Trichoplax P450s

 

2304 trace file sequences were downloaded and placed on a BLAST server and TBLASTN

searched for P450 hits to CYP20, CYP38 (sponge ortholog of CYP20), CYP51, CYP4T3,

CYP3As, CYP12A1 (mito clan), CYP17 (CYP2 clan).  These files represent about 4% of the

genome size of 52Mb, so there are no overlapping pieces for the P450s.  Each hit is a

separate sequence.  None are complete.  There were more CYP3 clan sequences than any

other type.  No CYP2 or CYP4 clan members were found, but there are some in sponge, so

they may be in Trichoplax in the 96% of the genome not represented here.

There was one hit to a CYP51 ortholog, and there were two hits to mito clan fragments.

 

Trichoplax has at least the mito clan, CYP3 clan, and CYP51.  The others will have to

wait further sequencing to know.

 

D. Nelson

Dec. 5, 2006

 

 

CYP51 clan

 

>gnl|ti|1039420734   name:AYFC67379.g1 mate:1039420638

            Length = 986

 

  Minus Strand HSPs:

 

CYP51 N-term, 33% to mammalian CYP51, 30% to sea urchin CYP51

    MTKLSPSSTAWPSLIFLVGLTLAAMGSSGVFLLQTLYPQ

470 VSDTLPDVSYEQALAISGVCFVLLICFAYHSHQQLVMLNMKMPMIPSPVPFLGQAL 303

302 LFLKHSPWDLLLNWHRQVGPFFSFVLLGRRCVSLAHPDYLKLVLQSKIRSVKKDVAFAYK 123

122 PFLVILGHGIVTSENQSWMKQR 57

 

 

Mito clan (2 sequences) These two sequences might combine

 

>gnl|ti|1039420953   name:AYFC67982.b1 mate:1039419993

            Length = 1049

 

  Minus Strand HSPs:

Mito clan  34% to 27B1 C-helix region, 38% to CYP10 snail mito clan

NDEQWKETRSAIDKRLLKLNAVQGYSKIMNKVIDDFIAYLLRIRGKHGVKNEILGFESQTFRWSLES

 

>gnl|ti|1039420953 name:AYFC67982.b1 mate:1039419993

NNTTACGTTCTGACGCGNAGCAAGAGATCAGCGATGAAGTTTTGTATGTCATATCTGTAAGAGCTTTATG

AAATAATTCGCCATCATGGCTCGGCGGTTCTTGAAGGCAACCAATGCGCTTATCGATACCATCAACCAAT

ATTGCTGTATTAATATGAAGAGTTTAATTAGTAAAATTTTACGCATTTCTAGGAGCATTTTAGTTTAATT

TTCTACTTTTGATGGCGCAAAATTCAAAATATGATATTTCTAAATATACATTTAACGGTATGCAATAGAA

TGCCATATACTCGTAGGCCTAAGGTAAACATTAGCTTCAATTTTTCACTAAGATGCTATAGAATACATGT

ATTGTACATAAAGATCATATTAAGGTTATTAGCTAGCTATGATTCATTGAACAACATCGTTTAGGACTAA

CAACAGTAATGTTTTATTGTAGAATCCTATTCAACATTTTAGTAGAGTTCAACCTACTTTCTAATGACCA

TCTAAAGGTTTGGCTTTCAAAACCAAGAATTTCATTTTTAACGCCGTGTTTGCCTCGTATGCGAAGTAAG

TAAGCTATGAAATCATCAATAACCTTATTCATGATCTTACTATAGCCTTGGACAGCATTTAATTTGAGTA

ATCTCTTATCGATGGCGCTACGTGTTTCCTTCCATTGCTCATCATTGCTGAAAATAAAAAATTGGAGTCA

AATTAATTCCCAAACAATCTGAATAGAATTTGATATGTAGTAGTTTCTACTGAATGTTCGCGTACGCTCA

TATGTTGTGATTGCTATATTATATATTGCTTAATATGTTGCTCAATTTTGTAAATCCATGAGAGGCATGA

GCTTTTATAAAACAACAAACAGATTCTTCCGTATGCTAATAAAATACGGTTTTCTAAGTTGTTCTCATNA

ATGTGTTCACCATATAGCTGTGGTATCAATACGTGAGAAGATCCTAGCTTTATATTACAGTTAAGTTCAT

ATTTAAGCAATGATTCCTCACATCTGACTCAATTTTTTGACTTCTTTAGCCCCGACGTAGCATGACATA

>gnl|ti|1039421032   name:AYFC68061.b1 mate:1039420072

            Length = 1035

 

