whitefly Trialeurodes vaporariorum using 454 pyrosequencing

from Yannick Pauchet Jan. 25 2010

 

CYP2 clan [5 sequences]

CYP15, CYP18, CYP303, CYP304, CYP305, CYP306,

CYP307, CYP342 (name changed to CYP369A1), CYP343 (note CYP304 is not

found in honeybee)

 

>*CYP18A1 whitefly Trialeurodes vaporariorum seq106_3'truncated

57% to CYP18A1 Pediculus humanus N-term

MAFLRSLILYILHEVKSRDLLIFIGILVLYKLICELNVIRKLPPGPWGVPFLGYLPFMTSDRHLQFAALSKKYGSLFSTKVGNQLIVIISDYKLIRETFRKEEYTGRPRDQLTNIIEGYGVINCDGRLWKTQRRFLHSHLRSFGMTCMGKGKQSMQLRIMVGSMTPHLMSLHLTSTVNHPPIDSL

 

>*CYP304G1 whitefly Trialeurodes vaporariorum seq96_full_length

37% to CYP304E1 Tribolium castaneum

35% to CYP304B2   Aedes aegypti

34% to CYP304A1 D. pseudoobscura

MSPLLFLVYFSALCFFLYRFMVSRPKDFPPGPLRWPIFGSLLHLYWRNFKLPFMAAHDWVKEYNAPMIGLYLGDTPNIIVNDPDLIKEVFTRPEFQGRPWTRTGELRSLSKDKTLGVIFTDGEGWSEQKRYALRNFRDFGYGRRSESFEMVLEEETRNLITLIKDENPVVMKDGVAKVPELFYLFNINMILNVFDGERFSFDQLPETMRLVDTAFDFLKYTEPTGGAINYLPWLEYLFPRGYGIPEIIDTSTTLNGFLGNMIQRSKKNHSSELLRGYVDVFLEKMKNGKNNHSSFTEENLLNILVDFWMPAVTTISAAQGFLFEFLLYHPEIQRKMQEEVDSVVGRGRLPTLQDRKNMSYTEATIRETLRMKPVVVFALAHRCTKGAKLGDHWVPEDALLSPNLYNHHRDEKLWRNPNVFDPTRFLDSNGEIIKKDPSLPFGVGKRVCPGETFARQNLFVTTAAFFQNFSIECPAGIPPPNLHDLRNGVNLSPNPFKVKIVHREK

 

>*CYP305? whitefly Trialeurodes vaporariorum seq111_5'3'truncated

47% to CYP305B1 Helicoverpa armigera (aa 371-456)

might be CYP305 or CYP18, possible end for CYP18A1

too short to name

GVLNDTIVDGYLIPQNATVLGDLDAYYRSPECWPNPESFRPERFLNAKGDGLISPDKHFFFGRGARSCIGDMLARHFIFTFFTSILHRYQIRLAPSV

 

>*CYP306A1v1 whitefly Trialeurodes vaporariorum seq107_full_length

46% to CYP306A1 Tribolium castaneum

MEISVISMTLLKAIGFAIAVIFIQNLINLYKHLRELPPGPYGIPILGYLPWIDPKTPHTTLTDLAKRYGKIYSLKFGSLTTVVLSDPALIR

QAFAKDVFSGRADLFVTHGIMDGYGLIAAQGEVWKEQRRFAVATLKNLGM

VKHGAKREELEKRIMVGVNTLFEKLRTLEGEAVEITHLLFHSIGNVMNSLVLGKVWSEDDPTWIWLQDRIEEGVKMMQVAGPINFIPWLRFIPKYRQTIEFLISGKNETHEVYEKIVQESPRDNQDFVSAYKVEMEKRQNSATPHFFNKKQCHHFLADILGGGTDTTATSLRWFFLLLLTHPEVQEKIQRELDEIRGRHENMELSDMEQTHYFKAAFAESLRIRPIVTVGIPHATMADTTLANFQIPKRSMIIPLLWAINMDPELWSRPEMFRPERFIDSKGQFSKPDHFMPFQVGKRMCPGDELSRMMTFLFCTNTLHKYQLTSPNSKQELDDAFQGECGLLYLPKKYLIFFSYEANINLIIN

 

>*CYP306A1v2 whitefly Trialeurodes vaporariorum seq110_5'3'truncated

top line 58% to CYP306A1 Pediculus humanus C-helix region

IDENTICAL TO CYP306A1EXCEPT 1 AA DIFF AND THE END DOES NOT MATCH

bottom line is a poor match

QAFAKAVFSGRADLFVTHGIMDGYGLIAAQGEVWKEQRRFAVATLKNLGM

EVKSDDPYYDLLKKKFEAVVGTPSWAKLRSLKGSSKLKKSDSEDEEDSQLIRHCGKMINTKIQ

 

CYP3 clan [49 sequences]

CYP6, CYP9 CYP336

 

>*CYP6DB2 whitefly Trialeurodes vaporariorum seq32_full_length

52% to CYP6DB1 Acyrthosiphon pisum AUG5s6612g1t2

MFSFLGKIWLPLLMFIFFFLYWHYTKTFDYWKKKGVFYYEPTIFFGNIKDRILFRKAFHQFWRDIYMKMKGHKYVGFFEGRRQTLVILDPEVIKQICIRDFSHFMDRPTLQMRYPLIQRQLLNLKGQEWKQVRSLLTPGFSSGKLKAMEILLKQCGKQLKQYLVKVTDEKDGAVLEMKEFYEHYTMDVIATTAFGVQSDSLENPDSEFVKTTSKFTSISFSERMLIFAVLIFIPQFAKYVPITFFNMEVMNFLANVIKDSIKHRQSKNEKRSDFLQLMLDVKEELESKEKSGDGEPSPNLSLMDETTIIAQSVLFLVAGFETSSTLLTFASYELAQHKDVQEKLRNEINEAVKEHGEDNLYEAIQSMPYLDMVLNEALRKHPPLARIDRTCTAEYTIPDTSILIDKGINVSIPVLGIHYDPDYYPDPEKFIPERFTAEEKSKRSPYVFLPFGLGPRNCIGLRFAMLSTKMAIIYLLKDFTIDVCEKTKVPYQYSRFTMLLKAEGGIWLRIKPLSTTLS

 

>*CYP6CM2v1 whitefly Trialeurodes vaporariorum seq2_full_length

54% to CYP6CM1 Bemisia tabaci GQ214539

MELLESLNLVSTNSLLISASVILCIVYLYKTTFSYWSNRGVSGITFIQSLTNSLRLFLRIDSFQSSFVNLYNLLEGHKYGGMYQFTTPALVLRDPDLIQNFLVKG

FSQFHDRSTPQDENLDPLSGNLFILTGDRWRNVRQKVSPAFSSAKLKIMFLNLKECAQELDDYLQRLTADTGYVDVEAKKLISDYSLDVIGACSMGIKCSSIGTGETDFKRITRDVFRFDLRRTVHALLEVISPKLPPLIGWKAVRMEVEEFFMNACREAAALKEHESNERKDFLSILMNVRKSEESMRQKSESLDDKDDLLFSDNIIAAMISSFFSAGFEPVAATMTMCLYELAQHPEAQEKLYAEIQSVEEEIGEEITYESLKKFQYATQVIEETLRLYPVAPVLXRQCTERFVIPESRVVIDKGVKLFLPLYGLQRDAQYFSDPDEFDPERFSEENKDKILPGTYLPFGDGPRACVAYRFAMMDMKYMLVRLLSKYTVHTTA

ETQRKIVFDPKSFTLIPLGDLILRFERRT

 

>*CYP6CM2v2 whitefly Trialeurodes vaporariorum seq29_full_length (missing about 100 aa at N-term)

57% to CYP6CM1 Bemisia tabaci GQ214539

same as seq 2 except ends and one X (polymorphism)

KFFLVQKD

FSQFHDRSTPQDENLDPLSGNLFILTGDRWRNVRQKVSPAFSSAKLKIMFLNLKECAQELDDYLQRLTADTGYVDVEAKKLISDYSLDVIGACSMGIKCSSIGTGETDFKRITRDVFRFDLRRTVHALLEVISPKLPPLIGWKAVRMEVEEFFMNACREAAALKEHESNERKDFLSILMNVRKSEESMRQKSESLDDKDDLLFSDNIIAAMISSFFSAGFEPVAATMTMCLYELAQHPEAQEKLYAEIQSVEEEIGEEITYESLKKFQYATQVIEETLRLYPVAPVLGRQCTERFVIPESRVVIDKGVKLFLPLYGLQRDAQYFSDPDEFDPERFSEENKDKILPGTYLPFGDGPRACVAYRFAMMDMKYMLVRLLSKYTVHTTA

