A tomato EST project has generated more than 26,000 ESTs, with 8616 deposited in 
March, 11789 in June, and 5394 in July 1999.  These have now been searched for P450 
containing sequences.  There are 235 P450 coding tomato ESTs.  This is similar to the 252 
Arabidopsis P450 ESTs.  These sort into 58 contigs, that include 5 complete genes 
(CYP51, 73A24, 76A6, 88B1 and 707A4) not known previously from tomato.  There are 
almost the same number of P450 ESTs in tomato and Arabidopsis, even though 
Arabidopsis has almost 38,000 ESTs.  Part of this can be explained by the very large 
number of ESTs for 88B1 (47 ESTs) and 707A4 (29 ESTs).  These genes are both in the 
CYP85 clan.  Other members of this clan are involved in plant hormone biosynthesis 
(brassinosteroids) as in CYP90A [Arabidopsis DWF3], CYP90B[Arabidopsis DWF4] and 
CYP85 [tomato dwarf] see Trends in Genetics Dec. 98 14, 490-495.  CYP88A1 [maize 
dwarf3] catalyzes an early step in gibberellin biosynthesis.  It is likely that the new 88B1 
will also be involved in this process.  Most of these ESTs are from tomato ovary.  The 
large number of ESTs for 88B1 and 707A4 suggest that these genes are very active in 
tomato ovary.

Only one EST seems to fall outside the existing set of 44 P450 families in plants. 
AI490089 is only 31% identical to any other plant P450.  However, this EST is from the 
middle of the gene, so it might associate with a known family when the full length 
sequence is known. The other 57 contigs belong to 22 families.  These results indicate that 
the present coverage of P450 families is pretty complete, at least in the eudicots.


235 Tomato P450 ESTs (from 26255 tomato ESTs = 0.9%)
Assembled and sorted into 58 different sequence contigs 
(CYP51, 73A24, 76A6, 84A2, 88B1, 707A4 are complete) 
Only CYP84A2 and CYP85 were known before, and CYP85 has no ESTs.
The five genes CYP51, 73A24, 76A6, 88B1 and 707A4 are only known from this 
assembly of ESTs.
Last modified Sept. 1, 1999

CYP51 complete
AI484014  EST249885 cLED22P20
AI771214  EST252410 cLED29K11
AI771863  EST252963 cLED38M17
AI490659  EST249213 cLED24M21
AI898383  EST267826 cLED33O15
AI777750  EST258629 cLES2P6
AI490739  EST241447 cLEB3D8
AI490746  EST241454 cLEB3D8
AI773859  EST254959 cLER8M8
AI771494  EST252594 cLED29H14
AI490407  EST248721 cLED21D12
MELGDNKILNVGLLLVATLLVAKLISALIMPRSKKRLPPVVKAWPIVGGLIRFLKGPVVM
LRQEYPKLGSVFTLNLLNKNITFFIGPEVSAHFFKAPETDLSQQEVYQFNVPTFGPGVGF
DVDYTIRQEQFRFFTEALRVTKLKGYVDQMVTEAEEYFSKWGESGEVDLKYELEHLIILT
ASRCLLGEEVRNKLFDDVSALFHDLDNGMLPISVIFPYLPIPAHRRRDNARKKLAEIFAN
IINSRKRTGKAENDMLQCFIDSKYKDGRPTTEGEITGLLIAALFAGQHTSSITSTWTGSY
LLTNDKYMSAVVDEQKNLMKKHGNKVDHDILSEMEVLYRCIKEALRLHPPLIMLLRSSHS
EFSVTTREGKEYDIPKGHIVATSPAFANRLPHIFKNPDTYDPDRFGPGREEDKAAGAFSY
ISFGGGRHGCLGEPFAYLQIKAIWSHLLRNFEFELISPFPEIDWNAMVVGVKGEVMVKYK
RRKLS

CYP71A
AI485927  EST244248 cLED4A21
AI488529  EST246868 cLED23H18
67% to 71A1
YSEYWRQVRSVIVLHLLSNKRVQSFRDIREEEVSNMIDEIRKRSTSSSNSVIDMRDVLSC
MTNNIINRVTIGRTYNEGESGRAVKALLEDLLALLGTFNIGEYIPWLKWLNKINGLDNRV
KKVAKDLDAFLDSVIEERVFRNKKAENSTGEAKDFVDVLLEIQNGNETGFPLQRDSLKAI
LLDSFIAGVDSIYTTLEWIMIELLRNPRAMEKLQNEVRGLVQGKAEITEDDLRNMLYLKA
VIKE

AI896171  EST265614 cLEC14E8
51% to 71A5 middle region
INHSIGNSQVVDLTDLFVSMTNDVLCRVALGRKYCDGEEGKKFKSLLLEFVELLGVFNIG
DYMPWLAWVNRFNGLNAKVDKVAEEFSAFLEGVIEEHKEKIKTDEKEEGSADFVDILLQV
QKENKSGFNVEMDSIKAIIMDMFSAGTDTTSTLLEWTMNELIRN

AI771748  EST252848 cLED35K17
59% to 71A9
MLA*LFLFLFILFSLTTKKNKAKKLLPSPRKLPIVGNLHQLGKLPHRSLQKLSHEYGDFI
FLQLGSIPTLLVSSADVAKEIFRVHDVAFAGRPPLYAAKRLSYNCCNVSFAPYGNYWREA
RKILALELLSAKRVESFSSIRDEEVSRLIQEIGNSLNSSINISALALT

