Ustilago maydis P450s
 
The following 17 P450 sequences were submitted for naming by Martie Smit.
They all are in Genbank with the accession numbers given.
Only five sequences fit in existing families.  The other 12 are in new families.
These are the first fungal sequences to be assigned four digit CYP family names.
Trees were constructed to name these sequences except for two genes that 
are quite different from named P450s, but they show some similarity to 
white rot P450s (CYP5033A1, CYP5034A1).
 
D. Nelson Sept. 9, 2004
 
>gi|46099607|gb|EAK84840.1| CP51_USTMA Cytochrome P450 51 (CYPL1) (P450-L1A1) (Sterol 
14-alpha demethylase) (Lanosterol 14-alpha demethylase) (P450-14DM) [Ustilago maydis 
521] CYP51F1 GenEMBL XM_401277.1 in the 51 clan
MVASSSSATASLLDQLFALTPLADSSAWIKTITVLVLLPLLAVVLNVASQLLLATPKNHPPVVFHFVPVIGSAIYYGIDPYKFFFE
CREKYGDVFTFVLLGRKITVALGPKGSNLVFNAKHQQVTAEDAYTHLTTPVFGKEVVYDVPNAVFMEQKKFVKVGLSIENFRVYVP
QIVDEVREYIKSDARFSALKTRKTITVDIFQAMSELIILTASRTLQGKEVRQGLDKSFAQLYHDLDSGFTPINFVIPNLPLPSNFK
RDRAQKKMSQFYQDIVAKRRAAGASTSADDASGENDMIAALIEQKYKNGRALSGVEIAHMMIALLMAGQHTSSATSSWAFLRLASR
PEIIEELYEEQLNVYSDGHGGLRELDYETQKTSVPLLDAVVKETLRLHPPLHSIMRYVKSDLAVPPTLSSPTSTKSEPDAHYVIPK
GHYIMAAPGVSQVDPQIWKSSDQFDPHRWLDATTAAAMQDSGEDKQDFGFGMISTGANSPYLPFGAGRHRCIGEQFAYLQIGVILA
TFVRIFKWHLDSKFPDPDYQSMVVLPSKNGCAIVLTPRAESLHLD
 
>gi|46095566|gb|EAK80799.1| hypothetical protein UM00005.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score BAA09832 Rhodotorula minuta 
CYP53B1 benzoate hydroxylase score 514 E 1e-144
CYP53C1 GenEMBL XM_397620.1 in the CYP53 clan part B 54% to 53A1 54% to 53B1
MVETDLVPRIGAAIQWSVESPAHVVITLLGAVVLFHVVPYITNTACIKYPGPFFAKFTDFWLLRTALIGHRFEEVHKQHQKYGKFV
RIAPNHVSIADHEALQPIYGHGTGTLKPAYYDAFVPPRPFPRGLFNTRDRAEHTRKRKIVSHTFAPKTIVAFEPFIRREVQLLLER
WDEFCDKATKDNTEGPRGIKGRAWLDSLMWLNYFAFDTIGALAFGKTFGMLENGVDQAKVEYEDANGNKQVDYCSAVQIINERGEF
SGTMGLAPVWMRPYLIKLPWFSSRLKSVKKLTGIALARVNDRLQNGSEREDLLAKLQAAKDDRGEPMGKMELTAEALTQLIAGSDT
TSNTSCAIVYHLATHPDKMRKLQAELDRELEHAEEVPLHADVQELPYLQAVLSESLRYHSTSAIGLPRVIPAGGATVCGQQFPSGT
ILSVPAYTLHRDKSVFGADAEEYNPDRWLAPNAKRDFEKAFIPFSVGPRACVGRNVAMMELSILIAAIFRRYDIVLAEPDKPLDTF
EGFLRKPVKLEVGLKRRN
 