VKPQKKKLF

 

>*CYP6CM2v3 whitefly Trialeurodes vaporariorum seq37_5'3'truncated

60% to CYP6CM1 Bemisia tabaci GQ214539 C-term

identical to seq2 except for one X

SRET

YAEIQSVEEEIGEEITYESLKKFQYATQVIEETLRLYPVAPVLGRQCTERFVIPESRVVIDKGVKLFLPLYGLQRDAQYFSDPDEFDPERFSEENKDKILPGTYLPFGDGPRACVAYRFAMMDMKYMLVRLLSKYTVHTTAETQRKIVFDPKSFTLIPLGDLILRFERRT

 

>*CYP6CM3 whitefly Trialeurodes vaporariorum seq15_full_length CYP3 clan

52% to CYP6CM1 Bemisia tabaci GQ214539

MELLESFHLISTNFLLISASVLLYIVYFFKTTFNYWSVRGVHEITFTQSLRSTLRLALRIDSFQSSFTDLYHLLEGHKYGGMYQFTTPTLIVRDPNLVQDFLIKGFSQFYDRVSPQNENLDILSGNLFTLTGDRWRNVRQKVSPAFSSAKLKIMFHNLKECAQELDNYLQQLTAKTGYVDVEAKKLISDYTLDVIGACSMGIKCSSIGAGETDLKRISRNVFRINFRRTVHALLEMINPKLPHLLRWKAVEPEVEEFFMTACKEAAALREHESTKRNDFLAILMNIRKSEETLKQGAESHIDDNDLLFSDHIIAGIISSFFGAGFEPAAATMTLCLYELAQHPEVLEKLYAEIQSVKEEFGEEITYESLKKFRYTTQVIEETLRLYPVAAALTRQCTGRFMIPESGVVIDQGVKIFIPVWSLQRDAKYFPDPTAFDPERFSEANKEKILPGTYLPFGDGPRVCVAQRFAMMDMKYMLVTFLSKFTVHTTAETNKKLVFDPSSFTLTPLGDIKLRFQRRI

 

>*CYP6CM4 whitefly Trialeurodes vaporariorum seq1_full_length CYP3 clan

51% to CYP6CM1 Bemisia tabaci GQ214539

84% to seq15

MELLESLQLVSTNSLLIFTSVILYIVYFFKTTFSYWSVRGVPEITVTQSLGSTFRLALRIDSFQKSFSDLYDLLEGHKYGGAYQFTTPTLIIRDANLIQNILVKGFSQFHDRSGPQNENLDILSGNLFSLXGDRWRKVRQKVSPAFSXAKLKIMXHNLKXCAQELDNYLQRLTAETGYVDVEAKKLISDYTLDVIXACSMGIKCSSIGTGETDLKRISRNVFRFGFRRTLHAILEMISXKLPHLLRWKVVEPEXEEFFMTXCREAAALREHESSARKDFLAXLINIRKSEEALKQGAESLDDENDLLFSDHIIAGIIXSFFGAGFEPAAATMTLCXXELAQHPEVLEKLXAEIQSVKEEFGEEITYESLKKFRYTTQVIEETLRLYPVAAVLARQCTEPFVIPESGVVIDKGVKXFLPIYSLQRDAKYFXDPTAFDPERFSEANKEKILPGTYLPFGDGXRVCVAQRFAIMDMKYMXVTLLSKYTVHTTAETNKNIVFDPTSFTLTPVGDLKLRFQRRI

 

>*CYP6DP1 whitefly Trialeurodes vaporariorum seq24_full_length

46% to 6AY1 brown planthopper

45% to CYP6DD1 Acyrthosiphon pisum LOC100162594

MIEVVLLCIGIICWTLFQFGTSTFDYWRRRGVTYTAPTPFLGNIKSVLTFQATSGQCFQRIYNEHLNEPFVGVWLLRKPALLIRSPDVIKDVLLKHFQSFYDRGHAFDETREPITANLVNLTGEKWRILRQRLAPTFSTGKLRGMTPSLQKCALELGKYVSKSKGKGEEDVYEMRELMAKFTTDVIGSVAFGLELGSFEDENSQFREMGRKIFAPSLKIAVSLLFRQFLPSLYSFFDLRSFPKDVNSFFGNVVKDTVSWRKENNVQRNDFMQLLIQMKEEDAQQRKEGKVEDQKFEFTDAVMTAQSFIFFTAGFETSSTTLSYCLYELALNPDIQAKAVSEISRVRDKCETLNYESALELIYLEQILHETLRKYPPVMNLARVCTESLQLPGTKVKIDEGVNIVIPVYAIHHDPKYYPNPEKFDPDRFSAENIRKRPNYTYLPFGDGPRICIGMRFAYLNMKLCLGEFLRRFEVQPCSETVVPMKFRNSSFLLAPLGGIPLKVTKREDLS

 

>*CYP6DP2.a whitefly Trialeurodes vaporariorum seq109_5'3'truncated

44% to CYP6DD1 Acyrthosiphon pisum LOC100162594 (aa 198-279)

70% to seq24 (aa 194-277)

EIMSRNWRGKRDGIYEMRELTAKFTTDVIGAAAFGLEFGPSRMRTHNFVEMGRKIFTPSLKYGIALLFRQFLPSLYSLLDLRSFPKDVNSFFEKGS

 

>*CYP6DP2.b whitefly Trialeurodes vaporariorum seq55_5'3'truncated

83% to CYP6DP1 (aa 317-464)

57% to 6AY1 brown planthopper

FKCKRKMRNNERRKVADQNFEITDSVMTAQSFVFFTAGFETSSTTLSYCLYELALNPDIQAKTVSEIRRVRDKHETINYDSAQELIYVEQVLRETLRKYPPVMNLSRVCTESLQLPETKVEIDKGVSVVIPVYAIHHDPKYYPNPEIFDPDRFTAENMKKR

 

>*CYP6DQ1 whitefly Trialeurodes vaporariorum seq31_full_length

38% to CYP6BC1 Apis mellifera

cyan too long

MISQMAVLQCVSSFLCIAIFLFGYVYVKLVQKYSYWQKRGYPFVQPHIIFGNLKEVILRKVYSGEEYLRLYRIFKQCRVGGFYRFFVPSILIADPEIIKMCLTREFDSFHSRGTEGKVKHEPIRCHLINLERDRWQQLKRCLTPAFSITKIKSMAPIMGECGQKMNQVLEQLMAQNGGEVELQDITSRYSIDVIGTCAFGLKLQSLTEHNSKFRHMGKQIFRLSKLSMLKMITSVVAPNLYNLLRLRLVSAEVTQFFTDIVKETVAYRQKNGITRNDFLDLLIRAKQKSGAGCSDSQEIKADERNTSTPPISEEIKRGVKDTRLDMEINSEVMVAQCFVFFIAGYETSSSVLSFSLYELALNLKMQTKLQGEIDKIIQENYAIISFQAVQQMHYLDKVVLETLRKYPPIGAIMRKCNKRVRIPNSDMTIEPNEKIVISSYALHHDPDIYPNPHIFDPERFNASNKALRHHFSYLPFGEGPRGCIGRNFGLMQVKIGLISLLSRYNFSLSPKTIIPVKLDPKSTIISSKDGITLRVTKRT

 

>*CYP6DR1 whitefly Trialeurodes vaporariorum seq19_full_length CYP3 clan

38% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

MMEVVKNLLPNVSANSVLILTILVLIIVYYLRDRGSYWNKKGVSTFDAQKMLKSSLKLLIGRMHVTELYHEMYRELGDHSFGGSFQGIHPMIYIKDPKVAKAILVKGFTNFHDHGPPPVDNEEPLAQNLFFMTGARWRQRRQKLSPGFSSVKLKIMHQTLENCVEELNTYLEKHVSRIGGAEIELKELVSNYTLDVIGALVLGIKCNATHDPDCEFKKLMVELVQGGFKTYLFYFLEVFHPKLPRWLGLSLLKRESLEYLQQIIRETMQLKENERAVERKDFLQMVMNHRDNESEERTKEDHLLQENGWAEKEEIFPDEENQGPIFSESFILGTVITFLTAGFEPITVTLSFCLHELAFHPEIQEKIFDEIRAVKAESRNGTISYEDLRKLKYTDQVINETLRKHPPAGIIIRVCTEPFLIPDTSVVVDKGTRIYVDMASIQNDQKYFPEPEKFNPDRFSEKNTDKIISGTFQPFGDGPRFCIGMRLALLNVKTMLIGLISNYHLRLCERTPEIGLDKKQLLLTPAGDIWVRMERRK

