFNPSRWD 399489

399172 EVKTYSAFLPFGAGPRLCPGAELARLEVSVFLHYFLLNYR (2) 399053

398954 LERLNPKTSVTYLPIPSPTDNCLARLKRISSSC* 398853

 

>CYP88A35 CYP88A@2 scaffold05189 68% to CYP88A4

1839202 MDFWLMMMVTIICVMFGFMKWLLSSVNVWYYEKVKLSGDKKKRLSLPPGDLGWPFIGTMWS 1839384

1839385 FLRAFKSNNPDSFINSFISR (2) 1839444

1841303 FGRTGIYKAFMFGSPCVIITTPEGCRKVLNDDEAFKPGWPKSTMELIGKKSF 1841468

1841469 IGISYEEHKWLRKLTAAPVNGHEALSMYIQYIEERVISALDKWSSMEEVEFLTHMRKL 1841642

1841643 TFRIIMYIFLSTESEQVMDDLEKEYTTLNYGVRAMAVNLPGFAYYKALK

        ARKNLVAIFQSIVDERRARKEKRGLEDKKDM 1841999

1842000 MDILLEVQDENGRKLNDEEIIDVLVMYLNAGHESSGHITMWVTYFLQKHPDFFKKAK 1842170

        EEQESIVKNRPAEQKGLTLKEIRNMDYLSK

1842448 VIDETLRLITFSFVVFREAKEDVAIH 1842525

1842608 GYTIPKGWKVLVWFRSVHLDPEIYKDPLEFNPSRWD

GLTPKVGTFLPFGGGGRLCPGNDLAKLEISIFLHYFLLDY 1842967

LERKNPSCPVMYLPHCRPKDNCLGRVKRVSSTSSAA* 1843190

 

>CYP90A5 scaffold05575

2931269 MDTIDLFLYLFLSVFTFYLLRCMAAAHLRGRKTRLPPGTLGLPFIGETL

QLISAYKTENPEPFIDDRVSKYGSIFTTHVFGEPTVFSADPETNRFILQNEGRLFESSYP

GSIQNLLGRYSLLLMRGSLHKRMHSLTMSFANSSILKDHLLGDIDRLVRLNLDSWTGRVF

LMDEAKKITFNLTVKQLMSFDPCEWTENLMKEYMLVIEGFFCIPLPIFSSTYRKAIQART

KVAEALGLVVRDRRKERDGGERKNDMLEALFEGDGVEGVGFSDEEIVDFILALLVAGYET

TSTIMTLAVKFLTETPRALSLLKEEHEEIRLRKGEVKSLQWEDYKSMPFTQCVVNETLRI

ANIISGVFRRAMTDINIKGYTIPKGWKVFASLRAVHLDHEHFKDARTFDPWRWQSSAGPT

SSPNVFTPFGGGPRRCPGYELARVELSVFLHHLVTRFSWVPAEADKLVFFPTTRMLKRYP

INVQHRSLFEQKEEEKGS* 2924516

 

>CYP90B3 scaffold00090

2262196 MSDLEFFLFLIPPILAVLIILNLFKRKHNFQNLPPGDMGWPFLG

ETIGYLRPYSATTIGDFMQDHISRYGKIFKSNLFGEPTIVSADAGLNRYILQNEGRLF

ECNYPRSIGGILGKWSMLVQVGQMHRDMRMIPLNFLSNARLRNQLLSEVEKHTLLVLG

SWKQDSVVCAQDEAKKLTFNFMAEHIMSLQPGNPETEKLKKEYITFMKGVVSAPLNFP

GTAYRKALQSRSTILGFIERKMEERLKEMNRNENDLLGWVLKNSNLSKEQILDLLLSL

LFAGHETSSVAIALSIFLLESCPAAVQQLTEEHLEISRAKKQSGETELNWDDYKKMEF

TQCVINETLRLGNVVRFLHRKAVKDVRYKGYDIPCGWKVLPVISAAHLDPSLFDRPHD

FDPWRWQNAEESPSGKGGSTGTSSTTKSSNNFMPFGGGPRLCAGSELAKLEMAIFIHY

LVLNFHWKLAATDQAFAYPYVDFPNALPINIQHRSLNKLHD* 2258088

 

>CYP90C2 scaffold00090 65% to 90C1

1826265 MEEKSENWIWICMVTVFWLIYKIRKKQKEDKEREIGVPRGNSGWPLLGETLDFIASGYTSRPVTFMEKRKSLYGNV

FKSNILGKGIIVSTDAEVNKVVLQNNGDVFIPCYPKSITELFGKNSILQMNGAVHKRLHGLIGSFLKSPQLKARIT

RDIEASVRHFLSTWLEKQHNVVYLQDEAKKISFEVLVKLILGVDPGEELNLLKKEFEELTKGLICLPIKLPGTTLY

KSLKAKERLTRMVEKMVEERKLSMEKKEEKGFPNDAIDVLLGNADGAKQPLPYDFTSGNLIEMMIPGEETVPTVIT

LAVKFLSDNPVALHRLLEENLELKQQKISCCEDYSWTDYLSMPFTQNVISETLRLANIINAVWRKSLKDVKIKGHL

IPKGWCVLASFTSVHMDEENYENPYNFDPSRWEKVGVAATSNTFTPFGGGQRLCPGLELSRLEISIFLHHLVTTYR

WVAEKDEIVYFPTVKMKNKLPINIMPLQQNPLIQTKQN* 1820595

 

>CYP90D19 CYP90D@1 scaffold04007  72% to CYP90D8 Vitis

3778664 MYNYSVWSSLAIAIFIIIFHKKLF

3778592 IIIIHRVKRYAQSNKTISLLPLGNLGWPYIGETLEYISSAYTHSPESFMDKRRHM (2) 3778428

3777835 YGKVFKSHIFGSPTIISTDAEVNRSILQSDAKTFVPFYPKSLTELMGKSSILLINGSLQR 3777656

3777655 RIHGLIGSFFKSPHIKARITHDMKKYVQKSMDNWQENCPVYIQHQAKN (0) 3777512

3777072 IAFQVLVKALIGIDGGEKLDILKINFQEFIAGLMSLPINFPGTTLYRSLQ (0)

        AKKRMVKLIQNIIQEKREKNIMSTVNDDVADVLLNDTSKELTDELI 3776713

3776712 SDNMIDFMIPGEDSVPVLITLAIKYLSDSPLALQQLT (0) 3776602

3776426 EENMTLKRLKEKQGETLVWSDYLSLPFTQN (0) 3776337

3776253 VISETLRLGNIIIGVMRKSVKDVEIKGYLIPKGWCTFVYFRSVHLDDNHYDFPHQFNPWR 3776074

3776073 WQ (0) 3776068

3775975 DTNNYCNFTPFGGGQRLCPGLDLARLEASIFLHHFTTQFK (2)

        WVAEEDSIINFPTVRMKKGMPVWIKRRETKQC* 3775667

 