>gi|46095935|gb|EAK81168.1| hypothetical protein UM00350.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score sterol C22 desaturase 
characterised genes/proteins with highest BLAST score BAC0001142 Symbiotaphrina 
buchneri 491 E 1e-137 
CYP61 GenEMBL XM_397965.1 in the 61 clan 49% to CYP61 N.crassa
MASILGVGQQGLNFSRSSAPSSPLIPRDSALGKVFSIVDLTRLPSLQEADRTTVVFTILAVVATLLLAEQYTYQKKKAGLPGPKWT
IPVIGKFADSLHPTLEKYQEGWNSGPLSVASVFNIFIVIASSNEYTRKILNSPTYAEPCLVASAKKVLCPDNWVFLNGKTHVDYRR
GLNTLFTRQALGIYLGIQETIYKRYFEEWLADTNPNPQPYMMKFRDLNMETSLRVFCGNYIPDEGAKQISDNYWLITVALELVNFP
FAFPGTKVYNAIKARKTAMKWFELTARESKKRMAAGEEVTCLTDAWIKAMVDARLQRDNADLEAETRRVLLRDFSDREIGMVLLSF
LFASQDAMSSGLTYLLQHVADRPDVLRKVREEQYRVRGDDINAALTYNAIEQMEYTKAVVKESLRIKPPVIMVPYLTQKDFPIDKN
YTVPKGSMVIPSFWNSLHDEKVYPQPDEFKPERWLDEADPANKSPKNYLVFGSGPHYCIGQQYANMHLTAVLGTASVLMNWEHEVT
PLSEKVEVIATIFPKDGARIKFSRRAAPAPGTAPEVAARA
 
>gi|46096525|gb|EAK81758.1| hypothetical protein UM01424.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score AAF21760 Penicillium chrysogenum
 phenylacetate hydroxylase score 369 E 1e-100
CYP504C1 GenEMBL XM_399039.1 in the CYP64 clan 46% to 504A1
MRFELSSESLATVPLFVWLSATLVVGHILYTAVKRPKINLPGPRGWPYVGNLFQLGEDAAQTYYKWSKRYGPVYKVQLGEREVIII
NSAQASKELLTDLGSIYISRPLFYTFHTVVSSTAGFTIGTSPWDESCKRKRRAAATALNRVAVQSYVPIIDRETFSLVEDLYSAKG
KAIAPFAYFQRLALNVSLSVNYGSRLDKISDELLQEIVEVETHVANFRSVSNSAADYLPIVRYVQMLVGGNNSFAAQIRARRDKYM
RRLLEDLKARVKAGTDIPCITGNIIRDPTAKLTDLELSSICLSMVSAGLDTLANTFIWSMGFLAKHPEIQEKAYSELSKVYQGQVP
NSDSEQVEYITALHKECSRYFSVLKLALPKATISDSSYKGVNIPAGTTVFLNAFAIHQDAERYGDVENFRPERFLEPGEENKQSHY
SFGAGRRMCAGVHLANRELYIAFCKVIHFFHIQLSDVEEEKHFDINPKTGCANPKGLSSTPKPFKVRFVPRHPAALEQWIESEREK
TDLMASAA

 

>gi|46097632|gb|EAK82865.1| hypothetical protein UM05074.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score AAD34565 Aspergillus terreus 
activity during lovastatin biosynthesis score 376 E 1e-103 and AAF21760 Penicillium 
chrysogenum phenylacetate hydroxylase score 369 E 1e-100
CYP504D1 GenEMBL XM_402689.1 in the CYP64 clan 504 subfamily 48% to 504C1