  Minus Strand HSPs:

Possible mito clan  29% to 11A1 Fugu, mid region up to I-helix

730 AINTVLFSKSLGAFNDPPTPIAAIFYDNVLKMLNATNELLFYPPYYKYIKTKYW 569

568 KQYCGYWDTLFEVGGQLINEARQALNDGKGIDIDRTTSPSRLNDLEFLPYILLRGELTDE 389

388 EIASNLIELMTAAVDTVS 335

 

>gnl|ti|1039421032 name:AYFC68061.b1 mate:1039420072

NNNTTATGGTGTCCTTTTCGTTCTTTGATTTCTTCTAAATTCGTTCTTGTATGTTTTTATGTTTCCCCAG

TACATAAAACGCCCATAATACTGTGTTAGCTGACTAGAAAAATGGAAACATGATGTAAATGATACTGTTA

TTGTATATATCCTATCTTCATTGATTATAAGTATGATATGTTCAACCATAAATCAGGAATCTACAGATCG

CAAATTATGTAATTTTTATCTTATCCTTATAGAATTTTGTCAAGAGTTATCGCAAATAAATCCTAATCTA

TTCTCATCTAGTGTAGTACGACAATACCAATACCACGTATATTGGTATTATAAGACTTACGGTATCTACA

GCTGCCGTCATGAGTTCTATCAGGTTACTAGCAATTTCTTCATCAGTTAATTCTCCACGAAGTAAAATGT

ACGGTAAAAATTCCAAATCATTGAGACGACTTGGACTAGTGGTCCTGTCGATATCAATTCCTTTTCCATC

ATTCAATGCCTGGCGTGCCTCGTTAATTAGCTGGCCACCAACCTCGAATAAAGTATCCCAATAACCACAA

TATTGTTTCCAATATTTAGTCTTTATGTATTTATAATAAGGAGGATAGAATAAGAGTTCATTGGTTGCAT

TCAACATTTTTAGAACGTTATCGTAGAAAATGGCGGCAATCGGTGTCGGAGGATCATTGAATGCACCAAG

ACTTTTACTGAATAAAACAGTATTGATAGCTTGAAAAAATAACCAAAGAGCATGAAATTGTAGAAGATTG

CATCAACTTACTAAATACACCAAACTGTAAAGTGCAATATTTTTAATTGGCTATTTGAATCCCTTTCATT

GATATTAACATTTATAGTCATGGACTAGAGTTGAGAGCTAACGACTTAGCCAGGAAACTATCTACCGTNA

GGCATGTACTATACTTACTTTCGAAAGACCNNACTGATAAATAATTNCTAAATATGCTCATTTTCTCAGT

AGCATGATCTCCAGTCCATTCCGTTTTATTAAATTTAATAAACTAGTATCGACAT

 

 

 

CYP3 clan (6 sequences)

 

Note:  These sequence showed higher identity to CYP5 sequences than to CYP3 sequences. 

This may mean that the CYP5 sequence preceded CYP3 in evolution, though the function

of CYP5 was probably not thromboxane synthase in these earlier evolutionary groups.

These sequences do not have the CYP5 insert that is characteristic of vertebrate

CYP5s.

 

>gnl|ti|1039422066   name:AYFC67751.b1 mate:1039421778

            Length = 1012

 

  Plus Strand HSPs:

 

38% to CYP5 Fugu, 27% to 3A48 fugu, 33% to 3A5 hum,

CYP3 clan seq a N-term half, 37% to seq b, 33% to seq e

YSLIAPCRRLKRLGIDVPKPKLIVGNVTDFGPGNGHIAQLKRLQMYGNIYGTLFFKVPAI

WFNDPEMLRTVMVKEFSNFSNRYSLTKSLGPFSNSLQELKDDDWKRVRTILTTTFSSAKL

KSIMPIIDNASDDLIQSCDDAIAKGLPVDFWRQSGKFSMSVILATVFGIEIESQEQEEKL

TEAAATLFRSLPGLLQFLIIFMPSLFRILEPILGGKITYSMDYLTKTVKSVIKERRKSMV

AGIPCRRDILQXMIEAGDNDKLSDDEIVSQAFVFLIAGYETT ANTIAFASYLLRPPWNTT

QVHDELNPMS

 