AI489371  EST247722 cLED16B17
60% to 71A9
ELILNPKVMKKVQQEVRQVAKGKTKVHETDLYKLEYMKLVIKEALRLHPPAPLLIPRVTT
STCKIMDYEIKENTRVLINATAIGTDPKYWENPLTFIPERFMNKDIDYKGQSCEFLPFGA
GRKGCPGINFSVPLVELAIANLLFHY

AI771367  EST252467 cLED29M16
AI489137  EST247476 cLED15E15
AI894642  EST264085 cLEC4L4
37% to 71A1 probably new 71 subfamily 2-310
LIWEVVVVVSIVYVLYELLNIHKRKKLPPGPRGLPIVGHLHLLGKNPHHDFQNLAKKYGP
IMYMRLGLVPTIVVSSSDVAEKFLKTYDHIFANKPHNEAAHYLAYGQKNIIFAKYGPYWR
NMRKLCTQHLLTNQKINSFQSLRSQQVELMIESLQNESRGERVVVDLSERVASLNANMTC
LMVFGKKYMDEDFDKRGFKAVLQEVVHLAAITNLGDCFPFLGVIDLQGLTRRLKDLSEVY
DEFLEKIIDEHVESHDENQTKDFVHTMLEFMQSGKAEFQFDRIHIKAVLFDMIVAAIDTS
ATTIDWIL

AI777985  EST258864 cLES3J13
43% to 71A1 75% to AI771367 cluster 1-156
MTLIWETIVVICIVYALYELLNIHKRKKFPQGPKGIPILGHLHLLGKKPHHDLQNLAKKY
GPFFYIRLGLIPTYIASSVDTAEKFLKTYDHIFATRPHNEAAKYLSYGHKNLVFGTYGPY
WRNMRKLVTLDLLTHQKINSFQSVRTEQVDLMIQSL

AI896229  EST265672 cLEC14O18
46% to 83D1, 40% to 71A1 71% to AI771367 cluster
MAFIWATLVVIFVVYTLLNNIQNRKRYPPGPKGLPIIGHLHLLGKNPHKDLQKLANTHGP
FMYVRLGLVPTIIVSSAGAAEKVLKTYDHIFASRPHMEASYYLAYEQKNLISAKHGPYWR
NMRKLCTQHLLSNQKINSFQSMRREQVELMIKSL

AI896104  EST265547 cLEC13J4
61% to 71D6
79-269
VTSPIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSG
KNVRSFGSIRQDETIRLVEFFRSSSSSEPVNVTKRISLFTSFIICRSAFGTIFKEQDEFI
QVMKGVTSLLEGFNVADIFPSLKFLHVLSGMKSKTMYLHHKVDTIVENVINEHKKNLVNG
KTNGEL*GEE

AI490387  EST248713 cLED21F14
AI771126  EST252226 cLED28H13
AI485818  EST244139 cLED4O17
AI899238  EST268681 cLED37P22
AI489726  EST248065 cLED14P15
AI488487  EST246826 cLED23D16
55% to 71D6
HQKMFKDRDEFIKLLKDILILASGFYVTDLFPSWKLLHKLSGAESRLMNVHKKIDEIMED
ILKEHLENKANRNKRIGDQLGGEDLVDVLLNLMEDAELECPITNDHIKAVILDVFIAESD
TSSTVTIWVNDEKSKNPNIMAEVREVFRGKKNYDDEEDLEKLTYLKLVIKETLRLHTPAP
LLGPRDANKNVDGYTIPLKTKVLIN

AI488722  EST247061 cLED13N15
AI488087  EST246409 cLED20G5
AI487210  EST245532 cLED6G15
48% to 71D8 N-terminal
LIFLPLLLAIVKNHKKSKKLPPGPWKLSIIGNLHQLEISRPYITLKELSKKYGPLMHLKL
GERSTIVISSYKILKELMKTSDTILSHRPELLVSETVAYNGRDIAFAPYGDYWKQMRKIC
TSEILSTRRIHSNYPLMEEEISRLVKNIKESSSKGTLINVYECLNSLSCAIICRATVGTT
CNDSDSLISTIRKITPLVGFNISDLFPSLSFSIDILQDLIK

CYP72A
AI895117  EST264560 cLEC6H14
AI896438  EST265869 cLEC15C15
AI896396  EST265827 cLEC14L12
AI895895  EST265338 cLEC10M4
AI772781  EST253881 cLER4G13
AI895096  EST264539 cLEC6D20
AI896770  EST266213 cLEC23F5
AI894741  EST264184 cLEC5B6
AI894430  EST263885 cLEC4A4
55% to CYP72A1 75% to AI781728
MDIPYNFKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKE
MSKMGEEAWSKPVNFSHDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEV
MMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNE
MLSKWEKIVSREGSEIDVLPYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVS
RTIYIPGWRFLPTKRNKRMKQIFNEVRTLILEIINKRMRMIEAGESHDDLLGILLSSNLK
EIQQHGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDRAREEVLQV
FGSNEVDYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVKTKTKLGNLCLPSGVQLLLPTI
LLQHDTKIWGDDAMEFNPERFSDGILK