>CYP87A21 CYP87A@2 scaffold00777 77% to CYP87A9 Medicago truncatula 79% to CYP87A14 Vitis

2152944 MISVGMSIGAFLILIIIHWVYNWRNPRCNGKLPPGSMGWPLLGETIQFFTPNTTLDIAPFVKERMKR (2) 2152744

2152630 YGPIFRTSVVGRPVIVSTDPDLNYFIFQQEGQSFQSWYPDTFTEIFGRQNVGSLHGFM 2152451

2152450 YKYLKNMVLNLFGSESLKKMLPEVEEVAKNKLKRWSGQTSVEMKEATAN (0) 2152304

2152020 MIFDLTAKKLISYDSETSSENLRESFVAFIQGLISFPIDIPGTAYHKCLQ (0) 2151871

2151758 GRKKAMKMLKTMLEERRAKPRKEGTDFFDYVLEELQKNDIILTEAIALDLMFVLLFASF 2151582

2151581 ETTSLAITLATKFLHDHPLALKELT 2151507

2151430 EEHEAIIRSRENPASGLTWKEYKSMKFTFQ (0)

2151256 VINETVRLANIVPAIFRKTLTDINFK (1)

2151082 GYTIPAGWAVMVCPPAVHLNPAKYQDPLDFNPWRWE (0)

        GVEINGATRNFMAFGGGMRFCVGTDFTKVQMAVFLHSLVTKYR 2150717

2150630 WQTIGGGNTVRTPGLQFPNGYHVRISEKDEKIL* 2150529

 

>CYP87A20 CYP87A@3 scaffold02257 75% to CYP87A14 Vitis

1175945 MLSLGIYIIGTLLVIVILHYWRNPKCNGKLPPGSMGWPLLGETIPFFAPNTSFDISP 1175775

1175774 FVKERMQ

1175620 RYGPIFRTSLVGRLVIVSTDPDFNYFIFQQEGKLFQSWYPYTFTEIFGRQNVGSLHGFMY 1175441

1175440 KYLKNMVLNLFGPESLK 1175390

1175390 NMLPEIEKIANNNLNRWSRQTSVEMKEASAKLISQMITRLLCI 1175244

1175094 FDYENSTENVSENFVAFIKGLISFPLYFPGTAYYKCLQ 1174981

1174084 GRKKIMKMLKRMLKERKSQPRKEQSDFFDYVLEELQSKDTILTEAIALDLMFVLLFASFE 1173905

1173904 TTSLAITLAIKFLHQHPKALKEL 1173836

        EEHEAIIRRRESASNGLTWQEYKSMKFTFQ 1173415

1173311 FINETVRLANIAPVIFRKALKDINFKG 1173231

1172063 YTIPAGWAVMVSPPAVHLNPTKYEDPLQFNPWRWE

1171471 GIEINRASRNFMAFGGGMRFCVGTDFVKVQMAVFLHCFVTKYK 1171343

1170938 WETIKGGDIVRTPGLQFPKGYHIKISQKEY* 1170846

 

>CYP87A19 CYP87A@4 scaffold02257 73% to CYP87A14 Vitis

1189825 MLSLGIYIIGSLVVIVILHYWRNLKSNGKLPPGSMGWPLLGETIPFFAPNTSLDISP 1189655

1189654 FVKERMQR 1189631

1189058 YGPIFRTSLVGHPIIVSTDPDFNYFIFQQEGKLFQSWYPHTFAEIMGRQNVGSFHGFMY 1188882

1188881 KYLKNMVLNLFGPESLRKMLPEVEKTTNNNLKRWSKQKSVEMKEATAx 1188741

1188186 MIFDITGKKLISYDSENSTENVCENFVAFVKGLISFPIYFPGTAYYKCLQ 1188037

1187509 GRKKTMKMLKRMLEERKSQPRKEQSDFFDYVLEELQSKDTILTEAIALDLMFVLLFVSFE 1187330

1187329 TTSWAITLAIKFLHQHPQALKEL 1187261

1186749 EEHEAIIRRRENASYGLTWQEYKSMKFTFQ 1186660

1186586 FINETVRLANIAPAIFRKTLKEINFK 1186509

1185578 GYTIPAGWAIMVYSQAVHLNPTKYEDPLQFNPWRWK

1185396 GIELNGATRNFMAFGGGIRYCIGADFAKVQMAVFLHCFVTKYK 1185268

1185027 WETIKGGDIVRSPGLQFPNGYHIKIYEKYD* 1184932

 

 

>CYP724B16 CYP724B@1 scaffold06393 55% to CYP724B14 Vitis revised

78778 MILLLPVMLSFLFGTVIFVFTFHHLFFRFYKHDTKI

78886 LPGGNMGFPFVGEAFGFFTPHKSFSIGNFLQQRCSR 78993

79079 YGKVFKSYIFGSPTIISCDLELNKFILQKEGKLFQSSYPKPIRDILGNHSLMIVTDVER 79255

79256 HKKLRRIEVGLINKFSSTSNFLCEIDKLCVSLMESWRGNQLILFSKQAKQ

      FSFNLMLMNLLDMQPGEPLGLQLLQDFLTFMEGFVSIPINLPWTP 79609

79610 YAKA

      ARRRISSTLKQILNERKNRKDVQGKGDPF 79789

79790 DEILMKEDLISDVEKVSILLDLLLAGYETTSGLLSLLVYFLAQSPQALQTLk 79945

80017 DEHLAIRRNKKEGEPLNWEDYKQMEFTTM 80103

80217 VINETLRCGNLVKFVHREAIKDVKFK

80406 GYHIPAGWKVLPILSAVHLEPSLHENPSEFNPWRWT

      DPATSKNVVPFGGGSRLCPGSELGKLEASFFLHYLLLNYR 80741

80907 WTMKEEEYPMLYPYMDFPKGLLIALETETKNVI* 81008

 

