Trypanosoma cruzi P450s


The Trypanosoma genome projects are not finished.  These genes are a sample found at Genbank and Sanger.

>CYP51E1v1 Trypanosoma cruzi AY283022.1 CYP51-1 allele (only 3aa diffs to allele 2)

Buckner,F.S., Joubert,B.M., Boyle,S.M., Eastman,R.T., Verlinde,C.L.
            and Matsuda,S.P.
  TITLE     Cloning and analysis of Trypanosoma cruzi lanosterol
            14alpha-demethylase
  JOURNAL   Mol. Biochem. Parasitol. 132 (2), 75-81 (2003)
83% to T. brucei CYP51E1 
MFIEAIVLALTALILYSVYSVKSFNTTRPTDPPVYPVTVPFLGH
IVQFGKNPLEFMQRCKRDLKSGVFTISIGGQRVTIVGDPHEHSRFFSPRNEILSPREV
YTIMTPVFGEGVAYAAPYPRMREQLNFLAEELTIAKFQNFVPAIQHEVRKFMAENWKE
DEGVINLLEDCGAMIINTACQCLFGEDLRKRLNARHFAQLLSKMESSLIPAAVFMPWL
LRLPLPQSARCREARAELQKILGEIIVAREKEEASKDNNTSDLLGGLLKAVYRDGTRM
SLHEVCGMIVAAMFAGQHTSTITTSWSMLHLMHPKNKKWLDKLHKEIDEFPAQLNYDN
VMDEMPFAERCVRESIRRDPPLLMVMRMVKAEVKVGSYVVPKGDIIACSPLLSHHDEE
AFPNPRLWDPERDEKVDGAFIGFGAGVHKCIGQKFALLQVKTILATAFREYDFQLLRD
EVPDPDYHTMVVGPTLNQCLVKYTRKKKLPS

>CYP51E1v2 Trypanosoma cruzi AY283023.1 CYP51-2 allele

Buckner,F.S., Joubert,B.M., Boyle,S.M., Eastman,R.T., Verlinde,C.L.
            and Matsuda,S.P.
  TITLE     Cloning and analysis of Trypanosoma cruzi lanosterol
            14alpha-demethylase
  JOURNAL   Mol. Biochem. Parasitol. 132 (2), 75-81 (2003)

MFIEAIVLALTALILYSVYSVKSFNTTRPTDPPVYPVTVPFLGH
IVQFGKNPLEFMQRCKRELKSGVFTISIGGQRVTIVGDPHEHSRFFSPRNEILSPREV
YTIMTPVFGEGVAYSAPYPRMREQLNFLAEELTIAKFQNFVPAIQHEVRKFMAENWKK
DEGVINLLEDCGAMIINTACQCLFGEDLRKRLNARHFAQLLSKMESSLIPAAVFMPWL
LRLPLPQSARCREARAELQKILGEIIVAREKEEASKDNNTSDLLGGLLKAVYRDGTRM
SLHEVCGMIVAAMFAGQHTSTITTSWSMLHLMHPKNKKWLDKLHKEIDEFPAQLNYDN
VMDEMPFAERCVRESIRRDPPLLMVMRMVKAEVKVGSYVVPKGDIIACSPLLSHHDEE
AFPNPRLWDPERDEKVDGAFIGFGAGVHKCIGQKFALLQVKTILATAFREYDFQLLRD
EVPDPDYHTMVVGPTLNQCLVKYTRKKKLPS

&&&&&&&&&&&&&&&&&
CYPxx ortholog 

>AQ910038   GSSTc06412 Trypanosoma cruzi random genomic library Trypanosoma
           cruzi genomic clone G44C5.
          Length = 473

24  FVDLYEAFRHMTLQVIGETTLSLEPEETDRIFPALYLPVVHECNRRVWEPWRAVMPFLEG 203
204 FQERRRCLKELNHVICELILKRWEDRHKPHKRDIISLCISQIDKMDNAMVVQLRDDVKTI 383
384 LLAGHETSAALLTWATYEVISRPDACEKIV 473

gap of 62 aa between these two

>AI066238 TENU2354 T. cruzi epimastigote normalized cDNA Library Trypanosoma
           cruzi cDNA Length = 442
68% to CYPxx of T. brucei
2   DVWPASITGLDGDVTIPAGCSVAVGIQAVHRRPDIWPDPDAFKPERFLDVKLENNFTTP 178
179 NHEAYKDTVDPYAFIPFINGQRNCIGQHLSLMETEVALAYLFLNWDLRFYGADAGATDVE 358
359 KRLFQEEVGRPHVFMFPIVPQNGLKVV 439