CYP72A
AI484240  EST248467 cLES1M11
AI484253  EST248480 cLES1M11
AI487667  EST245989 cLED13M7
AI483046  EST242369 cLEB3P22
AI897551  EST266994 cLED27N8
AI485046  EST243350 cLED7G18
AI899167  EST268610 cLED37O10
AI899100  EST268543 cLED37A10
AI483050  EST242373 cLEB3P22
58% to 72A2 missing N-terminal
SAFLKLFVTGLGTYDGEKWAKHRKILNPAFHMEKLKVMLGLFVECTDDMISRWDKLTGST
GSCELDISQEFHNLTGDMLSKAAFGSNFEEGKLVFSLLREQCELIFTAKLAINVEPWLRF
VPTKTNRRRLYIYNTVRSSLKSIIEKREKEVQSGKSHNEDLLGLLMKSNQEEQQGNMNSN
KGMSTEDMIEECNSFYFAGQETTATLLTWTAIVLTMHPDWQEKARKEVLQVIGKDEPKFD
QLNHLKIVTMILHEVLRLYPSGSLVRETNKKTKLGGYTIPAGAQLLVPLQTIHRDTEAWG
EDALIFNPERFSEGVSKASKDLMYFPFGWGSRICLGMNVSMIQGKLVLAKILQNYSFELS
PSYAHGPTMPALVLQPQYGAPMIVRKLE*

CYP72A
AI485298  EST243602 cLED5C5
AI898152  EST267595 cLED31J14
AI485472  EST243793 cLED4H21
AI771741  EST252841 cLED35I21
AI486402  EST244723 cLED5D10
AI898614  EST268057 cLED34F24
AI897347  EST266790 cLED27M23
AI771332  EST252432 cLED29O15
AI771422  EST252522 cLED29J13
AI781257  EST262136 cLES14N4
62% to 72A15 63% to AI781728
PDWQERAIEEVLQVLGSRKPDFDGL
NHLKVVTMILYESLRLYSPITVLTRRVYEDITLGEVSLPTGVLVSLPMILLHHDKDIWGE
DATKFNPERFSEGISSATKGQVTYFPFAWGPRICIGQNFAILEAKMTLCMILQSFSFELS
PSYTHAPQSLVTTQPQYGAPLIFHKL

CYP72A
AI781728  EST262607 cLES16N4
this is a unique seq. but there are many closely related to it.
65% to 72A15
NQLKVVTMILNEVLRLYTSVYAINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGD
DAMEFMPERFSEGISKATKGQVVFFPFSWGPRICIGQNFAMLEAKMAMVMILKHYAFELS
PSYAHAPHPLLLQPQYGAQLIMHKL*

CYP72A
AI899618  EST269061 cLES14G3
AI779270  EST260149 cLES7P7
72% to 72A7 85% to AI781728
FSDGILKAPKGQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSHAPHP
LMLQPQFGAPLILYKL*

CYP72A
AI490392 EST248730 cLED21L4
AI490932 EST241641 cLEB3G5
AI774016 EST255116 cLER9K19
67% to CYP72A2 N-terminal
MAIVTVIGATIGILIALFFVKSFYTLWWWPKMIEKKLKKEGIHGQPYQFLFGNLKEMTRM
SREAKKKPLVNHDIVPWVNPFILHLSKTYERLFVMWAGPTPRITVTDPKLIKEVVNRHNE
FQKPQANAFIDMFVTGLASYNGQKWDHHRKILNPAFHIEKIKRLYPAFCECCD*MINKW

CYP72A
AI776710  EST257810 cLER19F21
AI779005  EST259884 cLES6H10
AI484366  EST249014 cLES1G11
AI782844  EST263723 cLES20P12
AI778910  EST259789 cLES6F7
AI484355  EST249003 cLES1G11
80% to 72A2 C-terminal half
SNRRARYIYKKVLSLIKGIIEKKEDAMRRGVSESDDILGLLLKGGLSTTEIIEECKEFYL
AGQDTTTALLSWTLVALSMHPEWQDKARNEVFQVLGKNKPKFEDLNQLKIMNMIFQEVLR
LYPALTLMRSTSKDTKLGEMTIPAGVQIFVPIYIAHRDPQVWGDDALIFNPNRFSEGVSK
AAKEPLYFPFGWGPRMCIGNNFGMAEAKLVLSQILQRFWFKLSPSYVHAPQAILVMKPQY
GAQIILNKL*

CYP72A
AA824943 CT226
AI895869  EST265312 cLEC10G22
64% to 72A15 80% to AI781728
DLLGILLESNMKEIEQHGNKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPE
WQVRAREEVLQVFGNEKPDLEGLSHLKIVTMILYETLRLFPPLPVFSRRNKEEVKLGELQ
LPAEVILIIPAIFIHYDKEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQ
NFAMMEAKMAIAMILQKFSFELSPSYTHAPFATITIHPQYGAPLLLRKH*

CYP73A24 complete
AI484139  EST248946 cLER1C5
AI484136  EST248943 cLER1C5
AI490789  EST241497 cLEB3H9
AI490786  EST241494 cLEB3H9
AI774139  EST255239 cLER10B22
AI894646  EST264089 cLEC4L12
AI774477  EST255577 cLER12O4
AI895653  EST265096 cLEC9O20
AI899232  EST268675 cLED37P6
AI774140  EST255240 cLER10B24
AI773934  EST255034 cLER8N1
AI487946  EST246268 cLED19L20
AI484879  EST243140 cLED3A21
AI894393  EST263848 cLEC4G23
AI895830  EST265273 cLEC10A6
AI895463  EST264906 cLEC7J20