SL2.30ch02 48956295-48958525 (-) strand

 

>CYP87E3 CYP87x@1 scaffold04857 49% to CYP87B9, 51% to CYP87D8 Populus, revised 2/17/2010

59% to CYP87E1v1

468292 MDTLFTSFQDEIRRTNFLGVWYFVLTILTIYVTKWIYRWRNPKCNGILP

       PGSMGLPFIGETLQLILPSHSLDLPPFLKNRIKK (2) 468044

467373 YGQMFKTNIAGRPVIISADPEFNSFILKQDGKLVETWSLDTFAEVFEQNTHSSRK 467209

467208 YTRHLTLNHFGVEALKDKLLPQMENFVNLVLQKWSTHESLEVKSAATK (0) 467065

466462 MTVDFAAKQIFSGDLENAPFNISDMFRDLVEGLMSFPINLPGTSHHKCLK (0) 466313    

       IHKKVRETMRDVLKKRIESSTKKRKGEEDLVDHLLKDM 466109

466108 DSQKFLTQDYIVQMMFGLLFVTSDSISTTLALSFKLLVEHPHVLEELI (0) 465965

465884 VEHDLILKNKENLDAPLTWNDYKSMTFTLQ (0) 465795

465552 VINEVLRLGNIAPGLFRRALKDIPIN (1) 465475

464549 GYTIPAGWVIMIATAALHLNSDQFEDPLSFNPWRWK 464442

464335 KIRLSGGAKNFMPFGYGMKQCAGAEYSRVFLATFLHVLVTKYR 464207

463283 WTMVKGGKIIRAPIIRFPDGFHFNISQKNQ* 463191

 

>CYP71D-se3[1] CYP71D@47P scaffold07408

914252-914362 (-) strand

54% to CYP71D.56v2

914362   YPSIKSLRKTSDMRAKVEKVHKRIDAILEHVINEHRE*K & 914252

RANAVDFLLRIQKEGNLDVPLMRNNIKAVI 64371589

 

 

SL2.30ch07 64371357- 64371577 (+) strand

 

>CYP718A6 scaffold07408 76% to CYP716A17

4069174 MAIDMNFPLSNFTLLLSSIFFIIFFSLLLKQYYKNVHKNHITKKKLPPGEMGLPWLGETIE

4068991 FYKSQKKNKLFEEFVEPRIEKYGKTFKTRLMGEPTIVVCGAKANMFFMSNEFKLVISSWP 4068812

4068811 TSSVELMGKNSIMEKKGDIHRFLRGIISSSLTSTSLDNMVPKICNTIQSHLYINCTSHGQ 4068632

4068631 VDRTIKLYHLTKSLTFKIVFECFLGIVVKPGLLETFEGVLEGAFSPPFKFPGSKFSRATS 4068452

4068451 ARTKVQKFLVEVIREKRNEIEFGRVQNEERKLDESLLSRLVKAMIRGEVSEDEVVDNVVL 4068272

4068271 LVFAAHDTTSFAIAMTFRMLAQHPTCYSLLLQ (1)

4068091 EHANIMSNKRLDEGLSLEDTKKMKYTWQVARESMRLFPPIFGSFRKAIADIEFDGFTIPK 4067912

4067911 GWK (0) 4067903

4067796 VLWTTYGTHNSPEYFKEPQNFDPSRFEEPVQPYAFIPFGGGPRLCAGYQLAKLNILIFVH 4067617

4067616 YVVTKYNWSLVDHDEPIVMDPLPFPSKGMPIKISPKF* 4067503

 

>CYP718A6 CYP718A6 scaffold07408 AC210348.2 58% to CYP718A1 Arab.

67% to CYP718A4P Vitis, 97% to CYP718A7 potato (ortholog)

4069174 MAIDMNFPLSNFTLLLSSIFFIIFFSLLLKQYYKNVHKNHITKKKLPPGEMGLPWLGET

IEFYKSQKKNKLFEEFVEPRIEKYGKTFKTRLMGEPTIVVCGAKANMFFMSNEFKLVISS

WPTSSVELMGKNSIMEKKGDIHRFLRGIISSSLTSTSLDNMVPKICNTIQSHLYINCTSH

GQVDRTIKLYHLTKSLTFKIVFECFLGIVVKPGLLETFEGVLEGAFSPPFKFPGSKFSRA

TSARTKVQKFLVEVIREKRNEIEFGRVQNEERKLDESLLSRLVKAMIRGEVSEDEVVDNV

VLLVFAAHDTTSFAIAMTFRMLAQHPTCYSLLLQ (1)

EHANIMSNKRLDEGLSLEDTKKMKYTWQVARESMRLFPPIFGSFRKAIADIEFDGFTI

PKGWK (0) 4067903

33453  VLWTTYGTHNSPEYFKEPQNFDPSRFEEP

VQPYAFIPFGGGPRLCAGYQLAKLNILIFVH

YVVTKYNWSLVDHDEPIVMDPLPFPSKGMPIKISPKF* 4067503

 

>CYP716A44 CYP716A@3 scaffold03154 75% to CYP716A15 Vitis

1174584 MELLYVCLVCVFVFLVSLLLLYKKKSGEGLPPGKTGWPVFGESLEFLSSGWKGHP

1174749 EKFIFDRVAKYSSSVFKTHLLGEEAAVFCGASANKFLFSNENKLVQAWWPNSVNKVFPSS 1174928

1174929 TQTSSKEEAIKMRKMLPNFFKPEALQRYVGIMDHITQRHFATGWENKEQVVVFPLTKRY 1175105

1175106 TFWLACRLFLSVEDPKHVAKFADPFDVLASGLISIPIDLPGTPFNRAIKASNFIRKEL 1175279

1175280 VRIIKQRKIDLGEGKVSSTQDILSHMLLTCDENGKFLGDLDIADKILGLLIGGHDTASS 1175456

1175457 ACSFIVKYLAELPHIYQR (0) 1175510

1175600 LYIEQMEIAKSKGPGELLRWEDIQKMKYSWNVACEVLRLAPPLQGAFREALSDFMFNGFY 1175779

1175780 IPKGWK (0)

        IYWSANSTHKREEFFPDPEKFDPS 1175959

1175960 RFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKFEKIIPHEKIIVNPMP 1176139

1176140 IPANGLPLRLYPHHHNP* 1176193

 