>gnl|TIGR_5693|1047053509719 172 21464 bases
3aa diffs to Trypanosoma cruzi CYPxx ortholog
MGILIVIWALILYYFFLFLRGFIMDRHLRNIPEAPGRIPVVGHALILMGGS
PWRKMADWSLDSFSHADSNKKKDT
PRTSRLVRFNVLYQRVVYINDPLLLKRVLLTNQRNYAKDVETSYKHFLCLLGTGLVTAEG
EHWKKGRLLLSHAMRIDVLEEVPKMTIKAVGRVMDQIAAIDDKNPFVDLNEAFRHMTLQV
IGETTLSLEPEETDRIFPALYLPVVHECNRRVWEPWRAVMPFLEGFQERRRCLKELNHVI
CELILKRWEDRHKPHKRDIISLCISQIDKMDNAMVVQLRDDVKTILLAGHETSAALLTWA
TYEVISRPDACEKIVEEARVLFDPARCEEKVVTPEGKTWGIPTASDVRNTLRWSPACLRE
TLRKHSVVPLVMRRALKNDVWPASITGLDGDVTIPAGCSVAVGIQAVHRRPDIWPDPDAF
RPERFLDVKLENNFTTPNHEAYKDTVDPYAFIPFINGPRNCLGQHLSLMETEVALAYLFL
NWDLRFYGADAGATDVEKRLFQEEVGRPHVFMFPIVPQNGLKVVGTPRI*

&&&&&&&&&&&&&&&&&&&
CYP710 like gene

Note: this sequence has no orthologs found in T. brucei, T. vivax or T. congolense
But it does have an ortholog in Leishmania major.  

>AA676046 AW330298 AA908129 AA958228 Trypanosoma cruzi simlar to CYP61 and CYP51
EUGLENOZOA
best match to CYP710A 42% C-TERMINAL FRAGMENT
58% to scaffold 690 of Chalmydomonas, a CYP710 related sequence
VPKGSLIIPSLVGACREGFPNPDVYDPDRMGSERQEDRKFAKQF 
IPFGVGPHRCVGYNYAINHLTVYLALVARLAEWRRTRTPNSDKVIYLPTLYPHDCLCTWRHREGLKAGK*

>gnl|TIGR_5693|1047053506945 824 65792 bases
note 100% identical to T. cruzi CYP710 like fragment but this is intact
72% to Leishmania major seq
MTVISNVLGVQIPYLAEVAAIMLIAHGLAYLLTMFYFARKHKFSIPGPKFVTPLLGGLVMMMKDPY
TFWEKQRRYCPSGYSWLSILNQFTVFV
TRADLCHKIFATNSENTLTLQLHPNGRIILGDNNIAFQCGPRHKALRASFLNLFATKALS
LYLPIQERLIREHLAEWVKKYPFEGKPEEMRGHIRELNCKTSQTVFVGEHLLDPEEFTRN
YNIITVGFLSLPLYFPGTALYKAVQARKKVVDELKAAVIRSKARMSLPDAEAHCVLDFWS
ATILETLKACEDEGVDPPPFASDDAMAETLLDFLFASQDASTASLVMITATMADRPDVLE
RVRQEQTKLCAGDEPLTFDLVQEMTFTRQCVLEQLRLFPPAPMVPMKAHSDFVIDGHYTV
PKGSLIIPSLVGACREGFPNPDVYDPDRMGSERQEDRKFAKQFIPFGVGPHRCVGYNYAI
NHLTVYLALVARLAEWRRTRTPNSDKVIYLPTLYPHDCLCTWRHREGLKAGK*


this fragment is 64% to a Choanoflagellate sequence.
Choanoflagellates are "collar-flagellates" and are thought to
resemble the precursors of sponges, so they may be the most ancient of animal cells.
CO435081   6f10_CAS-06-1F10 Monosiga ovata Lambda Zap Express Library Monosiga
           ovata cDNA.
          Length = 712
51% to chlamydomonas scaffold 690 Best matches in fungi are all CYP61
so a CYP61 like seq is found outside the fungi for the first time.
ARGAFSAFPSRSRGLACGRQSTPAMRSSTSSLQLRASPRRAWLRAXDPECLLDFWSQRIL
EEIAEAKPGDEPAEHWSDWEMGNTMMDFLFASQDASTASLTWTAAFMSERPDVLAKVQAE
QKALRPNDEPLTYDMVEQLVYTRAVIKEILRFRPPAVMVPAIAMVDFPLTDTCVAPKGSL
VVPSIWAACMQGFPHPEVFDPDRMGPERQEDVQYRDNFLTFGVGPHMCVGREYAINH

The sequence seems to exist in Chlamydomonas (green algae), Euglenozoa and 
choanoflagellates (precursors of animals).  This may be one of the oldest P450s in 
eukaryotes.