 

>*CYP6DS1v1 whitefly Trialeurodes vaporariorum seq11_full_length CYP3 clan

46% to CYP6CM1 Bemisia tabaci GQ214539

cyan seq is long

MASLINFFPTVSTGAVLFVTSVILLVVFYVREKASYWDKKGVPSLSAWRFFRRLFGKGHGHMTEFYIQLYRDLEGEKFGGSYQMLDPIILLRDPQLAKHFCIKAFSSFHDRMPMTPGDDNPFSVNLFSLTGEKWRKVRHKLSPGFSTSKLKIMFQTLKEYSSELNSYLENKASQTGDVEVDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKQIMLGMLRISWRTFAVFFLKLIHPKLPLLLGLSPVSPELSQFFKKVVKETMEMKDSKHEVSRKDFLQLVMNHRDSEEQMKDDNDLDPLLSQDNRLPIDALDSEEEGPLFSESLIMGTMVSFLSAGFEPVSSTLTFCLYELAHHPDVQEKLFNEIQAVKASEPGN

EINYESMKKFKYVDQVMNETLRKYPVAGVLARVCTEPFLIPDTSVILEKGTKVYISLHAMQQDPKYFPDPKKFDPDRFSEENVDKIIPGTYSPFGDGPRFCIGMRLATLDVKTLLITVISNFRVRTCEKTVAEIEYDNSLFILSPDRPIWLRLEKRK

 

>*CYP6DS1v2 whitefly Trialeurodes vaporariorum seq50_3'truncated

44% to CYP6CM1   Bemisia tabaci GQ214539

100% identical to seq11

cyan too long

MASLINFFPTVSTGAVLFVTSVILLVVFYVREKASYWDKKGVPSLSAWRFFRRLFGKGHGHMTEFYIQLYRDLEGEKFGGSYQMLDPIILLRDPQLAKHFCIKAFSSFHDRMPMTPGDDNPFSVNLFSLTGEKWRKVRHKLSPGFSTSKLKIMFQTLKEYSSELNSYLENKASQTGDVEVDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKQIMLGMLRISWRTFAVFFLKLIHPKLPLLLGLSPVSPELSQFFKKVVKETMEMKDSKHEVSRKDFLQLVMNHRDSEEQMKDDNDLDPLLSQDNRLPIDALDSEEEGPLFSESLIMGTMVSFLSAGFEPVSSTLTFCLYELAHHPDVQEKLFNEIQAVKASEPGN

 

>*CYP6DS2v1 whitefly Trialeurodes vaporariorum seq13_full_length CYP3 clan

45% to CYP6CM1   Bemisia tabaci GQ214539

cyan region is long

MASLINFLPTVSTGAVLFVTSIILWVVFYVREKTSYWDKKGVPSLSAWRFFSSLFGKDTGHVTEFYIQLYRDLEGEKFGGSYQMLDPIILLRDPQLAKHFCIKAFSSFHDRMPPTTEGDDNPFTVNLFSLTGEKWRQVRNKLSPGFSTGKLKIMFQTLKEYSSELNSYLEKKVSKTGDIEIDIKELMSNYXLEVIGAVAMGIKCNAIQDPNCEFKRMMLVMLRISWRTYATFFLKLIHPKLPLLLGLSPVSPELSEFFRKVVKETMEMKDSKHEVTRKDFLQLVMNHRDSEEQMKDENDLDPLLSQDNRLPKDALESDEEGPLFSESLIMGTMVSFLSAGFEPVSSTLTCCLYELAHHPDVQEKLFNEIQTVKASEPGNEINYESMKKFKYVDQVMNETLRKH

PVAGVLARVCTEPFLIPDTSVILEKGTKVYVSLHAMQQDPKYFPDPKKFDPDRFSEENVDKIIPGTYSPFGDGPRFCIGMRLATLDIKTLLITVISNFRVRTCEKTVAEIKYDKSVITLLPDRPIWLRLEKRK

 

>*CYP6DS2v2 whitefly Trialeurodes vaporariorum seq36_full_length

45% to CYP6CM1 Bemisia tabaci GQ214539

97% to seq13 (1 X and 10 aa diffs, 7 in the C-term after heme region, all 10 in last 166 aa)

cyan too long

MASLINFLPTVSTGAVLFVTSIILWVVFYVREKTSYWDKKGVPSLSAWRFFSSLFGKDTGHVTEFYIQLYRDLEGEKFGGSYQMLDPIILLRDPQLAKHFCIKAFSSFHDRMPPTTEGDDNPFTVNLFSLTGEKWRQVRNKLSPGFSTGKLKIMFQTLKEYSSELNSYLEKKVSKTGDIEIDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKRMMLVMLRISWRTYATFFLKLIHPKLPLLLGLSPVSPELSEFFRKVVKETMEMKDSKHEVTRKDFLQLVMNHRDSEEQMKDENDLDPLLSQDNRLPKDALESDEEGPLFSESLIMGTMVSFLSAGFEPVSSTLTCCLYELAHHPDVQEKLFNEIQAVKASEPGNEINYESMKKFKYVDQVMNETLRK

YPVAGVLARVCTEPFLIPDTSVILEKGTKVYISLHAMQQDPKYFPDPKKFDPDRFSEENVDKIIPGTYSPFGDGPRFCIGMRLATLDVKTLLITVISNFRVRTCEKTVAEIEYDNSLFILSPDRPIWLRLEKRK

 

>*CYP6DS2v3 whitefly Trialeurodes vaporariorum seq30_3'truncated

42% to CYP6CM1   Bemisia tabaci GQ214539

nearly identical to seq13 and seq36

3 Xs and 3 other aa diffs to seq 13

cyan too long

MASLINFLPTVSTSXXLFVTSIILWVVFYVREKTSYWDKKGVPSLSAWRFFSSLFGKDQGHVTEFYIQLYRDLEGEKFGGSYQMLDPIILLRDPQLAKHFCVKAFSSFHDRMPPTTEGDDNPFTVNLFSLTGEKWRQVRNKLSPGFSTGKLKIMFQTLKEYSSELNSYLEKKVSKTGDIEIDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKRMMLVMLRISWRTYATFFLKLIHPKLPLLLGLSPVSPELSEFFRKVVKETMEMKDSKHEVTRKDFLQLVMNHRDSEEQMKDENDLDPLLSQDNRLPKDALESDEEGPLFSESLIMGTMVSFLSAGFEPVSSTLTCCLYELAHHPDVQEKLFNEIQAVKASEPGNEINYESMKKFKYVDQVMNETLRKH

TQLQAFLREFAPSPF

 

>*CYP6DS3v1 whitefly Trialeurodes vaporariorum seq8_full_length

45% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

MASFIHFFPTISTGAILVVTSIILLVVFYMREKTSYWNKRGVPSLSAWRFIGECIGLTLGRAHMADFYIKLYRDFEGQKFGGSFQGLQPLILLRDPELIKHFCIKVFSCFHDRTPPVTQGDDNPFMVNLFSLTGEKWRQVRHKLSPGFSCAKLKIMFQILKDYSSELNSYLEKKVSKTGDVEIDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKQIMLAMFRVNWRSYVFFFLDLIHHKLPALIRFEPVSPKISDFFKKVVKETMEMKDSKHEVSRKDFLQLVMNHRDCEEQMRDENDLDPLLSQENRLPKAALDSEEEGPLFCESLIMGTMVSFLSAGFEPVSSTLTFCLYELAHHPDVQEKIFNEIQTVKASEP

GNEINYESMKKFKYVDQVMNETLRKHPVAGILMRTCTEPVLIPDTSVIVEKGXQXFISLYGLQSDPKYFPDPTKFDPDRFSDENVDKIIPGTYLPFGDGPRFCIAMRLATLDIKTLLITVISNFRVQTCERTVAEMKYDKKLFLLSPDGPIWLRFEKRI

 

>*CYP6DS3v2 whitefly Trialeurodes vaporariorum seq71_3'truncated

42% to CYP6CM1 Bemisia tabaci GQ214539

identical to seq 8 except the end (primer seq?)

cyan too long

MASFIHFFPTISTGAILVVTSIILLVVFYMREKTSYWNKRGVPSLSAWRFIGECIGLTLGRAHMADFYIKLYRDFEGQKFGGSFQGLQPLILLRDPELIKHFCIKVFSCFHDRTPPVTQGDDNPFMVNLFSLTGEKWRQVRHKLSPGFSCAKLKIMFQILKDYSSELNSYLEKKVSKTGDVEIDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKQIMLAMFRVNWRSYVFFFLDLIHHKLPALIRFEPVSPKISDFFKKVVKETMEMKDSKHEVSRKDFLQLVMNHRDCEEQMRDENDLDPLLSQENRLPKAALDSEEEGPLFCESLIMGTMVSFLSAGFEPVSSTLTFCLYELAHHPDVQEKIFNEIQTVKASEP