MNTTKLLGTGALSPSFVFDHDSGNAIFGLSSSTLVVLVAMIAVSTLTLKSVLPGDRSINLPGPRGWPIVGSWFDLGNNWAEYFRQA

AKEYGDVFKVHIGNRTVVVVNSPKAAHILFNEHGSSLISRPWFYTFHGVLSKSSAFTIGTSAWSDSTKNKRKAAATALNRPAVQSY

MPIIVEESLDAVRRILNDGNAGKNGIVPYSYFQRLALNTSFQVNYGFRMGERDDGLFDEISEVIAKVASVRAVTGSLQDYVPLMRY

LPANAKSKAAASYGLRRKKFMSKLYEELEQRVNQGKDESCITGNILKDTESRKKLSRLEIDSICLSMVSAGLDTFANTMIWTIGFL

AKHPEIQRKAQAELLAHYPNRELPHVDSEDLVYIHAMAKEASRLFNVFRICLPRTNVSDVTYNNAVIPAGTTFFLNSWACNVDAEK

FADPFEFKPERFMDKSASNAHVENKMGGVETYAFGMGRRMCPGVFLALREIYTTLVFLTHFFDIAPDGEYDIDPLTAVEDGRAFSV

RPKPFKVRCTPRPGVDLSPVLDKQ

 
>gi|46101937|gb|EAK87170.1| hypothetical protein UM06463.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST scores AAP79889 CYP557A1 Rhodotorula 
retinophila induced by decane score 334 E 5e-90 and CAC67445 CYP86A8 Arabidopsis 
thaliana score 208 E 3e-52
CYP5025A1 GenEMBL XM_404078.1 in the CYP52 clan 39% to 557A1
MSLKVQLPHSSLCRIGQRTTGAQGGLSSDKAAQKEKVGPLKSGLLFSYMQNFCALQTRLRRPSRTTELDTMDFKPFLTLQHFRPQG
FAGDVLAPGASYNQTWNTMASKFNGRGGNRVETGKVLEAASESLKETVPLLQLVVRARHHPLLVFLVGLFLGTIYLLYRYWDCAVG
CERRPDLKGPKGLPLIGNLMWALKNRDPLSYQVYAQQKYGYGNTHTLPGLGRLIDISRPDWIEHVQKIKFSNYVKGEQFHDQMRDV
LGDGIFTSDGERWKMQRKVASRIFTVSSFKAIITQTIREDCALVEQLIETYARQGTVFNLQELYFKFTLSSFVKIAFSQDIKSLSE
PDRPDTFGDAFNYAQKVLDMRFVQPWWKIAERFNETGRKMRAARKIVEEFTTNIVEARRKESEAMGEKSKPESSRKDLLDLFMAYR
SSDGQRLSNQQLKDTILNLMIAGRDTTAEALSWMSWHMLTKPDVYDRIRHEIDATLEEEGEQAGLEIDYDVFEQHTAKLTTFQETL
RLHPSIPKNIRRALQDDVLPNGGPRVRKGDLMLYSDWAMGRNPDIWGPDACEFKPSRWTDQETGSSIKYSQFQAHFFNGGPRLCLG
QKLASYEVVQLIHHIFAKFDLELIDLGPGRSAGFGKVPDYLNSLTHPMKRPLMVKATLRCCKEGTR
 
>gi|46102051|gb|EAK87284.1| hypothetical protein UM06473.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST scores AAP79889 CYP557A1 Rhodotorula 
retinophila induced by decane score 264 E 5e-69 and CAC67445 CYP86A8 Arabidopsis 
thaliana score 213 E 7e-54
CYP5025B1 GenEMBL XM_404088.1 in the CYP52 clan 38% to 557A1 if inserts removed, 42% to 557B1
MISLVQHSFDFFETRLGLAVGFIITLALVYRDRAVFVAKCDHIKGPPGLPLLGNTLQVFKEAADPLQAMLSRSAVYGLPNTMTVLG
MGRAINITRPDWIQHVQKTNFSNYVKGPKLHTCLKDLLGDGIFNADGHSWKAQRKVGSNIMTMSNLKNLVAGVLDAQSQRFSDLLQ
QAAKQGTPIDLQKAYFDFTIQTFLRIAFSTDLETVQSTRIATRSEQQKAAQHLSFADAFDLAQRLTVRRINRPWWKLTRRWEPSEK
KLEHAIRTIDRYLYPLIERRSQNKSKADKRHADLLDLFLSYRDDQDQPLTPKQLRDALLNYLLAGRDTTAESLSWASFELLRHPEV
VHDLRQELMSHSIWFDPHQKIDDDDAEQRSSSFELSHTKQLHHVRSIYHESLRLHPSVPRSSKIALQDDVLPGGVVVPKDTTVIWS
DWLLARNKSVWGDDADEWKPRRWLNAEGEFINESPWKFHAFNGGPRTCLGIQLAQFQGMYMLSRIFSDFDLELESDRGLHFEPEVE
NTLTLPMKHPLMVRVYTRAKTSRAP
 