>CYP716A42 CYP716A@1 scaffold02597 59% to CYP716A22 Vitis

302741 MEVVMVPYLLALLFLPLCLMFILRKRDSSSKSLPPGTCGWPLLGENVEFALLGPQKFIKDR

       MEKYSAQVFQTSIMGEKMAFFCGAQGNKFLFSSENKLVTSWWPQSMKKALLFPEFVESSLKQVSALK

302357 RSFLHDILKPEALKQYIPLMDAMARQHLHQNWDSNRVVTVFPLSKKYTFDLACRLFMSLV 302178

302177 DPEEIKRLADPFTLVTNGMFSMPIDLPGTAYHRAIKGGTMVRDELMRIITQRRKELTENQ 301998

301997 ETSGRDLLSKMLLVTDEDGQFMSEMEISNNIIGMLVASFETTSSAVTSVLKYLAELPHVY 301818

301817 DQ (0) 301812

301732 xMTEQMAIAKSKGAEDLLTWEDIEKMKYSWNAARESLRLTPPAQGSFRETITDFTYAGFTI 301553

301552 PKGWK (0) 301538

301463 TFWSVHSTHKNPKYFSDPEKFDPSRFEGSGPAPFTFVPFGGGPRMCPGKEYARLEVLVF 301287

301286 MHNVVKRFKLEKEIPDEKIVFHASPVPVYGLPVRLLPHGN* 301164

 

>CYP716A43 CYP716A@2 scaffold02597 frameshift = & 57% to CYP716A21 Vitis

308199 MDPFILYSLAFALVYISLYFIFKGNYSNNKHTNLPLGSNGWPILGENIDMAYSSSPEKFIHERMEK

HSSQVFKTSLLGQK &

SRFFCGTSGNKFLFSNENKLLTTWWPPSLTKPLMCPTQSQSQNSVKEIALLNRGFLRE

ILKPENLKQYIPFMDSMARDHLKQEWIPFKEVKIYPLVKKYTFSLACKLFLSIDDFRHVK

KLSDPFVLVTSGMFTVPINLPGTPYNRAIKGGKMVHEELMKIIKERKINEKNNHSND   

LLSQLISFSDENGQFMNDAEIYNNIIGLLVASYDTTSAAITFVLKYLAELPNIFNEVYK (1)

       EQMEIAKSKGEGELLNWDDIQKMKYSWNVACEAIRLM 309742

309743 PPAQGAFREAITDFTFGGFTVPKGWK 309820

309916 TFWSVYSTHKNPKYFPEPEKFDPCRFEGSGPEPYTFVPFGGGPRMCPGKEYARLEILVF 310092

310093 MYNIVTNFKLEKLVPHEKIIYKSSPVPLNGLPVRIQPIA* 310212

 

>CYP716A46 CYP716A@5 scaffold04687 74% to CYP716A15 Vitis

758115 MELFYASLVCLFVLLLSLSFLFLFNKKNKSMILSCP

758223 LPPGNSGWPVIGETLEFLSTGWKGHPEKFIFDRISKYKSSIFKTHLLGEKAVVFCGASSN 758402

758403 KFLFSNENKLVQTWWPSSVDKVFPSSTQTSSKEEAIKMRKMLPNFLKPEALQRYIRIM 758576

758577 DHIAQKHFQSWENQQEVVVFPLAKRYTFWLACRLFVSVEDPNHVARLADPFDVLASGLI 758753

758754 SIPINLPGTPFNRAIKASNFIRKELVAIIKQRKIDLTEGKASDSQDILSHMLLTSDENGK 758933

758934 FMHELDIADKILGLLIGGHDTASSACAFIVKYLAELPEIYDQVYK (1) 759068

759716 EQIEIAKSKGPGELLSWEDIKKMKYSWNVACEVLRLAPPLQGAFREALVDFTFNGFSIPKGWK (0) 759904

760774 IYWSANSTHINPEVFVDPLKFDPSRFEGNGPAPYTFVPFGGGPRMCPGKEYARLEILVF 760956

760957 MHHLVKRFSWKKIIRDEKIVVNPMPIPANGLPIRLYPHHVKT* 761085

 

>CYP716A45P CYP716A@4P scaffold04687

526183 LYWNSNTTYRNPEYFREPLNFDPSRFEGSGPAPYTFVPFGGGPRMCPGKEYARLEILVF 526359

526360 MHHLLKRFKWNKLIHDENIIIDPMPVPAKGLPIKLYPYQLH* 526485

 

SL2.30ch07 53490064-53490366 (+) strand

 

>CYP716C6 CYP716C@6 scaffold03187 64% to CYP716C4 Vitis

2446933 MDAIDLSTIFLVVFSFILTIILYQNRSSKNTKLPPGSFGWPVIGETIEFLFSNPEDFVRD 2446754

2446753 RMNKYSRDIFKTKIMGEKTVVICGPNGHKFLFSNEEKLFTVFRTHSMQRIFRSYQSKNPS 2446574

2446573 LSHSQSQSTRVIRQPGFLKPESLARYLGEMDCITKELLRDKVEIKMYDFAKILTLT 2446406

2446405 LASRFFLGSSERMVKLVDCFDDVALGLHAMILNVPGTAFYRANKAAVAIRRELIHVIK 2446232

2446231 EKKDEISKGVKTQDVLCHMIVVKDNNGVSMGENEIADKIMGLLVAGYSTVATTITFLV 2446058

2446057 KYVGERFDIYGKILN (1) 2446013

2445906 EQKEIAATKKEGELLEWEDMNKMKYSWNVICETMRLTPPLQGTFRQ 2445769

2445768 VLTDFTYAGYTIPKGWK 2445718

2444890 VYWTTSSTNKNPLYFEEPQVFDPSRYEKCDGPIPYTYVPFGGGPRMCPGKEYARLAILTF 2444711

2444710 LHNVVMKYKWELLLPNEKIVGDMMPTPQNGLPIRLHHHQ* 2444591

 

>CYP716H1 scaffold05103 93% to CYP716H1 potato ortholog

note called CYP71H2 on nomenclature pages (fix)