RTMRSTMK

 

>*CYP6DS3v3 whitefly Trialeurodes vaporariorum seq79_3'truncated

41% to CYP6CM1 Bemisia tabaci GQ214539 N-term

Identical to CYP6DS3v1 and v2 except 3 Xs

MASFIHFFPTISTGAILVVTSIILLVVFYMREKTSYWNKRGVPSLSAWRFIGECIGLTLGRAHMADFYIKLYRDFEGQKFGGSFQGLQPLILLRDPELIKHFCIKVFSCFHDRTPPVTQGDDNPFMVNLFSLTGEKWRQVRHKLSPGFSCAKLKIMFQILKDYSSELNSYLEKKVSKTGDVEIDIKELMSNYTLEVIGAVAMGIKCNAIQDPNCEFKQIMLAMXRVXWXSYVFFFLVFNSSQAACTDTIRTS

 

>*CYP6DT1 whitefly Trialeurodes vaporariorum seq7_full_length

46% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

MVPNFSSNAVFILTSVVLLVIYLLKERFRYWTKRGVPSVSPLECLKGFGFIFRXSHGMDWXMKMHDGLAGEKFGGAWMXLQPILVIRDPELIRMCMIKEFSSFHDRNPPTGTENDVLAENLFQLTGDRWRQVRYKLSAAFSSAKLKIMFQTLKDCSNNLNAYIENLASKTGSAEIDVKKLMSNYTLDVIGACAMGIKCNAIQDPNCEFGRITKQIFKFSWRRSLTLILELAHPKLPNLVGLKVLDPEISDYLQRIVKDTMALKDADQSSSRKDFLQIMMNLRDVEPEEPEDEENVGALPQENGGTRMEKKEAGHGGSKGPLISESIILGVISVFTSAGYEPVSATLTFALYELAQNPDVQERMFEEIRSVKAKLGDDLTYESLKKFKYTEQVIHETQRKRTVAGALLRMCTEPFMMPDSSVLVEKGTRVLIVTDAIHKDPKYFPEPEKFNPDRFSEENIDKIVPGTYLPFGDGPRFCIGMRLAIMDVKTALITVVSNYKVLPCAKTPKEIKYDKAGFMLSADGPVYLRLEKRK

 

>*CYP6DT2 whitefly Trialeurodes vaporariorum seq5__full_length

48% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

MELLNSMVPKLSSNSVLIFTSVVLLAIYWLRNRFQYWDKKGAPSVSPLECLKAFGFLFRMSHVMDLFLKMHYSLDGKKFGGGWMLLQPTLVIRDPELIRMCTIKGFSSFHDRNPPVSTENDVLAGNLFQLTGDKWRQVRHKISPAFSSMKLKIMFQNLKGCANELNAYIENLASKTGSAEIDVKTLMSNYTLDVIGACAMGIKCNAIADPNCEFARITKLMFRFNWRRILALLLELAHPKLPGWVGLKVVDPELVYYLTSIVKDAMEMKDGDRSSSRRDFLQIMMNLRDVEPEEGGKDEDEENVGALPKENGGGWTEKKETVNGESKGPLFTENIILGVIGSFMSAGYEPVSATLTFALFELAKNPDVQKKMFEEIQSVKAELGDELTYESLKKFKYSEQIIHETLRLRPVAGALGRVCTEPFVMPGSSVVVDKGTRTIIVTYAIHRDPKYHPEPEKFNPDRFSEENIDKIVPGTYLPFGDGPRFCIAMRLAIMDVKTALITVVSNYKVLPCARTPKDIEYDKAVFPLSADGPVYLRLEKRK

 

>*CYP6DT3 whitefly Trialeurodes vaporariorum seq10_full_length CYP3 clan

46% to CYP6CM1 Bemisia tabaci GQ214539

cyan is extra sequence not in CYP6CM1

MDLLNSLVPNFSSNSVLILTAVVLLAIYWLREKFQYWSKRGAPSVSPVECLKGLGFLIRTSHVMDLFLKMHYSLDGKKFGGAWMFFHPILIIRDPELIRLCIIKGFSSFHDRNPPINTDSDVLGENLFQLTGVKWRQVRYKLSAAFSGVKLKIMFQILKGCAKDLNAYIENLASKTGSAEIDVKTLMSNYTLDVIAACALGIKCNAIADPNCEFARMTKLMFRFNWRRSLALVLELAHPKLPGLVGLKVVDPEIADYLTNIVKNTMAMKDSDQSSSRKDFLQIMMNLRDFEPEEKDEGEGKVSALPQENGGGWAEQKEAVHNESKGPLFSESIILGVIGVFLSAGYEPVSSTLTFALYELAKNPDVQKKMFEEIQSVKAELGNELTYESLKKFKYTEQIIHETLRKRPVSGALFRMCTKPFQMPDSSLIVEKGMRVFIANYALHRDPKYFPDPERFDPDRFSEENIDKIVPGSYLPFGDGPRFCIAMRLAIMDVKTALIAVVSNYNILPCAKTPKSIEYYDKSTFTLCADGPVYLRLEKRK

 

>*CYP6DT4v1 whitefly Trialeurodes vaporariorum seq3__full_length

47% to CYP6CM1 Bemisia tabaci GQ214539

MALLNWLTPNISTNSVLILTSIILFAVYWLRERFSYWSRNGVPSVSPLECFKSTMAFSLGWKHMLDHFLKMHHALPSEAKFGGAWQLLQPTLIVRDPEMVRLFLIKGFTNFHDRGPPPDEKNDALGGNLFQLAGDRWRQVRHKLSPAFSAAKLKIMFQSLKGCANELNAYLMNLASETGSAEIDVKQLMSNYTLDVIGACAMGIKCNAIQDPNCEFKRIMALIFRFDWRRSLFFFLELVHPKVPKLLGLKPANPEVVDFLTRIVRETMEMKEGDLSVVRKDFLQIMMNLRDFPEENVKEDDEENGSALPKENGWMEKKEIVNSESKVPLFSEGMITGVISSFLSAGFEPVSAGLTFALFELAQNPEVQKKMFDEIRSVKAELGDEITFESLKKF

KYTDQVINETLRKRPVAAALVRICTEPFLIPDTSFIVQKGTRVIIVAYALQRNPKYFPEPEKFDPDRFSEENVDKIVPGSYLPFGDGPRFCIAMRLALMDIKTALIMIVSNYKILPCARTPKDIEYDPHSFILNVNGPLWLRLEKGSDDISCKLHFLVHPKTVTIGDMYSVANSNFCIASSAQNFIKRME

 

>*CYP6DT4v2 whitefly Trialeurodes vaporariorum seq42_5'truncated

58% to CYP6CX1v1 Bemisia tabaci C-term

identical to C-term of seq3

HFTSWQKTLNVQ

KYTDQVINETLRKRPVAAALVRICTEPFLIPDTSFIVQKGTRVIIVAYALQRNPKYFPEPEKFDPDRFSEENVDKIVPGSYLPFGDGPRFCIAMRLALMDIKTALIMIVSNYKILPCARTPKDIEYDPHSFILNVNGPLWLRLEKGSDDISCKLHFLVHPKTVTIGDMYSVANSNFCIASSAQNFIKRME

 

>*CYP6DT5v1 whitefly Trialeurodes vaporariorum seq4__full_length

47% to CYP6CM1 Bemisia tabaci GQ214539

96% to seq3

cyan too long

MELLNWLTPNISTNSVLILTSIILFAVYWLRERFSYWSRNGVPSVSPLGCFKSTMAFSLGWKHMLDLFLKMHIDLPSEAKFGGAWQLLQPTLIVRDPEMVRLFLIKGFTNFHDRGPPPDEKNDALGGNLFQLAGDRWRQVRHKLSPAFSAAKLKIMFQSLKGCANELNAYLMNLASETGSAEIDVKQLMSNYTLDVIGACAMGIKCNAIQDPNCEFKRIMALIFRFDWRRSLFFFLELVHPKVPKLLGLKPANPEVVDFLTRIVRETMEMKEGDLSVVRKDFLQIMMNLRDFPEENVKEDDEENGSALPKENGWMEKKEIVNSESKVPLFSEGMITGVISSFLSAGFEPVSAGLTFALFELAQNPEVQKKMFDEIRSVKAELGDEITFESLKKFKYTDQVINETLRKRPVAAALVRICTEPFLIPDTSFIVQKGTRVIIVAYALQRNPKYFPEPEKFDPDRFSEEN