MDLLLLEKTLIGLFFAILIAIIISKLRSKRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTE
YAKKFGDVFLLRMGQRNLAVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFT
VYGEHWRKMRRIMTVPFFTNKVVQQYRGGWESEAASVVEDVKKNPESATNGIVLRKRLQL
MMYNNMFRIMFDRRFESEDDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK
ICKEVKEKRLKLFKDYFVDERKKLANTKSMDSNALKCAIDHILDAQQKGEINEDNVLYIV
ENINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGVQVSEPDMPKLPYLQAV
IKETLRLRMAIPLLVPHMNLHDAKLAAYDIPAESKILVNAWWLANNPAHWKKPEEFRPER
FLEEEKHVEANGNDFRFLPFGVGSRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKLD
TSEKGGQFSLHILKHSTIVMKPRSF*

AI896244  EST265687 cLEC14D9 74
AI896772  EST266215 cLEC23F9 74
AI777993  EST258872 cLES3L11 74
AI776315  EST257415 cLER18I15 74
NISSNTFVSLTLPTIFFCSMALTLSFSLPLPSLHQKIPSKYSTFRPIIVSLSDKSTIEIT
QPIKLSTMTIPGDYGLPGIGPWKDRLDYFYNQGKNDFFESRIAKYKSTIFRTNMPPGPFI
TSNPKVIVLLDGKSFPVLFDASKVEKKDLFTGTFVPSTELTGGYRILSYLDPSEPNHEKL
KKLMFFLLSSRRDHVIPEFHETYTELFETLDKEMEEKGTVGFNSGSDQAAFNFLARSLFG
VNPVETKLGTDGPALIGKWILLQLHPVITLXVPNFLEDLMLHTFQLPFFIIKSKYQKLYD
AFNEHAGSTLDDAEKSGIKRDEACHNLEIHTRLANEIRSEVKSAGGKITMSAMEKMPLMK
SVVYEALRVDPPVASQYGRAKQDLKIESHDAVFEVKKGEILFGYQPFATKDPKIFDRPGE
FVADRFVGEEGEKLLKHVLWSNGPETESPTVGNKQCAGKDFVVMVSRLFVTEFFLRYGTL
NVD

AI484576  EST242806 cLED2O15 74 LIKE
AI488898  EST247237 cLED18G17 74 LIKE

RPCAFLDPSEPSHATHKGFYLSIISKLHTQFIPIFENSVSLLFQNLEIQISKDGKANFND
ISDAMSFDFVFRLLCNNTNPLDTKLGTTGPKCFDLWMLPQLAPLVTLGLKFVPNFLEDLM
LHTFQLPFFIIKSKYQKLYDAFNEHAGSTLDDAEKSGIKRDEACHNLVFLAGFNAYGGMK
ILFPSLMKW

CYP76A6 85% identical to 76A2 complete
AI779370  EST260249 cLES7J14
AI779369  EST260248 cLES7J14
AI488667  EST247006 cLED18N24
AI895030  EST264473 cLEC6H17
AI771692  EST252792 cLED34O18
AI774262  EST255457 cLER12I1 5 prime end = ARG10 homolog on reverse strand
AI779703  EST260582 cLES8J16
AI895857  EST265300 cLEC10E22
AI777873  EST258752 cLES3C24
AI777872  EST258751 cLES3C24
MEWELSYLFFSSIILLSIFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMAALK
QKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPALAR
YGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRFVF
LASFNMLGNLILSKDLADPESEEASEFFHAMKGIMEWSGVANVSDVFPFLRKFDLQSLRK
KMTRDMGKAMEIMSMLLKERKKGMEKMKDFLDVLLEFEGTGKDEPAKLSEHEIKVFILEL
FLAGTETTSSSVEWALTELLRHPQAMAEVKTEISKAVGSNNKFEESDIENLPYMQAVIKE
SLRLHPPLPFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPERFLG
SKLDVKGQHYELIPFGARRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSPKSINMDE
SMGVTARKRDSLKVIPKKV*

76 family
AI897760  EST267203 cLED30H11
AI897763  EST267206 cLED30H17
AI484957  EST243220 cLED2D16
57% to 76B1 C-terminal half
AREDNPQDIDRKHIATILLDLFNAGTDTSSNVVEWAMTELLRSPDIMKKVQAELVQVLGE
GNLMEETDVARLPYLQCIIKETYRMHPPAPFLVPRKVEQDVELCGYTVPKGSKVLINVWA
IGRDSTLWEDPLVFNPDRFKDSKLDVRGQDFELIPFGAGRRICPGLPLAIRMVPVLLGTM
LNTFKWKIEGDIAPNDMDMQEKFGLTLAKLRPLRAVPLSL*

76 family
AI488646  EST246985 cLED18C3
AI777331  EST263739 cLEE10C3
92% to AI897763 but different
DLFDAGTDTSSNIVEWAMTELLRSPDIMKRVQAELVQVLGEGNLMEETDVARLPYLQCII
KETYRMHPPAPFLVPRGVEQDVELCGYTVPKDSKVLINVWAIGRDSTFWKDPLVFNPDRF
MDSKLDVRGQNFELIPFGAGRRICPGLPLAIRMVPVMLGSLLNTFKWKIEGDIAPNDLDM
QEKFGLTLTRLHPLRAVPLPL*