>gnl|ti|1039421688   name:AYFC67661.g1 mate:1039421592

            Length = 978

 

  Plus Strand HSPs:

3 clan seq b, 41% to CYP5A1 Fugu, 33% to 3A48 fugu, 37% to seq a

47% to EG574244.1 Xenopus laevis cDNA (CYP5A1)

49% to sea urchin EST CX695947.1 Strongylocentrotus purpuratus

RTHDXRIPIVDNSSRKLRSALISYAQQGEIIDARDVFGKFTMEVILSVAFGVQLN

TQDTTLTNAASKMLSGIPRRILFTIISPYLLELTRKSPLDFEAKYFQQLDHAARQVIKER

RQSSAPKSKDFLQLILDGRESGKLSDEDIIAQSFVFLLAGYETT ANTLSSVCYLLAINPD

VQERLINEVDDAFSGIDDDLSYEQIFELKYLDMVITETLRLYPPIPIIIREVAQDCTIGD

YQFIAGTSIMLSTYALQRDSAEWPDPEKFIPERFTQEEKQKRSSMSYLPFGAGPRICIAM

RFALMXIKIALVTVLRTVKFIRV

 

 

>gnl|ti|1039421888 name:AYFC67861.g1 mate:1039422176

NAACCAGAAGCCGGNNCCGGCAGCAATGATACGCGNTTTTTGTAATAGAGTTGCGAAACATGACGCAGTT

ATTGACGGAGTGAAGATACCCCAAGATATGATGGTGGCAATTCCAATATACGGTATTCATCATAATGATG

AATTATGGCCAGATCCAGAAAAATTTATACCAGAACGATTTACACCCGAAGAGAAAGCTAAACGTCATTC

ATTCGCTCATATTCCATTCGGTAATGGTCCTAGAAGCTGTGTCGGTATGAGATTAGCTGTAACGGAAGCT

AAGTTAGCCTTAATCAAAATTTTGCAAAATCTGATACTTGAACCAGTGAAGGATACTCAAATTCCTCTGG

TTGTTGAACCGAAATTAACCTTAGCTCCATCTAAAGGTGTGATAATAGGGGCCAGAGAACGGTGAAGTCG

CTATCTTAATATCTCTTTATTCACCTCGAACTATCAATACCATACAAATTCTTATTAGAATTTAATATCT

ACATATGTTAGATTAGACTTATAAATTGCAACGCCATATTGTATTCCAATATTCTTACACAGTAGTAGTA

ATGCTATTAAGGAAGTAACTTTATGTCCACTTTGATAATAACTGCAACTTATAATACGAATACATTTGAA

GCATGCTACTATGCTAACTGTGCACCTTTGGATAACTGATTATATCTAATGATTTGTAAATCAAACCAAG

CTAATCTCAAACCTTTTATCGCTATTTAAATCTATCGATGCAACTATATATGTATAAATAGGCATGCAAA

GGGAAATTTAATTATATAGTTATGTAGTATTAAGATCTTTATGATGATTAGTAACCTTATGATATGGATT

TCTAAAGATTTTCGTAACCTTACAGTATACGCACGCAAACATAAATGCTCAATATATTCGAAATANCATT

ACTGTATGAGCGCCATCATATTCATTTTTAGTACTCATACATGTATATTTTTATATTGGTCATCTCCACT

AATCTTATAGCAGACGAGA

CYP3 clan seq c, 45% to 5A1 fugu  3 clan, 40% to 3A47 Fugu, 47% to hamster 3A31

48% to 3A16 mouse, 41% to 5A1 mouse

41% to seq b

PAAMIRXFCNRVAKHDAVIDGVKIPQDMMVAIPIYGIHHNDELWPDPEKFIPERF

TPEEKAKRHSFAHIPFGNGPRSCVG MRLAVTEAKLALIKILQNLILEPVKDTQIPLVVEP

KLTLAPSKGVIIGARER*

 