VDKIVPGSYLPFGDGPRFCIAMRLALMDIKTALIMIVSNYKILPCARTPKDIEYDPHSFTLNSNGPLWLRLEK

GSDDISCKLHFLVHPKTVTIEDICSVVNSNFCIKLDSKFHKTYEIIYSGNCENRV

 

>*CYP6DT5v2 whitefly Trialeurodes vaporariorum seq65_5'truncated

57% to CYP6CX1v1 Bemisia tabaci (whitefly) heme region

same as CYP6DT5 except ends

LNFDNRRTMNERD

VDKIVPGSYLPFGDGPRFCIAMRLALMDIKTALIMIVSNYKILPCARTPKDIEYDPHSFTLNSNGPLWLRLEK

RK

 

>*CYP6DT6v1 whitefly Trialeurodes vaporariorum seq6_full_length

47% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

identical to seq 49 except yellow

MELLKSMLPNF STNSVLILTSIILFAVYWLRERFSYWSRLGVPSVSPLECFKNTLRFMLGRVSMLGLFLNMHVGLPGAKFGGVWQLLQPTLIVRDPEMVRLFLIKGFSNFHDRNPPPDEKENTLSGNLFQLAGDRWRQVRYKLSPAFSAAKLRIMFQSLKGCANELNMYLETLASKTGSVEIDVKELMSNFTLDVIGACAMGIKCNAIRDPKNCELKRIMTLIFKFDWRQSLFFLADLVHPKLPPLLGLKAVNSEVADYLTNIVRETMEMKESDLSVIRKDFLQIMMTLRDSEPAEHGKDDDGDNGQALPKEGGWTEKKDIVNGDSKGPLFSEGIITGVISTFLSAGYEPVSSALTFALYELALNPEVQEKMFDEIRSIESRLGDDIRFESLKFESLKKFKYADQVINEALRKRPVAVVLARICTEQFLIPDTSVVVEKGTRVIIVPYALQRDPNYFPEPEKFDPDRFSEENVGKIVPGSYLPFGDGPRFCIAMRLALMEIKTMLIM AVSNYKILPCARTTMNLEFDPKAATISANGPVWLRLEKRK

 

>*CYP6DT6v2 whitefly Trialeurodes vaporariorum seq49_5'_3'truncated

49% to CYP6CM1   Bemisia tabaci GQ214539

cyan too long

NLKYIYTRLRHGATKXYAAKL

STNSVLILTSIILFAVYWLRERFSYWSRLGVPSVSPLECFKNTLRFMLGRVSMLGLFLNMHVGLPGAKFGGVWQLLQPTLIVRDPEMVRLFLIKGFSNFHDRNPPPDEKENTLSGNLFQLAGDRWRQVRYKLSPAFSAAKLRIMFQSLKGCANELNMYLETLASKTGSVEIDVKELMSNFTLDVIGACAMGIKCNAIRDPKNCELKRIMTLIFKFDWRQSLFFLADLVHPKLPPLLGLKAVNSEVADYLTNIVRETMEMKESDLSVIRKDFLQIMMTLRDSEPAEHGKDDDGDNGQALPKEGGWTEKKDIVNGDSKGPLFSEGIITGVISTFLSAGYEPVSSALTFALYELALNPEVQEKMFDEIRSIESRLGDDIRFESLKFESLKKFKYADQVINEALRKRPVAVVLARICTEQFLIPDTSVVVEKGTRVIIVPYALQRDPNYFPEPEKFDPDRFSEENVGKIVPGSYLPFGDGPRFCIAMRLALMEIKTMLIM

LCRIINTS

 

>*CYP6DT7v1 whitefly Trialeurodes vaporariorum seq16_5'truncated CYP3 clan

40% to CYP6CM1 Bemisia tabaci GQ214539

cyan too long

HCQLRLLLAKGRFSYWKRIGVPSTTPLQCFSPIRFFLGRVHMLDILMKMHFTLPEAKFSGAWVFHQPFLIIRDPEIARLFLIKGFPNFHDRHPPDNEVNDETIGNLFLLTGK

KWRPLRYKLLPAFSETKLKIMFESLRACAIKLNTYLDNLTSNMGVVEIDVNKLMSNYTSEVTGSCVMGIKCNALNDPNCEVKKNMXLMFRFHWRXLLFXLXEILHQRLPKLFGLRLVHPELVDFLTRVVRGKVERETDQSVIRKDFLHIMSSLRHSDLEARAKEETEEQGRALPQETGRFGKEEDMDGEGEGPLFSESVTTGVMSSFLSEGFELVSSALTFALHELAHNPEAQEKMFDEIQSLKFGLDNDIQYESLKKFKYTDQIINETLRRRPVVPGLGRICTEPFLIPGTSAVVERGTRVLIVTYAMHRDPTYFPEPERFDPDRFSDKNIDKIVPGSYLPFGDGPRFCIAMRLARMDIKLALITIVSKFKILPSTKTPKDLKYDKKMFTLSADGPVWLRLEKRE

 

>*CYP6DT7v2 whitefly Trialeurodes vaporariorum seq89_5'3'truncated

38% to CYP6CK12   Nasonia vitripennis (jewel wasp)

identical to CYP6DT7v1 except end

HCQLRLLLAKGRFSYWKRIGVPSTTPLQCFSPIRFFLGRVHMLDILMKMHFTLPEAKFSGAWVFHQPFLIIRDPEIARLFLIKGFPNFHDRHPPDNEVNDETIGNLFLLTGK

NGAR

 

>*CYP6DU1v1 whitefly Trialeurodes vaporariorum seq9_full_length

43% to CYP6CM1 Bemisia tabaci GQ214539

same as seq34 except N-term and 2 X (polymorphisms)

MMDFLKGYQLVSVSTLLYTSALLCIFQFL

RTKFTYWSSRGIPSISLLESFIRAMRFYLGLDSFSSSYLGLYQTFEGHKYGGTYELLTPVLILRDPKLVRNFLIEGFSQIHDRMPALDEDLNRLSTHLFRLTGDKWRQVRHKLSPAFSPARLKNIFFSLKECADXYDAHLRKLMEKTGSVEVNGYEFLSNYTLDAIWASVMGVKTNSAAGGDKTIKKYTHDFITFDFRRLVYRVLELINPKLPSLLKWKLVPSDLEQFFLKTCKDTATFREHKSASEKDFIQFFMNIRNSEDNLSDPLFSDELIASNIAFFLNAGLEPIGVLLTYCLHEIASNSEIQEKIYNEIQTVRSENNNEITFESLKSLQYTTQVINETLRLHPVAPVVFREITEPFKLPDSDAVIDKNTKLYISLHGLHHDPKYFPDPFKFDPDRFSEENKQYIVPGTYMPFGDGPRFCIANRFVLLNAKTLVVTLLSNYTVHTRPKVQKKLEYDPSTFSSSPVGGLYLSFKRRENS

 

>*CYP6DU1v2 whitefly Trialeurodes vaporariorum seq34_5'3'truncated

45% to CYP6CM1 Bemisia tabaci GQ214539

short at C-term, same as seq9 except N-term and 2 X (polymorphisms)

EAVVSRRVRG

RTKFTYWSSRGIPSISLLESFIRAMRFYLGLDSFSSSYLGLYQTFEGHKYGGTYELXTPVLILRDPKLVRNFLIEGFSQIHDRMPALDEDLNRLSTHLFRLTGDKWRQVRHKLSPAFSPARLKNIFFSLKECADDYDAHLRKLMEKTGSVEVNGYEFLSNYTLDAIWASVMGVKTNSAAGGDKTIKKYTHDFITFDFRRLVYRVLELINPKLPSLLKWKLVPSDLEQFFLKTCKDTATFREHKSASEKDFIQFFMNIRNSEDNLSDPLFSDELIASNIAFFLNAGLEPIGVLLTYCLHEIASNSEIQEKIYNEIQTVRSENNNEITFESLKSLQYTTQVINETLRLHPVAPVVFREITEPFKLPDSDAVIDKNTKLYISLHGLHHDPKYFPDPFKFDPDRFSEENKQYIVPGTYMPFGDGPRFCIANRFVLLNAKTLVVTLLSNYTVH

 