AI771958  EST253058 cLER1C6
60% to 76B1 70% to a 76 family contig
VELYGYTIVKDSQVLVNVWAIGRDSSLWEDPLNFKPERFWESDIDFRGRDFELIPFGAGR
RICPGLPLAIRMIPIALGSLINTFNWKLHGGIAPKDLDMEEKFGITLAKAQPLLAIPVPL*

CYP77A
AI779493  EST260372 cLES8M5
93% identical to AI779498 probably a different gene
86% to 77A2
HKYYPIITLRMGTKTMIIISNAYLVHEALVQKGQIFASRPRENPTRTVFSCDKFTVNAAV
YWPVWRSLRKNMVQNGLSLIKLKEFRAARKSAMDKMIDKIRAEADANEGLVWV

CYP77A
AI779498  EST260377 cLES8M17 CYP77
93% identical to 77A2
QIMRELRQKYGPIFTLRMGTRTMIIISNADLVHEALVQKGQIFASRPRENPTRTVFSCDK
FTVNAAVYGPVWRSLRKNMVQNGLSSIKLKEFRAVRKSAMDKMIDKIRAEADANEGLVWV
LKNSRFAGFCILLAMCFGVEMDEKTIETIDQMMKSVLIALDPRLDDYLPILSPLFSKQRK
RAMDVRKQ

CYP77B
AI772644  EST253744 cLER3M4
AI484951  EST243214 cLED2F4
71% to 77B1 40% to 77A3
TRLVQNGPLFASRPPDSPIRLIFSVGKCAINSAEYGPLWRALRRNFVTELINPTRIKQCS
WIRKWAMEYHMKRLEYEVSENGFVEVMANCRLTICSILICLCFGAKISEERIKKIESILK
DVMLITAPQLPDFLPVLTPLFRSQVKQAKKLRQTQLEYLTPLVRDRKAFVDSNGDPNSSE
SEMVSPIGAAYVDSLFSLEPPGRKLGEAEIITLVSETIGAGTDTSATALEWALLHLVMNQ
EIQEKLYEEIVDCVGKNGSISESDVEKLPYLGAIVKETFRRHPPSHFVLSHSVTNDTQL

CYP81B like
AI776121  EST257209 cLER17B3
AI772515  EST253615 cLER2L18
75% to 81B1 C-terminal
PYLRCIVNETFRMYPAGPLLVPHESSEETTVGGYRVPRGTMLLVNLWAIHNDPKLWDEPR
KFKPERFEGLEGVRDGYKMMPFGSGRRSCPGEGLAVRMVALSLGCIIQCFDWQRIGDELV
DMTEGTGLTLPKAQPLVAKCSPRPVMSNLLSQ

81 family may be new subfamily
AI774414  EST255514 cLER12C12
64% to 81D1 62% to 81E2 I-helix to PERF
NTMTDHFLSLQESEPEFYTVQIIKGIVLVMLNAGTETSSVTIEWAMSILLNHP*VLEKAR
NEIDNHVG*DRLMDEADLPQLKYLQSVISETLRLFPAAPXMLVPHETSEDCKVAGFHIPR
GTMLLVNAWTIHRDPLLWEDPHSFKP

AI485246  EST243550 cLED4N4
36% to 81B1 (middle region, least conserved part of the protein)
IELFSTNSLQKSSLIRNEEIEILIRSLFKASEKNTRGTRVDLNCWAFTFVFNIMMRIGTG
KSCVSEEDIGMEKGKKIIEEMRGVFFANLLVLNVCDFLPILKWFGYKGIEKKIDLMSMKR
NKFLNKLLDEFRQKKFSSDSEHEAKEKKATLVETXLSLQEFEPEFYTDDLIKSLLVALFV
AGTETTSMTIQWAMRLLLAHP

81 family may be new subfamily
AI778489  EST259368 cLES5B19
AI782402  EST263281 cLES19C23
51% to 81E2 50% to 81B1 N-terminal half
SLKPPLYRTLANLSTKYGPVFSLQLGTRLVVA
ISSPSAAEECFTKNDIVFANRPRTMTAKFIGYNSTTVVGSPYGDHWRYLRRLYALEIFST
NRLNNFQSTRQDEIRLLVQRVFHKSGDNFVTPVELKSKLFQMSYNIIMRMVAGKRYYGEE
IDNEEANHFRVLVEEVISFGGVSNAVDFMPAIFLLFFRSTEKKIAKLGNKMDKLLQGLGD
EH

AI776129  EST257217 cLER17D3
48% to 82C1 N-terminal
MDLFLIVVTLATSFILLFILHKQFYSVKKHSSNSRKVPEAGGAWTIIGHLHLVGGSESDH
LPHKMLGRLADKYGPIFGMKLGVHQVVVVSDHKLAKECLTTNDLALAGRSKSMASEIIGY
KHAMFGLWSYGAYWRETRKIATIELFSGRRIEMLKHI

AI895521  EST264964 cLEC9E21
50% to 83A2 95% to AI895470
VMPPGPLGLPFIGNLHQYDGLTPHIYFSKLAKKYGKIFSLKLGSTPIVVISSAKLAKEVL
KIQDLTFCSRPSFLGQQKLSYNGRDIGFAPYNDYWREMRKICVVHLFSLKKVQSFSPVRE
DEVSRMITKISQQATASQITNLSNLVISLTSTIICRVAFGIRYDEEAHEKRRFDELLAVA
QEMMA