>gnl|ti|1039420559 name:AYFC67300.b1 mate:1039420655

NNCCTGTCACGAGGTGCGTGCTATCATACACAACACATTTTTCTATAATAAGCGTATGTACACCAAGGCC

TTTTATGTAAAAATTGTAAGTAGTCACAAAGCAGTTAATGTGATACTAATACTGCTTAATTAATACTTAA

CGAAAGCAGCGAAAATCAAAACAGCTCAGTTTGACTCAGTATTAAGATGGAAGCTTATTCTATTAGATTA

CATCAGAGAATTGATCGGAAAATAAGAACCATCTCCGTATAAACAAATTCGATTCCGTAATTAATGAATG

ATCTATTGTTGACGTTAATTTAAGCCCTGGATCATCATCATACTATGAGCAATCGCATGATATTACATCA

ATTGGTTTATAACTGGCATGTCTAAGTATTACTGCAACTGTTTTCCATTTAGCTGATAATTAATGAGTCA

TTCTTGTCAAGTCGCTAATTATTGTAAATATACAATCATGTAATAAACCTAGATCAAGCGTATGAAATAG

CTAGGATAGTTTCGACTAAAAAGATGTGGTGGTATAGAAAAACTCAAATCTATCCTTTTAACTATTTTCC

GTTTGGTGGTGGGACAAAAATTGTATAGGTAATCGATTAGGATTGCTAGAGCTTAAATTAACTATTGTCA

TGATATTACAGAAAGTTGAATTGGCCAGTATACAAGAAATAGAAATTCCATTAAAATTGAAATCGTTTGC

AACTTCATCTTTTAACAATGGAATAAAACTAGGAGTTAAAAACAGATGTTATAATATTCAGATTTTAATA

AGTGATAGTTAGACCTCATTAAGACGAGTATGTGTGCACTGTGTATTGCCAGATCTGTCAATATTCATAT

GTGGGGTAGGTTCCAATCACTATTGACTAATTTTTGAGTAATCATTGAAATTGTACATATATAGATACTT

AGAGGACATATCAAGTTGCATAAGTCCGAGTATCTTACCCTGGAAGTGATCGATCATCTTGATAATGTTC

CGGTGGA

CYP3 clan seq d, (+) strand heme to end, 40% to 3A48, 35% to 5A1 fugu

31% to seq c

LFSVWWWDKNCIGNRLGLLELKLTIVMILQKVELASIQEIEIPLKLKSFATSSFNNGIKL

GVKNRCYNIQILISDS*

 

>gnl|ti|1039421579 name:AYFC67648.b1 mate:1039421675

NNTTTTGTTATCTGCTACCAACTTTTGCTATCTCCTGAATTAATTTATCTTGAACCTCGCTATTGTTAGC

TAACAAATAAGCTGTAAAAGTAGCACAGCTACTTGTAGTTTCGTAACCAGCCAGCATGATTGTACTCGAT

TGGGCAATAATTTCATTATCTGTCAGGCTCTTGTTACTTTCAGCAGCAGCGCTAGCATCTATCATCAGCT

GCAATAGATCTTTATAATTTGCTCCGGTAGCACCTTCCTGACGTCGCATCTTGATAATACTAGCAACCGC

TTTATCAATGTACTTGACACCATTCATAAATGATTTATCGAAAGCAGCAAATAATGGAGCTAATCTAGGC

ATCATGAATGACAACGCGATGACAGTAGGATTCATTTTGAAAATTGCCGTTGCACTATTTACTAAACGAT

CATGTCCACCATTTTGAACGTTACACTTTGCACCAAAAGCACTAGCAGTTATAATTTCTAAGCTAAGTTG

TTTCAACCAATCCGATACATCGATTGATTGATTCTTATCAGCTACCCTTTCCATTTTTCTTATGAAAGTA

TCGACGGAATCATTTACTAAAGGAAACATCTGTTTCATTTTGGACGTTGTATATGTAGGATTCAATACAG

TTCTAATGCGTTTCCAATCAGTATCACGTAAATTAGCAAGACTTCTCTCTAACCCAGGAGTTTTAAAGAA

CATAGCACGATTGGAGAATGCAGGAAACTCTTTAATCAGTATATTCTTAATAATATCTAAATCACCTACA

ACGTAAGCTGGCATCGATCCAACGAAAAATCCATAAACTCTGCCATACTTCTCCAAGTGAATCTGCTGCA

CTTCATGATTGCCTTTTCCATCTTTGGTATCAGCTGCTNAAGTGCCAATGATTGGGATAGGAGATGGCCC

TAGTATACCCAGACGTTTAAAATATCGTAATGNCACAATAAATTTGACATAAACCAAAATATTATCAATG

CGATAACTGTACACCAAAAAAACGAAACCATGGTAGTAT

 