>*CYP6DV1 whitefly Trialeurodes vaporariorum seq20_full_length CYP3 clan

39% to 6AX1 brown planthopper

MILQYLFLSVIYASSALLFYLVYNYWKNYTHWTNSGLPYIPFPRGESVFYPRHKAQQLMRFYDELAPHPVGGIFKMSRPNLLFRDPALIQKILIKDFSHFVDHGIDFDETLDPLNLHLFNIEGTRWKNVRNKITPAFSSGKMRGMWPYMEECKRVFEDYLDRQIEADGNIEVSDALSKFGIDVIGTCALGLECNAIQDKDSEFRKMARLVWSGHSLFFLRSLLRSTGLKITSWMRWKRLDKAIDDFFFSILRESVKHRAENVNKRQDFLQHLINIQQEELEMIKREGSKQEPLLTDAMVAAQVYLFFVAGHETTSGTLSYCLYQLAQHPEIIGKCRAEVKKVLQDNKGIMNYECLKDLTYIQSVIDETLRMYPVLGWLDRICNKPYELPGSNYIVRKGQRCLIPVLGLHHDPKYFPDPEKFDPDRFSEKNKSSIINGTYLPFGDGPRICAGMRFAFMEMKATLASLLMRYDIEPSEKTDFPLKIARTMFLYTPTNGIWLRFKKRADVSS

 

>*CYP6DV2 whitefly Trialeurodes vaporariorum seq22_full_length

39% to CYP6BC1 Apis mellifera

MILQFLSLSVIYVLLVLLFYLVYNYRKNYTHWTESGLPYIPFPRGDSVFYLRHKADQLKRFYDELAPHPVAGIFKMSRPHLLLRDPALIQRILIKDFAHFENHGIQIDEKLDPLNLHIFNIEGTRWKNVRNKISPALSSGKMRGMWPYLEECKHVFEEYLDRRIETDGQIEVLEVVQKYAIDVIGTCAFGLKCNAIQDEDSEYRRIAALILRPGGLYFFRSLLRSTGLNIISWIKWKRIDAAVDDFIFTILRESIKHRAENENKRQDFVQHLINIQQEELETLKKEGSGQEPLLTEPMVAAQVFVFFVAGYETTSGTLAYCLHELAQRPEIVEKCRAEVKKVVKENGGTLNYECLKDLTYIESVIDETLRLYPIAGVLDRICNTPYEIPGSNYIVRKGQRILIPVLGLHHDPKYFPDPEKFDPDRFSEKNKSNIVRGTYLPFGDGPRMCIGMRFAFMEMKATLASLVMRYDLEPSEKTEIPLKIERTMLLYAPKNGVWLRLKKRAVVDV

 

>*CYP6DV3 whitefly Trialeurodes vaporariorum seq25_5'truncated

40% to CYP6DD1 Acyrthosiphon pisum LOC100162594

HLQTFYNELAPHPLGGFYKMSRPFLMIRDPKLIRLMTIKDFAHFTDRGLDVHEELDPLNLHIFRLEGSRWKTVRGKITPAFSSARVKAMWPYLEQCERMFEKYLDHHNETNGQIDVMEAFEKFTVDVIGTCVLGLECSAIQSEDSALRKTAHLILRPSNLHFLRSFLRSTGLKFISWLKWKKVFPAVDDFFFSIVRETIKHRAENEARRQDFMQHLINIQQEELETLRKQENGQEPVLTEAMIAAQAFLFFVAGYESTAGTLAYCLHLLAQYPEMVEKCRLEVEEVVKQNGGTLTYECLNDLTYLQSVIDETLRLYPPLGWLERICVIPYVVPDSSYIIKKGQRIIIPIHAIHHNPQYFPEPEKFDPDRFSKTNKSNIISGTYFPFGDGPRICAGMRFAFMVMKATLASLLMSYDIEPSSKTKFSVEFERTMFLLVPKNGLWLKIKKRAVEEKSEDFKQKAL

 

>*CYP6DW1 whitefly Trialeurodes vaporariorum seq18_full_length CYP3 clan

40% to CYP6CM1 Bemisia tabaci GQ214539

42% to 6AX1 brown planthopper

MTAAPLVTFNLILVAVFTFLAYLVYHFKKRYDHWRKLDVPFLGIKEDIVFDWDKNRTYAVQDRYNKLDPLPYGGIFQATKPILLLRDPELIKAVMIKDFSHFTDRGIAFNEKLDPLMPHVFNLGGQRWKSVRAKLTPTFSSGKLKSMFILMEGCIQVLDKYLTESLDGKGQSKEIDVKSLMSELTTDVIGTCAFGWDCGAIGNEGSEFRRISNKTSFNPLKFFLRITLRSINPNIFTWLHWKGFDPEVEAFYLNITKEAIEKREENKEKRKDFLQLLINVQHEEQKMLQSLNDGSEPLFKDHVVAAQVFVFFIAGFETTANTLTFCLYELAQHPDIMEKLHAEITRVLKAYDGKVTYESIKEMHYMDTIVSETLRKYPPLGFLDRVCTKAYELPNSSLLIKPDTSVMIPVYALHYDPKYYPDPEKFDPDRFSEENKGNLVPGTYFPFGDGPRICIGMRFAQMEIKSALSLIVGKYTVHTTDKTPIPATFKTNSFINTSAKPITLKFKRRDS

 

>*CYP6DX1 whitefly Trialeurodes vaporariorum seq21_full_length

67% to CYP6DX2

42% to CYP6DA2 Acyrthosiphon pisum LOC100168454

38% to CYP6DA1 Acyrthosiphon pisum LOC100159636

MLPLTELKLSTVFVILTVITYIFYLIKRKYDYWSKRSVTHVGFSGDVMFNLSKHRSYFFKDLYRNFQNKPFVGFYQFGQPHILVRDLELIKLVLIKQFSHFTDHHLGPFGNDPLLVNSLFHLKGQRWKVIRAKLSPIFTSGKLRHMTGLLNVCVTMLDKHLERTLAESGGEIEMRDVTLKFAMDVIGVCAFGLNCNAIESEDSEFRQIMRKVGSAPTLKLYLILFLDIIHPKITEVLKIRFSNPEFDEFFYSLADQALKHRSDTETRRDDFVQLLMEVREEERKLIKSQNQNEIEPLFTDDVIAANIWVIFTAGWDTVGTTTSYCMYELALHPDLQEKLFEEIKEVQDKNGGQCTYDVLKQMHYLDCVVNETLRLHPNLPSLDRVCTKPCNIPESSLIIEENMNIIVPIQELHLDPEYWPDPERFDPERFNEQNKSNIVPGSYIPFGDGPRMCIGNRFALMVMKAFLAFIVRKYSVHPTAKTDIPITLDPKFMTNTPKHGIHLRFQKRDDLCARKL

 

>*CYP6DX2 whitefly Trialeurodes vaporariorum seq104_full_length CYP3 clan

38% to CYP6DD1 Acyrthosiphon pisum LOC100162594

36% to CYP6CM1 Bemisia tabaci GQ214539

MFFWMELKLQAIIVILTIVAFILYRIKRKYDYWNERNVPHVGISKDSLFNMKQHRDEIFKDLYQNSLKQGYIGFYQSGIPSILVRDLDLIKCILIKEFSHFTDHSQLELLNREPLLVHNLFFLKGQRWKGIRNKLSPIFTSGKLRHMTGLLSACVRIMDSYLERTLEEKGGQVEMRDVTLKFSMDVMGVCAFGLDCKAVEDEDSEFKRVMNKLMPARLKIILMVMLDIIHPRINALLNLKFVKPEINEFFYSLAKQTTKHRAETATKRDDFVQLLTEVREEEQKLIKSQNQNDESSDTELLFTDEVIAANIWVFFQGGYDTLGTTMSYCLYELALHPDLQERLHEEIKQVQDKNGGPLTYDVLKQMHYLDCVVNETLRLHPALGHLERLCTKPCKVSNNSLLIEKGVSIIIPVQSLHLDPDYWTEPEKFDPDRFNEENKSKIVPGTYLPFGDGPRICIGYRFARMEMKAFLAFFVRKYSVHPTXENRDTDYCGPKVSLQHSKKWNLFKIQETRLMTPQK

 

>*CYP6DY1 whitefly Trialeurodes vaporariorum seq26_full_length

37% to CYP6CY6 Acyrthosiphon pisum LOC100165240

MFTFKTLEALLIVCTVLGYIAYYIKRKYEYWKDRNVPHLGASKDFVFLHHSQMHRTQIYDDLYRNYSSDQYVGFYLAGKPILMIRDLKLIRAILIKDFSHFTDHGLTIIDGEPLFAKSLFNIGGHQWRRFRSKITPIFTSGRLKRMSGPVSECTEKLEKYLETVLEKSGDVQIEVREIILRFAMDTVGACTLGLNCEAIEDENSTFTRMARQLFQVSSNLKSLFCLILDTIHPKLNSWLRIKFTTSEVRDFFFSLTRDTIKYREGNATKREDLIQHLLNLRNEEQQMRLQGQKEHSDPLFDETGLVANATLFFIAGFEPIASTVSYALYELAKHPDIMATVYEEIMIVKQFYEGNLTYEAYKHMVYMDCVLFETLRMHSHNGWLDRVCTQTYQVPGTNLIIEKNTNVIIPVASVHHDPTFYPEPEKFDPERFNEENRFKIPSCAFLPFGEGPRICIGMRFAWMEMKAALSVIIGKYIVEPTNIPIHLNPLGHNNAPRAVYLRLKRREKWS