>gi|46097306|gb|EAK82539.1| hypothetical protein UM01723.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score AAP79889 characterised 
genes/proteins with highest BLAST scores AAP79889 CYP557A1 Rhodotorula retinophila 
induced by decane score 262 E 2e-68 and AAL54887 CYP94A5 fatty acid hydroxylase score 
202 E 2e-50 
CYP5026A1 GenEMBL XM_399338.1 in the CYP52 clan 45% to EAK82744.1 36% to 557A1
MPAFPSSSAANSAGRHIELRSDNAYVQHLVHVINTVLERTGLALPVLVLTLLFLTIKYHNRTIFAKPPRKELYSPPAWPLIGHTLQ
AMKYTDNILDWFLEQSRKHPVGFSASIAGTGSGQMNFIYRPEYIEYVQKTNFENFEKGQAVKTRFSDLLGQNGIFNSDGHVWKTQR
KMASHIFSVYQFRTWVQTVVQREMDSVVGILDALTEGKSSSDPATLLLPDLFFRYTLSSFGKMAFGSDIDCLSADPSCLEREVEFS
NAFDFVQMVIDKRFRKPMWQLIERFSSEGRKNARMVKKINSFSGQIIEQRLREREAGIQKEKMTSDGKEGKDLLDLFMDITTDRDD
LISVVLNFIIAGRDTTAQGLSWLFYELMKNPQYVEEIRSEIRNVLGNTDGSIRKLDYDTTKDLVFTQACFNEAIRLHPPVPKNGKR
AIKDDVVVPQGPTAAGLPPIKIYAGELLSWSDWVIARNPEVWGPDCCEFKPMRFIETVTNEDGTKTRSLKNFGQWKFHVFNGGPRL
CLGMTLANYEALSIIAAVMNRYDFGWGTKAQGQTADWPLKYLPSVTHPSQMYTATVVRRDELM
 
>gi|46097511|gb|EAK82744.1| hypothetical protein UM01863.1 [Ustilago maydis 521]  
characterised genes/proteins with highest BLAST score AAP79889 CYP557A1 Rhodotorula 
retinophila induced by decane score 236 E 9e-61 and AAL54887 CYP94A5 fatty acid 
hydroxylase score 202 E 2e-50 
CYP5026B1 45% to CYP50026A1 GenEMBL XM_399478.1 in the CYP52 clan
MSILLPTVHSSFEHLTPTHVAIASVLILGLLCLIAPDRYIFVSHRKGIKEVPGALPLIGNLLFLLDIAAKRRRFLDEFLRMQKSIG
AGGMPWAATFPYLGGRVTSINRPEYIRWVQKTNFENYIKGSFFQKSMGDVMSLHGIFVADGEIWRKQRKMASHIFSVGNFRTHVQN
TIHRDLAILNKLFRDASSKNTELNLPDLFFRFTLSSFSLMAFSADIKCLPSNVGDLSKVVEFAANFDYAQRVMDERFVDPLARFTE
LFSPQGRKMRRTIKELHSFCYEIIDLRLAARARGEAQAASGKGDKDLLALFMEQNLTRDELLPVVLNFLIAGRDTTAQALGWLFYE
LSKHPECIEKARQEIHEKLGSGSSFQSMAYDDLSSLVYVQACFLEALRLHPSVPKNIKLAVKDDVIRPYAQPCSDADVAPNAVPTT
QKLPDLVIKKGETVTWQDHTMARMPELWGEDCEQFKPERFIEERKDGSIGIKTYSQYLFHAFNAGPRLCLGQTLATYEGCAVVAEI
LGNFDVVYDHKALKEDEPTYDDSLTLPIKNPYTIHVRARDD
 
>gi|46099939|gb|EAK85172.1| hypothetical protein UM04109.1 [Ustilago maydis 521]  
characterised genes/proteins with highest BLAST score BAA33717 Coprinopsis cinerea 
involved in mushroom morphogenesis score 220 E 1e-55
CYP5027A1 37% to 530A1 with some insertions deleted GenEMBL XM_401724.1 in the CYP64 clan
clusters with CYP664, CYP665, CYP530 and CYP619
MFALEVDERSKLGSLLLGSRFKLADSVLARGEWIFAATAAAAVLVLLTLRFQAGQNCQGRFKRIPGPRQLPIIGNIGQVDAARQHP
KFLEWARRYGEIYQVRFGSNRIVVLNSAKASIELLDRRSSIYSCRQGPHFAHDLMSAGQRQVFLPYSKEWKAARASVHPFLMGTKS
QGYKTIQEHESAVLIHDLLRHTQHCLSHRRDQDLPLTHETGWEAHVRRYTTSVVMNITYGRRVTSTYRNPELHKIYDVLGNLAVVG
QPGRNACDAFAFVRKLPDWLAPWRVQAKAMHKWEMELWGGLLERTKRDRQHGRPCQGYVASVLDRRQHAPSSASFDGSGLTAEGEM
TDLLLAYTAATVLEAGSDTTASSISFFILACLNNPRIWDKLFKELISACGDALPTFDKIQDIRYLRACIKETLRRRPPTIMGIPHR
VIRDDVYDGYLIRAGTVVMGNVWAIHNDPQRYPNPEKFEPERFLGDDLSAAQSAATMDAERRDHYTFGWGRRVCQGMHIAENSLMI
VLARLVWCFELSTPVSSDGTTPIAVPSIDQEANFLPGFVSQPKAFACHFVPRSDHVVQTLENAAAEAQEYWSANDLEPDQRDHYYK
D
 