2096436 MDLFLLSFATTLTIIIYSLFKYFFAKPKEKMP

2096340 LAPGTFGWPIIGETIQFLFSLYYGLVHEFVQERTKKYNSHVFKTSLLGQKVVVFSGPAAN 2096161

2096160 KFIFTRGNKLIIGWRPKSVQKLFPSTSFVPIEHDTKRAHNVISYFLNSQNVERLTSTM 2095987

2095986 ENMSHLHLKNHWKGKNEVMVYDQVKLFTFSLSIRAFMGIEDSDKILNLYEKFKIFTQGLL 2095807

2095806 AVDINLPGTTFYKAMKAGNELRKQMKVIIKQRRVELFENPNLSKVDVLTQMINEQDEDGK 2095627

2095626 YMTEVEIEDKVFGFIIGSYDTTATTITLTMKYLQQMPEFFNEIIQ (1) 2095492

2095178 EQNEISRQMMPRKELCWNDIQKMRKTWSFVNEVLRNTPVVQGIFREAIEDFTYEDFYI 2095005

2095004 PKGWK (0) 2094990

2094694 IYLSFGATQKNGEYFPNPTKFDPSRFEGNGLVPYTSVPFGGGHRMCPGKEFARILILVF 2094518

2094517 LHHLLKNFRWEPKVPLEKILYPFFLLAIPTDGYPITLSSI* 2094395

 

>CYP716Q1P CYP716x@1P scaffold01241

2026288-2030264 (-) strand

52% to CYP716A33P Vitis 53% To CYP716D4 Stevia

pseudogene with stop codon, insertion and frameshift at C-term

93% to CYP716X.2 potato (full length gene)

This gene has been lost in the tomato

2030264 MEIPAYVLLLPLALFIIIVIVMRRKRLNYPPGSCGWPYLGETLDFLNANKEGKPEKFVKERI 2030079

2030078 EKYKSKIFKTSLMGETVVVLGGASGNKFLFSNENKQVVIWWPASVRKLIGSCLITTVG 2029905

2029904 KEAKIMRKMLSTFVSPDAFSRLYIKTMELVAHHHFMNYWQ 2029785

2029127 GKEKVKVFPLVKLYTFKVACQLFMSIEDKNEIERLSREFNLLLKGLISLPINLPGTSF 2028954

2028953 YKAMKGTTAIRKELLQV 2028903

2028882 VVKKRREALEQKIASPSQDILSHLLSCPDENGKYMSELLIVNNILLFLFAG 2028730

2028729 HDTSSVTLTLLIKRLAEHPQIYQNIL 2028652

2028526 AEHIEIASSKKEGEFLNWDDIQKMKYSCNVVSEVMRLTPPIMGAYREAIVDINYGGYHIP 2028347

2028346 KG*K (0) 2028335

2027752 FYWNTGLTSLDPEIFPNATSLEPSRFEGVGPAPYTYIPFGGGPRMCVGKEFARLEILIFLH 2027570

2027569 ILIRKFNWKLL 2027537

ISNEKMTYDPMPTPLEGLP & 37527964

ISLQPHNY* 2026288

 

SL2.30ch01 37524167-37527992 (+) strand

 

>CYP716Q1P Pimpi WGS contig 6732485, frameshift in exon 2

1631 MEIPAYVLLLPLALFIIIVIVMRRKRLNYPPGSCGWPYLGQTLDFLNANKEGKPEKFVKE 1452

1451 RIEKYKSKIFKTSLMGETVVVLGGASGNKFLFSNENKQVVIWWPASVRKLIGSCLITTVG 1272

1271 KEAKIMRKMLSTFVSPDAFSRLYIKTMELVAHHHFMNYWQ 1152

492 GKEKVKVFPLVKLYTFKVACQLFMSIEDKNEIERLSREFNLLLKGLISLPINL 334 &

333 PGTSFYKAMKGTTAIRKELLQVVKKRREALEQKIASPSQDILSHLLSCPDENGKYMSEL 157

156 LIVNNILLFLFAGHDTSSVTLTLLIKRLAEHPQIYQNIL 40

 

>CYP716Q1P Pimpi WGS contig 6612513

1043 AEHIEIASSKKEGEFLNWDDIQKMKYSWNVVSEVMRLTPPIMGAYREAIVDINHGGYHIPKGWK 852

 269 FYWNTGLTSLDPEIFPNATSLEPSRFEGVGPALYTYIPFGGGPRMCVGKEFARLEILIF 93

  92 LHILIRKFNWKLL 54

 

 

 

 

 

>CYP728B21P CYP728B@1P scaffold07408 pseudogene 66% to  CYP728B5 Vitis

1449784 IILGDRCLLEMNDEDHKR 1449837

INLPSTRCNHGLKASKDVQKMLKQ

ASFHQDLITCLRSIPGENKQELVSENEIIHNVMLIMVAGYETSSVLITFMVRVLAKNPNIHAA

1450305 LTWEDLGNMKYTWRVAMETMRPFPPIFGGFRQTVKDIEYGGNLIPKGWL (0) 1450457

QNTASLPPYNFVPFGGG

PRICPGYEFAKIETLVTIHYLIT 1450761

1450762 HFTWNLYCTDDFFSRDPMPVPTQGFPIQIIPRKPL* 1450869

 

SL2.30ch07 63836311-63837396 (-) strand

 

>CYP728B22 CYP728B@2 scaffold07408 68% to CYP728B6 Vitis

1452006 MNFIVTIFLFLLPVFLLLVRRRRSLTRV

1452090 PPGSLGFPIIGQSFGMLRAMKANTAEKWLEERVQRYGPISKLSLFGKPTVFIYGQAANKF 1452269

1452270 VFTSDCSVLTNQQPQSVKMILGNRCLLELNGEDHKRVRDALVSFLKPDCLKRYVGKMEE 1452446

1452447 EVRIHVETYWKDKQIIK (0)

1452631 VLPLMKTLTFNIICSLLFGLERGAQRDQMIHYFQQMIEGIWSIPINLPFTRFNCSLKASKDVQ 1452819

1452820 KMLKQLVSEKHHEFDNNLASSHQDLITCLLSIRGENNQELISETEIIHNVMLIMVAGYDT 1452999

1453000 SSVLITFIVRLLAKYPNIYTAVLK (1) 1453071

1453157 EQEEIAETKSPGESLTWEDLGKMKYTWRVAMETMRMFPPIFGNFRQTVKDIEYGGYLI 1453330

1453331 PKGWQ (0) 1453345

1453462 IFWVTTKTHMDSSIFQEPEKFDPARFENSASLPPYNFVPFGGGTRICPGYEFAKIETLV 1453638

1453639 TIHYLVTHFTWKLCCTDDFFSRDPMPVPTQGLPIQIVPRKPL* 1453767

 