 

>*CYP6DZ1 whitefly Trialeurodes vaporariorum seq14_full_length

44% to 6AX1 brown planthopper, 39% to CYP6CM1 Bemisia tabaci

cyan is long

MSVFSIVNILPSVSSLLLIVTSIALWLAYYLKKKYSYWAKRGVPYLEPVPFFGNTKDQILQRVPPAFDFQKIYNELDGNKFAGIFVMTRPTLFLRDPETIKNFLVKSFSHFHDRSSYLNEKLDPLSASILNLTGQRWKNIRYKLVPTFSSGKLKLMHDLMNECIDELDGYLEKATSENATGSEQNLKELMSKLTTDVIGSCAFGLRCNSIRDENSEFRRIGRKIFKFNYRIFFRNMLRTVNSKLVEVFRVKAIAQDVEDFFLSVLHDAVKEREANSQKRNDFLQLLINIQAEEQEQLRSIGHSQQNGNSTNGISKDDASEETDRKNQEPLFTDNVVASNAFIFFIAGFETTASTLTFILYELALNPDIFGKLRAEVDSVKEAHGGHLDYNALKELVYMDMVISESMRKHPAAPVLARLCTETFKIPETSVIVEKGMTVLVPTYALHHDPKFFPEPDKFIPERFSEENKDSIVPGSYLPFGDGPRICIGIRFALFEIKATLSRIVSNYTVHLCDKTQVPLKFNPKSMLLSPDDGIWIKFRKREAAS

 

>*CYP6DZ2 whitefly Trialeurodes vaporariorum seq88_5'3'truncated

45% to CYP6CW1 Nilaparvata lugens FN421126

78% to seq14 N-term, yellow is probably 5ŇUTR

CDWIYLFLLPCRAKYLCCQFNRIKGI

MSVFSIANILPVSSLLLIVTSITLWLTNFYKRKYSYWAKRGVPYLKPVLFFGNTKNQLLQRVPMAIDFQRFYNESDGNKFGGIFVMTTPNLFLRDPEIIRTFLIKSFSNFHDRPR

 

>*CYP6EA1.a whitefly Trialeurodes vaporariorum seq64_full_length (may be part of seq61 gene)

42% to CYP6CW1   Nilaparvata lugens FN421126 N-term

48% to seq14 N-term

MYNFSIANYTPTVISFSLLIAGLILYLVYYFERKFSYWDKYGVPQVRPVWFFGNIMDQVLLRSPAVFVEQDIYNKLSGHKLGGFYSMSKPILMLRDPELIRICLIKSFGHFHDRDIPFDPKDDPLSESLFVQRGQRWRAVRHKKAPAFSTSKLRTTVDALLSLRTRAGRFS

 

>*CYP6EA1.b whitefly Trialeurodes vaporariorum seq61_5'truncated (may be part of seq64 gene)

41% to CYP6CX1v2 Bemisia tabaci (whitefly)

47% to seq14 no heme signature,

cyan region is 1 aa too long and frameshifted

AKKMQSSSHREESGDSDDSPVLTDIAVAASMYSQITLAPTPIAHFFTHCLYELALNPAVFQKMRDEVDSVKKEYDDILNYDALRKLEYMEMVISETLRKHPSFPSLNRICTEPFPIPGTSIIIKEGTSIFVPTYALHHDPDYFPEPETFWPERFSKENAGSIKPGSFLAFRHRPKRMYGLNVFSRFEIKSVLALVVSKFTLHPTEKTMIPLAYDCRGLGLSPKEDIWVQFKMRQVT

 

>*CYP401A1 whitefly Trialeurodes vaporariorum seq38__full_length CYP3 clan

31% to CYP6BS1 Tribolium castaneum

cyan too long

MSALTIPILFLVFVLCCWLLFKKHEDQRRFWRQLGVPLLDPIPFFGQKEFSSIFNKSYFEIIHSLYQNARSRGLKYCTVFQFSEPSLMVLDPQLIGRILAKDASHFADRFDRSLDFSDHHPMSQRLFSVSGLAWKDISKFVSPVVSPGRINFLIEEMERGFQQIHHLIDSKTFDIVNADLFAFQLNEDLVGQATLGVPLHDRSGSLSKVTRTIKSFFDASVANWFKFYIPLVFPWFSFLSVPKISDGALGNFIKEIMPLRRINETGRRNDVFQFFVSSKNKRGARRELFDEFDSPQADCTQKDDSENLEVLVNNPENRDISRRIFWFLVDGLGTNAAALTFVLHLISLHPECQEKVRQEVGQTLRDRGESQMTYQVVKDLRYTHKVVKECLRFYTPMSMLQRVCTKKYNIPDSSVFIPEGTKIIIPIYSIHRDPQFFPDPLIFNPSRFDDLSKIIPYTFMPFGEGPRFCIGFRFGMAYLKFVVAKLVSKIVIQPLSTDKDVLVLHPFSPEVLKSREDILIKYVKHSDC

 

>*CYP402A1 whitefly Trialeurodes vaporariorum seq43_full_length

27% CYP6F1 AB001324 Culex pipiens

MTVFSLTFWLYLALLFIGACASLHYFVFLRQAAKWKKSNIPFLKPIFLIGHKYFTQYKYPIAVHLDRIYKDTENYDLIAFFMGSTPMILVRNPTLINQIFKKNFDKTHQNGMTALESDEIFQNSMFLASDRNKWRFQRSVMAPSFSSARLHESEEFGKIKKQAGNLMEYLENAQLSQQPVNVKDVAMKFIVDSIALWGFGEDTNCFQRSEKFHQMTHDFFKPTMKKMLQFLILSHFPSLQMFDSFKIADKKCMSFLRDLLIKNMMLREKSKVKHKDFIYHLGSLKGKVVADTSDENADDSTRKYKEIRFKQMLGLTLAVFAASMQTPGNLACYALHLISLHPDYQRRIKREVDEAMEKNGVSEITNQVIEDLQFTEQCVLETARLYPALPFIVRNCTEDFKVPGTDYFLKEGDKVLINPLSMHQDPKFYNEPDKFDPERFHPENRSSMSPETFVAYGYGPKKCPAYKIGNFLVVTFLASILQKYEVKPRSHSSQIDATGFHPLSFTHECKYDILVDLVPRETTV

 

>*CYP402B1v1 whitefly Trialeurodes vaporariorum seq47_full_length top hits are CYP3 clan

25% to CYP6F1 AB001324 Culex pipiens

42% to seq43

MAFFYFSFFHYASITVVILCFILHYLIYSRRVERWRSSNIPFLRPVFLFGHRYFFTHLFKHSVVVPLDRIYKENADQDILAFFITAAPVILLKSPRLIKAVYAKSFDKMFENGFFPPVEDTAAMSVIPLTSDRAIWKTGRSSMAPQFSTSRLGGVEFAKVKTQVDRLLCNXEKLRESGGPIDGKEAAHNFIVDSVNLWNFGVDTNSWEKKTELYEIIGTLFALSYHRLVCF

FVLSLFPFLQVFESLRFIPRKQVDSVTNFLEETMKFRDENLVDRNDFVDRLMSLRAGNVARNNNDGSKNEAQEGVSLKEMVGYSLSWLLAGSDTSSQMCLFATHLLSIHPEYQNRIREEVDEAMKKHQVSEITFEVVQDLRLTELCLLETSRLYPILPSIMRCALEDFKIPGTEYNLRRGDRVIIIPYSMHRDPKYFKDPDTFFPERFSPEFKEYACMDVYASFGCGPRKCPGYKIGMALATTYIASLLHRYELSPRSHPWQMSAYDLDPRGFTAQHRGEFTVDLFQR

NLKIYMIELRHCLFSFQN

 