AI895470  EST264913 cLEC7L16
95% to AI895521
ILLVTLPIVLNFLAKKDRKNVMPPGPLGLPFIGNLHQYDGSTPHIYFSKLAKKYGKIFSL
KLGSTPIGVISSAKLAKEVVKIQDLTFCSRPSFLGQQKLSYNGRDIGFAPYNDYWREMRK
ICVVHLFNLKKGQSFSPVRENEVSRMITKISQQATA

AI780540  EST261419 cLES12C18
48% to 84A1
SVVPVTQREAMEDCVIDGFNIRKGSRIMINHYAIQRDPNLWSEPEKFLPERFIGSNIDVR
GRDFQLLPFNSGRRSCPAIQLGIIVVRLVVAQLVHCFDWELPNGMQPCDLDLEEHFGIVT
SKEKHLMAIPTCRLNEQ*

CYP84A2 AF150881 complete
AI894552  EST263995 cLEC4F13
AI772808  EST253908 cLER4M13
AI895344  EST264787 cLEC7B13

MVLNNINSILEALQANPILIFFFIIPLFFLYLFSTSRRKRYPPGPLGWPLIGNMMIMDQL
THRGLAKLAQKYGGVFHLKMGYVHKIVISGPEEARQVLQVQDNIYSNRPKTVAISYLTYD
RADMAFADYGPFWRQMRKLCVMKLFSRKRAESWDSVRDEVDSMVKIVTTNAGTSINLGEL
VFCLTRNIIYRAAFGTSSDEGQDDFIKILQEFSKLFGAFNMADFIPWLGWIGKQGLNVRL
AKARASLDGFIDTIIDDHIERKKAIHVINDDGYRESDMVDELLAFYSEETKVNESEDLQN
AIRLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKKVQQELANVVGLNRKVD
ESDFENLTYLKCCLKETLRLHPPIPLLLHETAEESTVSGYFIPANSHVIINSFAIGRDKN
SWEDPDSFKPSRFLKEGVADFKGGNFEFLPFGSGRRSCPGMQLGLYALEMAVAHLLHCFT
WELPDGMKPSELNMDDMFGLTAPLANRLVAVPTPRLLCEIY

CYP88B1 (47 ESTs) complete
AI485067  EST243371 cLED7O12
AI485854  EST244175 cLED9F22
AI485103  EST243407 cLED7J15
AI487281  EST245603 cLED10H13
AI487782  EST246104 cLED10P23
AI487685  EST246007 cLED14E3
AI488385  EST246707 cLED21I18
AI485866  EST244187 cLED8K13
AI486275  EST244596 cLED5H15
AI486985  EST245307 cLED6P23
AI483791  EST249662 cLED25F11
AI489781  EST248120 cLED17I5
AI897791  EST267234 cLED30N13
AI485993  EST244314 cLED3N4
AI899220  EST268663 cLED37L16
AI898093  EST267536 cLED31N19
AI485024  EST243304 cLED2H20
AI898425  EST267868 cLED33I10
AI486922  EST245244 cLED6D3
AI488584  EST246923 cLED17L14
AI485520  EST243841 cLED7E18
AI898585  EST268028 cLED34P11
AI486059  EST244380 cLED4K13
AI489577  EST247916 cLED15I17
AI483418  EST249239 cLED24G19
AI484633  EST242894 cLED2C22
AI486779  EST245101 cLED11D22
AI897537  EST266980 cLED27J24
AI489823  EST248162 cLED15G14
AI485447  EST243768 cLED7N5
AI486828  EST245150 cLED7H14
AI897644  EST267087 cLED30A9
AI898994  EST268437 cLED36H17
AI780913  EST261792 cLES13D22
AI484561  EST242791 cLED2I23
AI490321  EST248647 cLED25A21
AI490370  EST248696 cLED15C16
AI483444  EST249265 cLED24E16
AI489234  EST247573 cLED17D2
AI490509  EST249043 cLED20H23
AI489914  EST248253 cLED17C23
AI483846  EST249717 cLED24O10
AI899105  EST268548 cLED37A22
AI488836  EST247175 cLED16K6
AI488199  EST246521 cLED20F3
AI486159  EST244480 cLED5M20
AI897904  EST267347 cLED31E7
40% to 88A4
MDFYNLALFFIALILGIFTFYAILMRINGWYYAIKFCSNKYNIPNGYMGLPYFGNTLSYF
KASMCGDPKSFIDFFATRFGEGGMYRAYIFGKPTIMVTKPEIIRKVLMDEEYLERGLPNY
MKKLIGLTTSIEEDKYFRRLTAPVKSHGLLSDYFDYIDKTVSSTLEKYATTEEPVEFLHK
MHKLTFEVFMRLLIGDEVNQELFDEMFEEITAVISGVHNLPINLPGFAYHKGLKARKVLX
EVFKKLIDERREAMKDGKSMPKANIIDMLLSNNNQDYEANMLSDKKIIEILVLFSFAGFE
PVALMSVKAIFHLQKHPHFLEKAKEEQEEIVKRRASSNAGLSFDEIRQMTFVSKIINETL
RIATDQSVFLRDTSTTFNINGYTIPKGWKFFAVVWNIHMNPDVYVQPKEFNPSRWDDIET
KPGIFLPFSMGPKSCPGSNLAKLQISVILHYYLLHYRVEQINPEARCYPPENCLVKFKKL
SISSNGN*