>CYP722A1 scaffold02164 62% to CYP722A1

2581699 MFSWFWYIFPCLGLLLLQIIWYNNTGKTPAK

2581636 KIPAGNRGIPVIGETIQFMATINSNKGFYDFIKIRRLK (2) 2581523

2580639 YGNCFKTNIFGQTHVFISSTEATKKILSNEKGNFTKRYIKSIAKLVGDQSLLCASHQYHKSIRS 2580448

2580447 QLSNLFSTTSLSTMVRQFDELTINNLSTWHKKSSIIILHEALK (0) 2580319

2579560 ITLEAICKMLMSLENKEELEMLHKDIGLIYEAMLSFPLRLPWTRFYKGLQ (0) 2579411

        ARKRIMNLLDRIIEARRTSNKKYDDFL 2579222

2579221 DYLLIKDNQIIQLTNEQIKDNILTMIIA (1)

2579086 GQDTTASAITWMVKYLDENPKALNNLR (0) 2578952

2578460 AEQQALQQKVSCKAYLTFEDLNCMPYASK (0) 2578374

2577982 VVKESLRMASIVPWFPRMALQDCEIE (1) 2577905

2577825 GFTIKKGWIINVDAKSIHFDPMIFHDPHKFIPSRFD (0) 2577727

2577554 DDSKPYRFLAFGMGGRTCLGLHLARAMMLVFVYRLTTSYR (2)

        WKVLDSDESIQRWTLFSRL &

        KSGCPIHVTSIEEERDSPNPSKT* 2577201

 

>CYP720A1 CYP720A1 scaffold03823  75% to CYP720A1 Lotus ortholog

1131093 MEIYSEYCVLIIITLFSLIFIIKYYKKSKSQYGNTKKFPPGRRGWPIIGDSFNWYNAVASSHPPCF 1130932

1130931 VEQQVQK (2)

        YGKIFSCSLHGKWAVVSVDPVF 1130752

1130751 NKFVMQNEGKLFQSSYPKSFRDLVGKNGIITAQGEQQRKLHSIASNMMRLDKLKFHFLND 1130572

1130571 IQRVIQETLNNFQHNEVILLQDVCRK (0) 1130494

1130341 LAINLMVNQLLGVSSESEVNEMAQLFSDFVDGCLSVPINMPGFAYHTAMK (0) 1130192

        ARENIIIKINKIIE 1129544

1129543 THRKEASNGNGVIYRLLEEESLPDEAVADFIINLLFAGNETTAKTMAFAVYFLTQSPK 1129370

1129369 AMKQLQ (0)

1128972 DEQESFRNEKGSNFDNEEMLSWQDYKAMPFTQC (0)

1128769 VIDETLRLGGIAIWLMREATNDVVYG (1) 1128692

1128231 DYVIPKGCFVVPFLSAVHLNENIYDEPRIFNPWRWMNPENQ (0)

        EKRNWRSSPFFAPFGGGGRFCPGAELSRLQIALFIYYFVTNYR (2) 1127881

1127707 WKQVKEDRMSFFPSARLVNGFQIQLTRN* 1127621

SL2.30ch03 6766759-6770270 (-) strand

 

>CYP724B2 scaffold07408 74% to CYP724B13 Vitis

ESTs BI926091 AW615836  BI204653  AW615967.1

3929878 MGEEGSLLIIVITLVFSFVIGITLNHFWPLFFNNYGTTLHVIPKG

TFGWPLLGETLSFLKPHPSNSIGTFLQQHCSRYGKVFKSHLFFSPTVVSCDQDLNYFILQ

NEDKLFQCSYPKPIHGILGKVSLLVAVGDTHKRLRNVSLSLISTIKSKPEFINDVETLAL

QILQSWKDKHQVRYWEEARKFSFNVIVKQVLGLTPDNPQSALILQDFLAFMRGLISLPLY

IPGTPYARAVQARSRISSTIKAIIEERR

RKHVVDGDGKKNDFLEILLCVDTLSEEEKVSFVLDSLLGG

YETTSLLMAMVVFFIGQSQTAFDRLK (0)

EEHDNIRSTKEKELLNWEDYQKMDFTQKVINEALRYGNVVKFVHRKALKDVKFKDYVIPAG

WKVLPVFSAVHLDPSVHPNALHFNPWRWESDEQISKKLTPFGGGSRCCPGFELAKVEVA

FFLHHLVQKYRWEVEEGEQPIAYPYVEFKNGLTIRLHKNST* 3925685

 

>CYP733A1 scaffold03736 BE435480.1 EST 76% to CYP733A1 Vitis

364123 MDLIIFIVMLLVMVLVVVLLVLLRTNK

364042 ASPKEMEAIPGTLGWPIIGESLSFISEFSSPAGIYSFINKRQKL (2) 363911

363644 YGKVFKSYVLGRYTVFMTGREASKILLTGKDGIVSLNLFYTGQQVLGPTSLLQQTGEAH 363468

363467 KRLRRLIAEPLSVDGLKKYFQFINSLAIETLDQWSGRKILVLEETST (0) 363327

363246 FTLKVIGNMIMSLEPTGEEQEKFRTNFKIISGSFASLPFKVPGTAFYRGIQ (0) 363094

363017 ARDRMYAMLDSIIDQRRSGENIKQDFLQSLVKKHGKDAPEGDDDDKLTDKQLKDNILT 362844

362843 LLVAGHDTTTAALTWLLKFLQENPAVLERLR (0)

       EEHREIQAQKQGTLDLTWSEVNNMPYTAK (0)

       VISETLRMATILPWFSRKAAQDFEIE   (1)

       GCKIKKGWSLNLDVVSIHRDPKIFPNPEKFDPSRFD (0)

       DPLKPFSFLGFGSGPRMCPGINLAKLEISVFLHHLVCR (2) 362040

361933 WTPLDTDDSVQPTLVRMLKNKYPVMVEPL* 361844

 

>CYP707A7 scaffold02156 CYP707A7 ABA 8'-hydroxylase. 76% to 707A1, 1 diff to submitted seq