>gi|46098084|gb|EAK83317.1| hypothetical protein UM02195.1 [Ustilago maydis 521]  
characterised genes/proteins with highest BLAST score S45583 Nectria haematococca 
CYP57 pisatin demethylase score 235 E 2e-60
CYP5028A1 37% to 532D1 GenEMBL XM_399810.1 in the CYP53 clan part B
MTTAPHTGIVESSVVATLAKILLTPLSGWPSMLQLLTGSFVLLFGWIVYNLAISPLSRYPGPLSARLGIPFWRFWHSLQGDYAPAL
YSLHRKHGDVVRIGPTHLSFADPTAMNSIYSLSDGVSSKFRKSNFYRSFQVFKAHPSIFSERDPHQHSKRRRAVASAYSMNSLVKL
EEYVEDVTELLLKRLDELVETNSVVEGGGTSEKTKTKAVRLDPWFHYFAMDVVGELAFGQSFNLLHRGKDDERFLTGVLNLSQWGA
VAGCMPLLSSLILWLFPRITGQPGGSVIGDKTTSRIQTRYAEVQDNGGVASRPDMLTKFMEARDPDTKEKYSMKQVLFSASSVMSA
GSDTTATSLTIFFGYLLEHPACYAKLRQEINEAIQAGHLISPVKYAKGAQLEYLQACIKEALRLSPPISMDLPRYVPAGGALIGKN
PHVIPAGTTVGISPYVLHRQPEAFGADAEMFRPERWLEGGEEGRKAMERFNMTFGGGSRACIGKNISLMELSKTIPEILLRYDIKK
PAVSTHLHTTPSNAKQPFFQGKSAWFLEAHVSHHRFHNFE
 
>gi|46100797|gb|EAK86030.1| hypothetical protein UM05791.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST scores AAB39881 (PIG16) Planta induced
 rust genes Uromyces viciae faba Score 195 E 3e-48 and AAM48961 trichothecene C-15 
hydroxylase Gibberella zeae (Fusarium gramearum)
CYP5029A1 GenEMBL XM_403406.1 38% to 65M1 C-term in the 53 clan part A
clusters with CYP671, CYP628, CYP670 on trees
MAQTAMQSFEQHRFLCIAVLSVASHHLIFRHVELWPMQLLALTTALFSIDVSLRHSVNKTTLFPDAAKLAYVDLAVWTLGVLISIG
VYRLFFHRLRHFPGPKAWAVSKFALMTTDAKGLRPRALEEAHKKYGDVVRTGPREISINAPTAIAPIMGAKSSFWRGPWYEATAGA
RGAHVPRNLHSVLIESDHSARRKIWDAAFSAKALKGYETILVDNIDNMVNQLEKRSQRKETVNIDDYCSFYSFDVMSQAGFAGDFG
LLNHGQLTPMIQALEDFMSFVQLVGNLPYLVEVFGLLPNPIAEFDKYMTRIVMERKARKEAVPDIMGHLLHEVETEKGKSSKRQDA
EATTDARLIIVAGSDTSSTTMGIAMFFLMEHPKILADLRQELLDVFGDDASLLTDFARMDDKTCPLLNAVINESLRIFPPVPTGLQ
RESTSPAVVDVNGQKVVIPANTIVTLPIWSLQRDARNFSPEPLRFRPERWLHPENEEHFNKTAFTPFSFGKTSCVGKVLAYMEIRL
VISNLVRRFDFVPTGNYDAQKFQDSLVDAFVTKRNHKLPVHVKVRNHVGP
 
>gi|46101933|gb|EAK87166.1| hypothetical protein UM06459.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score BAA25811.1  CYP3A31 from Syrian
 hamster Score 139 E 3 e-31
CYP5030A1 GenEMBL XM_404074.1 43% to 576A1 C-term in the CYP53 clan
clusters with 576A1 on trees