>gnl|ti|1039421579 frame2_ORF1

3 clan seq e, 32% to 3A49, 29% to CYP5A  N-term , 37% to 3A56

33% to seq a, 35% to seq b

YYHGFVFLVYSYRIDNILVYVKFIVXLRYFKRLGILGPSPIPIIGTXAADTKDGKGNHEV

QQIHLEKYGRVYGFFVGSMPAYVVGDLDIIKNILIKEFPAFSNRAMFFKTPGLERSLANL

RDTDWKRIRTVLNPTYTTSKMKQMFPLVNDSVDTFIRKMERVADKNQSIDVSDWLKQLSL

EIITASAFGAKCNVQNGGHDRLVNSATAIFKMNPTVIALSFMMPRLAPLFAAFDKSFMNG

VKYIDKAVASIIKMRRQEGATGANYKDLLQLMIDASAAAESNKSLTDNEIIAQSSTIMLA

GYETTSSCATFTAYLLANNSEVQDKLIQEIAKVGSR

 

>gnl|ti|1039420039 name:AYFC68028.g1 mate:1039420999

GGAGCCGGGNCCTCTAGATCGATTATTACATTAAATTTTAGAGGTAGGAATCAGTTACTACATTCATTGA

ATAAAATCATACATTTTTCATCTTGTTCGAGGTAAAATTAGGAGTCAAGATGTTGCGCACTTTCTTCCAG

TGATCATCACGTAATATTAATAAGCCAAGATCAAACCGAAATCCTGTATTGAACGTAATCTACAATGAAC

ATTAAACAACGAATAAGCTCCAAAACTTTGCAAATAATAATCAGAATTGATGGTTGCAAAAAAAGCATTA

AAATTTGCCGTATAACATTGTTAAATCATAACTTTTAACATATTTACTATTCAAATCGATATTTATTACA

CTAGTAACTGATTTTATATAAATCCAAAATATGTACACAGTAAGCATAGAATACAAGTAACTAAAGCAAG

CAACTGTATACCGATCGATTCAGAAAATTTGAAAATTGTTTCACGGTGATTTCTTTAATAATATCTGGAT

CAGTTAACAGATAGCGACCCCTCACGCCCATAAACAATCTGCATAATCAAGATTCAACAGAAAGATATAA

CTGTACCCTAATATCAGTTACGTTAATAGTAATTTGTAGGAAATCCTATAACTTTGGCAGATATAACGTA

CCCCGTTACACGTCCATACTTTTTAATAAGGTCGGCATGCACTTCATGCATTTTCTGTGCAAACACACAG

CAATACACCAAATTAATGAATTAATAATTATTATCATAAAGTACCTCGAATACAAGGTTTAAACAGGTTA

TAGTAAAACAGCCAGCTTAACAGCTAGCTGTTCTAGGGTACTTTATGACCTTGATCAAAGTAAAAGATAT

CGAAGGCATTTTACAATACCAATTTGCGTTCTATTATGCCATTCTTAATATAAGTAACTGTAGAAAAAAT

GACTGTCAATGAGAGTTACCTTCGTTTCTTCATAATTCGAGGGCGTTGCTAGTAAAATAGTGGCTTAGCC

CAGCACACCAATCTTCAAAAGTCTGTATTTGTCTCGTGACTGATGAAAGTATATCAATAGAGAGGTCGTC

TGTTGAGTAGACC

 

Minus strand

3 clan seq f,  46% to 5A1 Fugu  36% to 3A49 Fugu

44% to seq e, 41% to seq a

N-term KYG motif to C-helix.

FAQKMHEVHADLIKKYGRVTG (2)

LFMGVRGRYLLTDPDIIKEITVKQFSNFLNRS (0?)

ITFNTGFRFDLGLLILRDDHWKKVRNILTPNFTSNKMKN (0?)