AI773349  EST254449 cLER6C2
57% to 89A4
RFIGAVTLCVAFWLKSICNIIVSPNSNTKRNLPAGPYSFPVIGSLLWAKRTFSDLEPILR
DLKAKYGPLITLNIGSRSAIFVASHSLAYQALVQAGAIFSNRPKAGPTSAVVNSNQRNIS
SAPYGPIWRLLRRNLTSEILHPSRI

CYP92A
AI776223  EST257323 cLER17H16
87% to 92A2 362-509
ETMRLHPVAPMLVPRECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPDRFL
EKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEELNME
EIFGLSTPKKFPLSAVIQPRLSSKLYSV

AI772162  EST253262 cLER1J14
49% to 92A3 45% to 92A2
RMKDSGKNFTQFYKYVLDDHNAIKMQKSGDFVPKDMVDALLHLANDPNREVQLTSDRMMG
LMHSLLAGATDTSAATIEWTFQELMRRPNIMEKAHHELERAIGKERWVEEEDFSKLPYID
AIIKETFRLHPLCAVLPPRYSTEDCNVAGYDIPKGTTVYVNAWSLGRNSKYWDRAEEFISE

CYP94A
AI898365  EST267808 cLED33K15
AI781747  EST262626 cLES17A23
AI488040  EST246362 cLED19M2
AI488388  EST246710 cLED21I22
69% to 94A1
MRYDEVKNMMYTHASLCESMRFYPPVPMDSKEVMKDDVLPDGTFVKKGMRVTYHPYAMGR
SEEIWGKDWAEFKPERWLNKDEMTGNWMFVGKDPFAYPVFQAGPRVCLGKEMAFLQMKRV
VAGVLQRFKVVPVVEKGVEPMFISYLTAKMKGGFPVTIEERM*

AI777056 EST252023 cLEL1E13
66% to 94A1 183-345
NVVDLQDVLQRFAFDNICKIAFGYDPKYLLPNLPEAEFAVAFEDCVRLSSERFAVPFPLI
WKMKRAFGIGSEKKLRIAVGEVREFAKRIVREKLNERSSLDSADLLSRFLSTGHSDEDFV
VDIVISFILAGRDTTSAALTWFFWLISKNADVESEILRRI

AI772896  EST253996 cLER4O20
55% to 94A1 121-249 91% to AI777056
NTLADFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVESVADVEVSERLVPILANAAA
EKNVADLQDVLQRFAFDNIWKIAFGYDPKHLLPNLPEAEFAVASEDCVRLSRERFAVPFP
VIWKMKRAF

AI898212  EST267655 cLED32E24
AI485742  EST244063 cLED4I4
AI483714  EST249585 cLED23D21
60% to 94C1
VDVLAEEVIIQKRKNDFSSQNDVLSRFMRNIDDDKL
LRDIIVSFLLAGRDTVASGLTTFFWLLAQHPHVINEIRAESNRVMGKTVNGTLATFEGIR
EMHFLTAAIHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGTRVTYHPYAMGRMEGIWGK
DCLEFKPERWLE

CYP97B
AI482691  EST242014 cLEB1L15
AI482692  EST242015 cLEB1L19
AI482612  EST241935 cLEB1M6
79% to 97B1
LVLNRRSDSIFRHFPSSYPTSWSTQKRSSIRTMKCRCQSTGTDEPKTKMNLFDNASNLLT
NLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVAR
HILRENAFSYDRGVLAEILEP

AI773792  EST254892 cLER8M23
52% to 97B2
LRYTTRVINESLRLYPQPPVLIRRSIEEDVVGGYPIKRGEDIFISVWNLHRCPNHWEEAD
RFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCVGDMFATFENLVAVAMLVQRFDFQMAL
GAPPVKMTTGATIHTTEGLKMTVTRRSRPPIVPNLEMATLEVDVNSVSSDRAEAEASTVRP*

CYP98A
AI895234  EST264677 cLEC7M3 98 like
AI895476  EST264919 cLEC7N4
72% to 98A3
MALFLIILTSIALIFLAHKLYHRLRFKLPPGPRPLPVVGNLYDIKPVRFRCFADWAQTYG
PIFSVYFGSQLNVVVTTAELAKQVLKENDQNLADRFRTRPANNLSRNGMDLIWADYGPHY
VKVRKLCNLELFTPKRLESLRPIREDEVT

CYP98A
AI775624  EST256724 cLER16G13 98 like
AI779624  EST260503 cLES8L1
73% to AI895234 59% to 98A2
MAFPLVLSLSIFIIFLCYKLHNRLTAKLPPGPWPWPIIGNLFSIAPMRFRCFAEWAQIYG
PIFSFYLGSQLNVVVNNAELAKEVLKENDQNLANRFRTKPLDSVSKNGMDLIWADYGPHY
VKVRKLCNLELFTQKRLEALRPIREVEVTAMIENIFKDTTKPGDDSKTMTLRGYLGLVSF
NNITRLTFGKRFINSKGEVDEQGEELKSIVTDGIRISGKPNLGEFVPWLRWVFKDDNEAL
ESQDRRLNKFTRLIMEEHTIAREKSGETKHHFVDALLTLQKEYDLSDDSIISLFWDMVQA
GTDTIAITVEWAMAELVRNSIVQQK