729664 MEFVSMLCLFTFISLTLLLIHSIFKFLAFASKKLPLPPGTLGLPYIGETFQLYSQNPNVF 729485

729484 FASKVKK (2) 729464

729357 YGSIFKTYILGCPCVMISSPEAAKQVLVTKANLFKPTFPASKERMLGKQAIFFHQGDYH 729181

729180 AKLRKLVLQAFKPDSIRNIIPDIESIAITSLESFQGRLINTYQEMKT (0)

       YTFNVALISIF 728821

728820 GKDEFLYREELKKCYYILEKGYNSMPINLPGTLFNKAMKARKELAKIVAKIISTRREMKI 728641

728640 DHGDLLGSFMGDKEGLTDEQIADNVIGVIFAARDTTASVLTWILKYLGENPSVLQAVT (0) 728467

728305 EEQENIMRKKEVNGEEKVLNWQDTRQMPMTTRVIQETLRVASILSFTFREAVEDVEFE (1) 728132

728007 GYLIPKGWKVLPLFRNIHHSPDNFPEPEKFDPSRFE (0) 727900

727813 VSPKPNTFMPFGNGVHSCPGNDLAKLEILILVHHLTTKYR (2)

       WSMVGPQNGIQYGPFALPQNGLPIKLSLKTSST* 727466

 

>CYP82V1P CYP82x@2P scaffold06019

3667465-3667780 (+) strand

76% to CYP82S.1

3667465   TQLMVNV*KLHRDPQIWSDPKKFMLNKFMKNHNEISNQNFKFFLFNSDGRS*PSITFAMQ  3667644

3667645   VTHLTLARLL  3667674

          KANPLEVFVMPRLAPMLY &

          QH* 3667780

 

>CYP82V1P CYP82x@2P scaffold00446 ver 1.03

76% to CYP82S1

45045599 VRDSKVSKN

998743   TQLMVNV*KLHRDPQIWSDPKKFMLNKFMKNHNEISNQNFKFFLFNSDGRS*PSITFAMQ  998564

998563   VTHLTLARLLQ

         KANPLEVFVMPRLAPMLY  998438

         QH* 998448

 

SL2.30ch06 45045599-45045941 (+) strand

 

>CYP82V1P Pimpi WGS contig 6584992

2927 TQLMVNV*KLH*DPQIWSDPKKFMLKKFMKNHNEISNQNFKFFLFNSDGRS*PSITFAMQ 3106

3107 VTHLTLARLLQIKVLVLVH*RTYLKANPLEVFVMPRLAPMLY 3232

 

 

>CYP707A8 scaffold00777 CYP707A8 ABA 8'-hydroxylase. 76% to 707A1

6436425 MEFVSMFCLFSFISCSILLLHSVFKLFDCGVKKLPLPPGSLGWPYIGETFQLYSQNPSFF 6436604

6436605 FASKVKK (2)

6436720 YGSIFKTHILGCPCVMISSPEAAKLVLVTKAHLFKPTFPASKERMLGKQAI 6436872

6436873 FFHQGEYHAKLRKLVLRAFKPEAIKNIVPDIESIAITSLQSMQGRLINTYQEMKT (0) 6437027

        YTYNVALLSIFGKDEMLYREDLKR 6437232

6437233 CYYVLETGYNSMPINLPGTLFHKSMKARKELAKMLAKIISVRRETNQNHADLLGSFMGDQ 6437412

6437413 EDLTDEQIADNIIGVIFAARDTTASVLTWILKYLGENPSVLQAVT

        EEQEGIMREGELLSWAHTKKMPMTTRVIQETLRAASILSF 6437754

6437755 TFREAVEDVEFG (1) 6437790

6438021 GYLIPKGWKVLPLFRNIHHSPDNFSEPEKFDPSRFE (0) 6438128

6438224 VTPKPNTFMPFGNGTHSCPGNELAKLEILILVHHLTTKYR (2) 6438343

6438626 WSMMGPQNGIQYGPFALPQNGLPIMLSHKTS* 6438721

 

>CYP707A69 CYP707A@2 scaffold02793 74% to CYP707A38 Vitis

140981 MENISCSIYVLFFLIALLLYYHSSLKKSKWTNLQKAKLPPGSMGWPYIGETLQLYSQDPSVLFA 140790

140789 NKQKR (2)

       YGDIFKTHILGYPCVMLASPEAARFV 140610

140609 LLTYAHLFKPTFPKSKERLIGPSALFFYQGNYHSRLRKVVQSSLAPEALRKLIPEIEDLA 140430

140429 ISALELWAEKNQTINTFRVMKK (0) 140364

140187 FSFEVGILALFGQLDAKYKEELNKNYSIVEKGYNSFPTNLPGTAYYKAMV (0) 140041

       ARRKLNQILSEIISERKEKKTVEKDLLCHLLNFK 139840

139839 DEKGKNLTEYQIADNVIGVLFAAQDTTASALTWILKYISDDQKLLETVK (0) 139699

139396 AEQRTIYESNGGKKPLTWAQTRNMSLTYR (0) 139310

139233 VILESLRMSSIISFTFREAVVDVEYD (1) 139156

       GYLIPKGWKVMPLFRNIHHNSEFFADPQNFDASRFE (0) 138368

138248 VAPKPNTYMPFGNGAHACPGNELAKLEMLILIHHLVTKFR (2) 138129

137625 WEIEVSKGVQYSPFPIPQHGLPSRFWKETRSQRDP* 137518

 

>CYP81B42P CYP81B@6P scaffold02793

696932-697333 (+) strand

86% to CYP81B.6

696932   FKLNPPITHPLLVPHESSEETTVGGYRVPIGTMLLVNLWAIHNDPKLWDEPRKSKPERF  697108

697109   EGLEGVRDGYKMMPFGSGRRSCPREGLVVRMIAL*LGCII*CFDWQRIGDELVDM  697273

697274   T*GTGLTLPKAQLLVATCSP  697333

RTVMFNLLSQI*

SL2.30ch01 86776645-86777082 (-) strand

Added 11 aa at C-term

 