MAKLSRLDPCSRIAVYVERTHGLLLEVQQPSNTKRLDLLASLNPHLNAPPSAAKMLNETIFGRQVADVREHGLFGRPFWLNALYAF

LLYSAFLGYKSYFLHKTSRIPGPWHLHWTMLPALFYYVRGTQWRYVDKLHEKYGPLFRLGSRQIYVSDKDAIRQLLAKENLPKVNW

YASLSRDPKTAGMFTTVNKEYHRSRRRLMSPAFAVEFTRQLEPFLVDATTKLFEGYHQRVQKASDPFKPLLFNVYEDLACLAMDIL

GETAFGVSFNLVACRDDPGADRKFADINKLLAKYLHDGGIRFFCRPFDKYMKRDLNVYKLTNPLVDARFAETEARRAAAGDAAEQV

ETREDILQYLVDASLEMQKGQKEKLTRTHVRDQCVELLIAGGETTSNTITYILKALLENPAKLAKLYETIEPEPLDDAVPGFTQLP

ETPYLDACIQEGMRMYPVTSELGRRTGKEPTVVLGHVIPPRTAISASLRALHYSPKYWASPNRYWPERFLPADSIHSASDPAPAAD

MEAFMPFGCGPRNCIGSKFAWHEMRMVLHTLLARYTISAVEATDKVDFRQFVTFQLAKPEYRIAVTPRMALKA

 

>gi|46099960|gb|EAK85193.1| hypothetical protein UM04189.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score AAN74818 FUM15P Gibberella 
fujikuroi polyketide synthase fumonisin synthesis score 171 E 6e-41 
CYP5031A1 GenEMBL XM_401804.1 
clusters in the 56/547 clan with CYP616, CYP617, CYP618, CYP582, CYP547
MSFEVTLSSAAEQIFALLLKPISLIRAYPITSFLASLVLVPLFLVLSAALFFFGIATWRYISLHILGTDMYSHIPRPARTDRYPLL
TGHLGYIRKSPPVEGHLTFHRELNTKVYVYRGLFYSPRLMISDAKAMLHMLSAANSYNYEKPASTRLVLKNFLGEGVLVAEGDVHK
RQRKILQPAFSVGAIRELNPIFMRYSRDLVEKIGQMVDRSNSNAKEGGVDGVTRPFVAQSSYAMKASKPGEPVIDIGWWCIRAALD
IIGDAGFGYHFEALKVDVDPSIVVRRAGDELGDAFNTLFKLSLKIDIVRFLQLYLSNFKWLKWVNSIPNKRKWATDSAYGELEKVS
MQIVDRKKAEIRGEMQDEIEARGKTTSSDAFTKADFDEKDSVSTNGSAPGKDLLHLMMRANMAADVSPKEKLDDAELIGQITTLLI
AGHETTSNQTAWTLWLLAQQSSVQQKLRDEIHDHFGRGMERDPGYDELMSMPYLDAVCKESLRVNSAVPSTIRVAKTSADVPLSKP
YPTRDGRGTFNSIHIPAGREVIIPITLINIDDEIWGPDAAEFVPERWLDLPPAPRQNGLPMHLMSFISGPRGCIGNRFALAEFKAM
LCHLVGSFHFETVQDWKVEAKQTAVIRSRVVGQEDVGPQMPLRISRIPTV
 
>gi|46100834|gb|EAK86067.1| hypothetical protein UM05664.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score NP_000768 CYP3A5 Homo sapiens 
arylhydrocarbon hydroxylase score 165 E 3e-39
CYP5032A1 GenEMBL XM_403279.1 
clusters in the 56/547 clan with CYP616, CYP617, CYP618, CYP582, CYP547
MQVKLSSSSLVSESVLGKLAATAHSHRPTTFIGYVALAIGTVVLLLGLLITYSLAKMLYRTTIYHYYISPLRHLPGPDPKPFLGNV
EEFAKKPGAGAELDWSRKYNKDGVYRSTFLFGREAIHFHRPKALRQILVEDPYTYPKPALAWKLLGLIAGYGLLTVEGDTHRKMRK
TMNPAFSLTNLIEQFPVYYAKIYPLVDVLNQKVEESPEESAVIDCDAWVNKALLDIICLTAFGYDADSVNNPSNELASAYHAVTSM
QNGRNQARLNLLLNLPFGDTVLDWASDTSGWDWFLKRCKPGTAWQTFFQLLNGMHRIKNVSKEILYKQLNSGERAAQGGQFKAIID
IIEESYLTENDGKPKSLKQAERDMITQVLTFLGAGHETTASGVSWTLWNLATHQDIQDKLRKECKGLMDQDDRPPYSAIKGLAYLD
AVINESMRITPPVPRTIRMASKASYIDGIYIPKNTLLPISNRAINMDPTVWGEDADEFKPERWFNLPDKYDRTFSMITFIAGAHAC
IGRTMSYLEMKAVICILVSNFKFEPVSKDQSPIMDTLITMKPQGGLELRVSKV
 
