Trypanosoma brucei P450s


The Trypanosoma genome projects are not finished.  These genes are a sample found at Genbank and Sanger.  Multiple specis of Trypanosoma appear to have these
two P450s and no others are found, so this may be the whole P450 collection
in Trypanosoma.

>CYP51E1      Trypanosoma brucei (African sleeping sickness parasite)
           GenEMBL AZ217433 AQ948529 AQ950690 AL492728 AL481001 AZ217732 
           AQ948526 AQ647531 AL480043 AQ660405 AL495885 AZ212935 AL481816 
           Assembled from overlapping GSS fragments
           33% to mammalian CYP51s
MLLEVAIFLLTALALYSFYFVKSFNVTRPTDPPVYPVTVPILGHIIQFGKSPLGFMQECKRQL
KSGIFTINIVGKRVTIVGDPHEHSRFFLPRNEVLSPREVYSFMVPVFGEGVAYAAPYPRMREQ
LNFLAEELTIAKFQNFVPAIQHEVRKFMAANWDKDEGEINLLEDCSTMIINTACQCLFGEDLRKRLDARRFAQQ
LLAKMESSLIPAAVFLPMLLKLPLPQSARCHEARTELQKILSEIIIARKEEEVNKDSSTSDLLSGLLSAVYRDGTPMSLHEV
CGMIVAAMFAGQHTSSITTTWSMLHLMHPANVKHLEALRKEIEEFPAQLNYNNVM
DEMPFAERCARESIRRDPPLLMLMRKVMADVKVGSYV
VPKGDIIACSPLLSHHDEEAFPEPRRWDPERDEKVEGAFIGFGAGVHKCIGQKFGLLQVK
TILATAFRSYDFQLLRDEVPDPDYHTMVVGPTASQCRVKYIRRKAAAA*

>CYPxx N-term to I-helix about 41% identical to Chlamydomonas scaffold 306
Tb03.27F10.920 
MAVITNTSSLNGGFVSGSFMFLNDIFLYYSTSDLIWVGFMSMLMFIIMLWLSNVVVPAIR
MDRYLANIPRAPGGLPVLGHALELLEGSPSSKMASWSLRPWKAKRENTVAVTKAGTNRIV
AFTVFSQRVVYINEPALIKRVLLSNQRNYTKDIASSYKHFMCLLGNGLVTAEGHKWRKGR
LMLSHSLRIDILEDMPEMTMRAVGRIMEKLRTVGSGVPFLDLNEEFRHLTLQVIGETVLS
LSAEETDRIFPTLYLPIVHECNRRVWEPWRAFMFFSDGFRERRRCLKRLNAVICDIIQER
WRQRNEGSQKDVMSLCLSQVDALDNNMLLQLRDDVKTLLLAGHETSAALLTWATYEVICH
PEIRDKVVEEAKALFDP AHCDRTMETPEGVWGIPSASAVRSSLRWTPAVLRETLRKHSVV
PLVMRVAVNNDKWPASETGLDKDVVIPAGCSVAVGIEGVHQRPDIWEDPGSFNPERFLDV
AIPNDTNSPPTGEKYEKRIDPYAFIPFIN GPRNCLGQHLSMMETQVALAYLFLNWDLQLH
GAVSQSDTEINKELQQEVGRPHKFLIPIVPGNGLKVVGHPRPRY*

>tryp_XI-892a03.q1k chromosome 11 Trypanosoma brucei, a third P450
Note: this sequence matches 59% to CYP212A2 from a bacterium Ralstonia metallidurans.  It is probably a bacterial contamination.
CHCPGSAASAGRFAWLRGFIDRQVRLRLAQADAHWPEDLLSRLLRLHRGDAQAWTLQAVR
DECMTAFLAGHETVASSLTWWSWCMATHPEAQQQVADEIHEQLQGRTPTAQDLPALRQLG
WSLQEAMRLYPAAPVLISRRCTRPVQLGPWRLPARTLFMIAPGLMQRDARWFPQPDAFQP
QRFADADKDGTPAAPRGSWMPF