>CYP707A68 CYP707A@1 scaffold02164 83% to 707A25 tobacco

1392829 MVNYFEIFLYISMFVLGYLSYYFCFGKNNNSSSKKNAYK

1392946 LPPGSMGWPYIGETLQLYSQDPNAFFINRQRR (2) 1393041

1393205 FGEIFKTKILGCPCVMLASPEAARFVLVNQANLFKPTYPKSKENLIGQSAIFFHQGDYH 1393381

1393382 NHLRKLVQAPLNPESIRNQIPYIEELSISALNSWVGGHVVNTYHEMKK (0) 1393525

1393851 FSFEVGILAIFGHLDGHVKEELKKNYSIVDKGYNSFPINLPGTLYRKALQ (0)

        ARKKLGKILSEIIREMKEKKTLEKGLLSCFLNAKEEKG 1394210

1394211 FLVLNEDQIADNIIGVLFAAQDTTASVLTWIIKYLHDNPKLLECVK (0)

        AEQKVIWQSNEQENHGLTWTQTRKMPITSR (0) 1394558

1394747 VVLETLRMASIISFAFREAVADVEYK (1) 1394824

1395031 GYLIPKGWKVMPLFRNIHHNPEFFPDPQKFDPSRFE (0)

1395252 NAPKPNTFMPFGSGVHACPGNELAKLEILIMTHHLVTKFR (2) 1395371

1395780 WEVVGSGSGIQYGPFPVPLGGLAARFWKTTST* 1395878

 

>CYP735A19 old CYP735A18 scaffold00090 gene is missing C-term 91% to CYP735A8 potato

End of gene is in a seq. gap

2641300 MAMVVMLFLICILLMSLKIVYETLLSYYLIPKRITKIMEKQGVRGPKPRFLVGNILDMAS 2641479

2641480 LVSESTSNDMDSIHHDIVARLLPHYVAWSKIY (1)

2641658 GKRFIFWNGTEPRMCLSEADLIKELFSKYNSVSGKSWLQQQGSKHFIGRGLLMANGDDWY 2641837

2641838 HQRHIVAPAFIGEKLK (0) 2641885

2641954 SYAGYMVECTSGMLRSLGNAVKSGQVEFEMGEYMARLTAEIISRTEF 2642094

2642095 DSSYAKGKQIFHLLTILQQKCAQASRHLCFPGSR (2) 2642196

2642496 FFP 2642504

 

>scaffold00084 VER 1.03

same as CYP735A19 but intact, 95% to CYP735A8 potato

95% to CYP735A20 tomato

1043911   MAMVVMLFLICILLMSLKIVYETLLSYYLIPKRITKIMEKQGVRGPKPRFLVGNILDMAS  1043732

1043731   LVSESTSNDMDSIHHDIVARLLPHYVAWSKIY (1)  1043636

1043553   GKRFIFWNGTEPRMCLSEADLIKELFSKYNSVSGKSWLQQQGSKHFIGRGLLMANGDDWY  1043374

1043373   HQRHIVAPAFIGEKLK  1043326

1043247   SYAGYMVECTSGMLRSLGNAVKSGQVEFEMGEYMARLTAEIISRTEF  1043117

1043116   DSSYAKGKQIFHLLTILQQKCAQASRHLCFPGSR  1043015

1042715   FFPSKYNRDIKTLKIEVETLLMEIIQSRKDGVEIGRSSSYGNDLLGMLLNEMQKKRSSN  1042539

1042538   GFSLNLQLIMDECKTFFFAGHETTALLLTWTVMLLASNPSW

           qdkvreeinqvckgdsptvdhlpkltl (0) (tomato seq)

1042299   LSMIINESLRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEF  1042120

1042119   RPDRFASKPFSAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPV  1041940

1041939   IVLTIKPKYGVQVKLTPLTT*  1041877

 

SL2.30ch02 43246147-43248181 (+) strand

Lower case seq still missing

 

>CYP735A20 old CYP735A19 scaffold00090 gene is missing C-term 93% to CYP735A8 potato

90% to other CYP735A gene on this scaffold. End of gene is in a seq. gap

2648439 MSMMAVLLLICIILMSLKIAYETLSFYYLIPRRITKIMKKQGVCGPRPRFLVGNIFDMTS 2648618

2648619 LVSKSTSNDMDSIHHDIVARLLPHYVAWSKIY (1) 2648714

2648795 GKRFIFWNGTEPRMCLSEADLIKELFSKYSSVSGKSWLQQQGSKHFIGRGLLMANGD 2648965

2648966 DWYHQRHIVAPAFIGDKLK (0) 2649022

2649115 SYAGYMVECTSGLLRSLENAVKSGQMEFEMGEYMTRLTAEIISRTEFDSSYEKGKQIFH 2649291

2649292 LLTILQKKCAQASRHLCFPGSR (2) 2649357

2649738 FFP 2649746

 

>scaffold00084 VER 1.03

same as CYP735A20 but intact, 96% to CYP735A8 potato = ortholog

1036131   MSMMAVLLLICIILMSLKIAYETLSFYYLIPRRITKIMKKQGVCGPRPRFLVGNIFDMTS  1035952

1035951   LVSKSTSNDMDSIHHDIVARLLPHYVAWSKIY (1)  1035856

1035775   GKRFIFWNGTEPRMCLSEADLIKELFSKYSSVSGKSWLQQQGSKHFIGRGLLMANGD  1035605

1035604   DWYHQRHIVAPAFIGDKLK  1035548

1035455   SYAGYMVECTSGLLRSLENAVKSGQMEFEMGEYMTRLTAEIISRTEFDSSYEKGKQIFH  1035279

1035278   LLTILQKKCAQASRHLCFPGSR  1035213

1034832   FFPSKYNRDIKTLKIEVETLLMEIIQSRKDGVEIGRSSSYGNDLLGMLLNEMQKKRSSN  1034656

1034655   GFSLNLQLIMDECKTFFFAGHETTALLLTWTVMLLASNPSW  1034533

          qdkvreeinqvckgdsptvdhlpkltl (0) (tomato seq)

1033761   LSMIINESLRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEF  1033582

1033581   RPDRFASKPFTAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPV  1033402

1033401   IVLTIKPKYGVQVKLTPLTT*  1033339

 

SL2.30ch02 43253934-43256726 (+) strand

Lower case seq still missing

 

>Solyc02g085900.1.1 83% to Populus CYP735A

same as CYP735A20, 1 aa diff to CYP735A19

MIINESLRLYPPATVLPRMAFEDFKLGDLNIPKGLSIWIPVLAIHHSEEIWGKDANEFRPDRFASKPFTAGRNFLPFAAGPRNCVGQSFALMEAKIILAMLISKFRFTISENYRHAPVIVLTIKPKYGVQVKLTPLTT*

 

note: potato CYP721A.1 fragment is CYP735A8 (fix this)

 

>CYP734A7 scaffold04007 

2745324 MEGFCFQWLCVILFLYVLLLCIQKAFVHLWWTP