>gi|46097409|gb|EAK82642.1| hypothetical protein UM01980.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST scores AAR11387 P450 induced in 
Triticum aestivum (wheat) by Fusarium graminearum score 141 E 1 e-32 and CAC85662 
CYP4A24 fatty acid hydroxylase from Sus scrofa score 132 E 2e-29
CYP5033A1 36% to CYP5034A1 GenEMBL XM_399595.1 37% to white rot Scaffold_7 C-term
MAISTSSRLVIHQDVLSWLQHRPFASAFTLLVVYITYKLAIKPILFPSPYRHLPRPERASYILGQRIVEANGLTYIDASTNQRVKV
SGPGEVCKHYARTLDTSVFVFPEPFGGETLFISDPFALNAILADVDKFQSDLLRTTIIEFIVGKGIVARFGDAHRKQRKLMAPAFT
PAHIKGLTPIFAKYAQLMCHKIALADDESVDFAEYLDCTMLDIIGEAGFGYRCSALERGRGGSELSSAFNSVNQAAIDFGPARAIH
LGLSAMLYPRASIWPLSEANRRIAKVNRVMDRITMQIVREAKSRVEKEGEDLGDKKDLLSLLIKSNLDARIGERMTDKEISGQIQT
FMFAGYETSSVTTSWTLYFLARHPEVQNKLRNILTATLSERKGIPLEELDVSTLEYDDVWCQDLEYFDWILAETLRLCPPLSGNDR
QAMQDSVLPLMTPVKMTNGENVSQLMVKKGSRLTIGIKTVNCDRKLFGDDADEFRPERFAELPQRHAEAKLPPYATYSFFGGPKSC
IGSKFALTEMKVIIIAVLSRFQLSPEPGVTIKQHQALIVRPRVE
TSTGGPAAGMPLRIKRLPHQVSV
 
>gi|46096354|gb|EAK81587.1| hypothetical protein UM00202.1 [Ustilago maydis 521] 
characterised genes/proteins with highest BLAST score BAD02914 CYP4F42 Xenopus laevis 
score 149 E 2e-34
CYP5034A1 36% to CYP5033A1 GenEMBL XM_397817.1
MSTTLSNKLVRWASSHPFVAAFLALVLVSTLYLAWKRASAKPSVWLNLPGPERTSFLTGYSRDPKKKLGVKNPTAPDREPIIGDDG
VDITETPGVAIARLYDEYQCDHLVFPRPIGGELLITRDAATMNHILNDSYNYTRSTAGTKATKIIIGNGVVAVFGDEHKKQRKMLA
PAFSVDSLRGLMPIFTQATAQMMDRFGKDTSLEKRWGRDVKDSVKWFGRVTLDIIGRAGFDYDFGAVEQGPNGLAVRSTFHDAMTS
TMNVSPIDAVVGAFMFFVVPSLLYILPLTENVRKLREMRSELIKCSHKIVAAKAKQIRKELEAGVDAKETFAGKKDILHLLMRANM
SPEIRPQDRLTDETLAGQIVTFIFAGHETSGNTMSWCTFFLALDVEYQQKLRQHIQKALKEMGKDGDAITELTWADVNSEEMRPLD
LCIQETLRLRPPITTTFRYSTKDDQLPVTTPFKTKDGRTLSTIPITAGQEIAISVTGNNMDPKYFGADPHRFRPDRWNNLPDLHAK
SKLPSPYGSFVFNGGPKVCIGSKFAMTEMKVILVNVLAKYRIEPVEGLKYKSVEAVVQRPAVIGFEKEGSQLPLRFVHDPL