AI899070  EST268513 cLED37I1 701A like
AI484969  EST243232 cLED2H11
60% to 701A3
WAETYGPIYSIKTGANTIVVLSSSELAKEAMVTRYSSISTRKLTNALRILTCDKSIVAIS
DYDEFHKTAKRHILTSVLGPTAQKRFRIHRDTLVENVSKQLHDLVRTDPNEAINLRKSFQ
SELFGLALKQALGKDIEAIYVEGLDATLPREDLLNILVLDIME

707A4 (29 ESTs) complete
AI489171  EST247510 cLED17I4
AI487614  EST245936 cLED13C12
AI490609  EST249163 cLED15L23
AI487328  EST245650 cLED13O2
AI484045  EST249916 cLED22D22
AI487610  EST245932 cLED13A6
AI484770  EST243031 cLED3B5
AI488748  EST247087 cLED13H7
AI486367  EST244688 cLED8L22
AI485557  EST243878 cLED6H14
AI897215  EST266754 cLED27G13
AI484000  EST249871 cLED22H4
AI895304  EST264747 cLEC7I10
AI490463  EST248789 cLED22A13
AI485878  EST244199 cLED8K11
AI488150  EST246472 cLED21G15
AI899380  EST268823 cLED38J18
AI776955  EST251981 cLEL1A3
AI488489  EST246828 cLED23D18
AI487250  EST245572 cLED13A13
AI486593  EST244914 cLED6A23
AI488173  EST246495 cLED21A14
AI489713  EST248052 cLED15A17
AI487814  EST246136 cLED14O3
AI489648  EST247987 cLED16F10
AI488901  EST247240 cLED18G19
AI897189  EST266728 cLED27A19
AI782451  EST263330 cLES19M5
AI897794  EST267237 cLED30N19
74% to 707A3
MEFVSMLRLFTFISLTLLLIHSIFKFLAFASKKLPLPPGTLGLPYIGETFQLYSQNPNVF
FASKVKKYGSIFKTYILGCPCVMISSPEAAKQVLVTKANLFKPTFPASKERMLGKQAIFF
HQGDYHAKLRKLVLQAFKPDSIRNIIPDIESIAITSLESFQGRLINTYQEMKTYTFNVAL
ISIFGKDEFLYREELKKCYYILEKGYNSMPINLPGTLFNKAMKARKELAKIVAKIISTRR
EMKIDHGDLLGSFMGDKEGLTDEQIADNVIGVIFAARDTTASVLTWILKYLGENPSVLQA
VTEEQENIMRKKEVNGEEKVLNWQDTRQMPMTTRVIQETLRVASILSFTFREAVEDVEFE
GYLIPKGWKVLPLFRNIHHSPDNFPEPEKFDPSRFEVSPKPNTFMPFGNGVHSCPGNDLA
KLEILILVHHLTTKYRWSMVGPQNGIQYGPFALPQNGLPIKLSLKTSST*

CYP707A
AI896822  EST266265 cLEC23P7
AI489739  EST248078 cLED14D11
72% to 707A3 these two ESTs do not overlap and may be from different genes
1-101
MEFVSMFCLFSFISCSILLLHSVFKLFDCGVKKLPLPPGSLGWPYIGETFQLYSQNPSFF
FASKVKKYGSIFKTHILGCPCVMISSPEAAKLVLVTKAHLFKPTFPASKERMLGKQAIFF
HQGEYHAKLRKLVLRAFKPEAI
144-255
GKDEMLYREDLKRCYHVLETGYNSMPIYLPGTLFHISMKARKELAKMLAKIISVRRETNQ
NHADLLGSFMGDQEDLTDEQIADNIIGVIFAARDTTASVLTWILKYLGENPS

CYP711A
AI898402  EST267845 cLED33C24
78% to 711A1
LKVIKEAMRCYIVSPLVARETSAEVEIGGYKLPKGTWVWLALGVLAKDPKNFPEPEKFKP
ERFDPNCAEEKQRHPYANIPFGIGPRACIGQKFSIQEIKLSLIHLYRKYIFQHSPLMESP
LELEYGIVLNYKHGVKVHAIKR

AI484757  EST243018 cLED3M5
AI898806  EST268249 cLED35P5
AI483436  EST249257 cLED24O3
AI488390  EST246712 cLED21I12
64% to 714A1
279-501
EKLEKEIESLIWEAVKERERDQCLETQDLLHSILEGAINDGNVGENSSRKFIVDNCKNIY
FAGHESTAVAASWCLMLLALHPEWQSRIREEMTQIGVLDADSVSKMKMVTMVIQEVMRLY
PPAAFVSREALQDTQIGHIVVPKGVCLWTLIPTLHRDPDIWGRDANEFKPERFQNGVSGA
CKLPQVYIPFGLGPRLCLSRNFAMVQLRVVISLIISKF

AI898719  EST268162 cLED35M8 715
70% to 715A1 278-428
STREMVDECKTFFFGGHETTALALAWTLLLLAQHPEWQNQLREEIKQVMGDDGEIDVTKL
VGLRKMGWVMNEVLRLYSPAPNVQRQAREDIKVDDLVIPNGTNMWIDVVSMPHDKTLWGE
DVNEFKPKRFKDHIHGGCKHKMGFMPFGFGG

AI490089  EST248428 cLED22O9
31% to 93A1 may be in a new family
LILNMTYRMLFGDGNSERFDLENIVKEMVRLAGIFNVADYVPFLEPFDIQGLNKQLKEAG
KRVQEVFDTIINEHEQDARNYTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAILSDMI
VGAIDTSHTWIEWVFAEIIKHSTVMNKLQ