>*CYP402B1v2 whitefly Trialeurodes vaporariorum seq76_5'3'truncated CYP3 clan

32% to CYP6A5 housefly U09343 C-term

top hit in zebrafish = CYP5 in the CYP3 clan

1 aa diff to seq47 except ends

NYRNAFRSVLSQTRLL

FVLSLFPFLQVFESLRFIPRKQVDSVTNFLEETMKFRDENLVDRNDFVDRLMSLRAGNVARNNNDGSKNEAQEGVSLKEMVGYSLSWLLAGSDTSSQMCLFATHLLSIHPEYQNRIREEVDEAMKKHQVSEITFEVVQDLRLTELCLLETSRLYPILPSIMRCALEDFKIPGTEYNLRRGDRVIIIPYSMHRDPKYFKDPDTFFPERFSPEFKEYACMDVYASFGCGPRKCPGYKIGMALATTFIASLLHRYELSPRSHPWQMSAYDLDPRGFTAQHRGEFTVDLFQR

KPKNLHD

 

>*seq100_ whitefly Trialeurodes vaporariorum 5'3'truncated

34% to CYP6BV1 Ips pini (pine engraver, bark beetle)

41% to seq43

too short to name

MESRDSLGINEGDFIDFLRSLRGEIDMRQMVGFSFVLIKVGLDAVATLAIFALHLLSLHPEYQDSVKDEIESVMEQHKETEVTFEVVKDLQLTKQCLLETARLFPILVVNLRTCNRRFSKSPGTEYVLRKRRRKVAINPYSIHRDPNYFEDPDNFNPDRFSPQHKGSIASETFLGFGIXQRNAQDQNLGS

 

>*seq69_ whitefly Trialeurodes vaporariorum 5'3'truncated

45% to CYP9P2 Apis mellifera, 44% to seq21 C-term

42% to CYP6CY18 Acyrthosiphon pisum LOC100168007

too short to name

PDQSHWIACAIKLTRTRTLRLKRKPRIVIPVYSIHMDPKYFPDPEQFKPERFESGHRRSIIPGSYLPFGDGKRQCIAKKFAKYVIKMLVAHIATKYTVKASVNTRVLTYDSRKSVTLTP

 

CYP4 clan [15 sequences]

CYP4, CYP380

 

>*CYP4C63v1 whitefly Trialeurodes vaporariorum seq58_full_length

67% to CYP4C1 cockroach M63798

MELITLMLTTTILMFSITYLFKYVIKRIKLVRAINKLPGPKAYPFVGNALELVVPRNQLMKAFEDRTQKWGPLFRTWGGPMPVLHITRPEHAEIILSSSKHIDKSLAYSFLHPWLGTGLLTGTGAKWHSHRKMITPTFHFKILDIFQEVFVEKSQIMIEKLKAKANNEPFDVYPYITRCALDIICETAMGTEVNAQEKTDSDYVRAIYDISELTIKRSLQPWLWPNAVFTMTDYGKRYDECLQVLHGFTNRVIKERKALRASSNGKHTEKTVEDEDAELIGKKKRLAFLDLLLEASESSNGPALTDIEIREEVDTFMFEGHDTTTAGICWTLFLLGSHPQYQEKVFEELDNIFQGDNRLATMKDLNDMKYLERCIKDSLRLFPSVPFIGRTLKEDTTFDSYLVPKGTLINLQIYHVHRCPDQFPNPEEFNPDNFLQERISKRHPYSYVPFSAGPRNCIGQKFAILEEKTMLSSILRHYKVVAHEKFEDLTLINELILRPESGIILKLTPRS

 

>*CYP4C63v2 whitefly Trialeurodes vaporariorum seq115_5'3'truncated CYP4 clan

76% to CYP4C1 cockroach M63798

identical to CYP4C63v1, except one X

LAFLDLLLEASESSNGPALTDIEIREEVDTFMFEGHDTTTAGICWTLFLLGSHPQYQEKVFEELDNIFQGXNRLATMKDLNDMKYLERCIKDSLRLFPSVPFIGRTLKEDTTFDSYLVPKGTLINLQIYHVHRCPDQFPNPEEFNPDNFLQERISKRHPYSYVPFSAGPRNCIGQKFAILEEKTMLSSILRHYKVVAHEKFEDLTLINELILRPESGIILKLTPRS

 

>*CYP4G55 whitefly Trialeurodes vaporariorum seq60_full_length

65% to CYP4G51 Acyrthosiphon pisum LOC100164072

MSSIATPDLLLSSPVSYTSSAIVYLLASVLMLWVVYYRLTRKRLYQLAAQIPGPKGFPLIGHAHLFVGNSNSIFENVYKRTFDFKPSSPLKFWVGNRLIVFLFDPRDIEVILGSHVHINKSPEYRLFEPWLGNGLLISTGEKWRAHRKLIAPTFHLNVLKTFIDLFNKNSLDTVRKMGMEGSKQFDVHNYMSECTVDILLETVMGVNKQVQQAGFDYAKAVMKMCDILHLRQTKAWLKPDLLFKITKSAKDQVKLLDFIHRLTNDVIKKKKEEVLLRRKNTTTGTNTSIEMDETYNENKEGQDMVVKTEPMTTYVSVEGSSYGQSAGLKDDLDVDDNDDDVGEKKRQAFLDMLIESAANGEVLTDNEVREQVDTIMFEGHDTTAAGSSFFLCIMGTRPDIQDKVVEELQGIFGDSDRPVTFQDTLQMKYMERCIMETLRMYPPVPIIARELQEEVKLKSSDLILPTKCTVIIGTVKLHRNPDIFPNPDEFNPDNFLPENTSNRHYYAFVPFSAGPRSCVGRKYAMLKLKIMLATILRNYKVYSDSRQKDWKLQADIILKRTDGFNIRLEPRKIKPISLISDR

 

>*CYP4G56 whitefly Trialeurodes vaporariorum seq62_full_length

73% to CYP4G43 Nasonia vitripennis (jewel wasp)

cyan  too long

MGRKRLYELAERIPGPGGYPLVGNAHEFVGNSHAIFQKLYDRSFEFEPXSPAKVWIGPRLLVFLTDPRDIEIILSSHVYIDKAPEYRFFQPWLGNGLLISTGEKWRAHRKLIAPTFHLNVLKSFIDLFNKNSVLTVQKMKKEGSKEFDVHHYMSECTVEILLETAMGVDKRTQQASGFEYAMAVMKMCDILHLRQTKIWLRPDILFNFTKLAKDQVKLLDFIHGLTINVMKKKKEAYLKNKAATLSNSGVYNTFVGEGAKEKKKIEEKQKAKENTEVVKGSSFGQSAGLKDDLDVDDDVGEKKRQAFLDLLIESAENGVVLTDDEVREQVDTIMFEGHDTTAAGSSFFLCMMGARPDIQEKVVEELQGIFGDSDRPVTFQDTLEMKYMERCIMETLRMYPPVPIIARELQEEVKLKSADLIVPAGCTVIIGTIKLHRNPNIYPNPDEFNPDNFLPEKTSNRHYYAFVPFSAGPRSCVGRKYAMLKLKILLATIMRNYKVYSDTKQKDWKLQADIILKRSDGFNIRLEPRKMKPNRYLL

 

>*CYP4G57 whitefly Trialeurodes vaporariorum seq63_full_length

67% to CYP4G51 Acyrthosiphon pisum LOC100164072

MSMTLAPVQEVSLGYLPSTFVYLLVTCLSLWLAYFRMSRKRLYQLAETIPGPKGYPLIGHAHLMVGKSNDIFQKLYSLSFAFKEGSPVKAWLGPRLLVFLMDPRDIELILGSHIHIDKAPEYRLFEPWLGDGLLISTGEKWRTHXKIIAPTFHLNVLKSFIGLFNVNSRYTVEKMRREGMKKEFDVHHYMSACTVEILLETAMGVDKTTQKASGFDYAVAVMKMCEILHLRHTKLWLRPDSLFGLTHYAKEQIQHLDFIHSLTTNVIKEKKELYQKKKEVNXEVKPKAXEVETEKKTEKSVLEVVKGSSFGQSAGLKDDLDVDDDVGEKKRQAFLDLMLECAENEQLLTDKELREQVDTIMFEGHDTTAAASSFFLCVMGARPDIQEKVVAELESIFGDSDRPVTFEDTLEMKYMERCIMETLRLYPPVPIIARELQQEVKVASENMTLPAKCTVIVATLKLHRLPSIYPDPETFNPDNFLPEVTSKRHYYAFVPFSAGPRSCVGRKYAMLKLKIILATVLRNFKINSATKEKDWILQADIILKRPEGFNISLEPRVMRPKKS

 

>*CYP4AV6 whitefly Trialeurodes vaporariorum seq114_5'3'truncated

65% to CYP4AV1 Apis mellifera (aa 73-144) C-helix region

57% to CYP4BT1 Pediculus humanus

FEGRDSCPVLRISLDLKPSPFSVTSRICSDLRQICINFYSNCFKEYGDIYVVWVGTEPFIFIGSPETVQPLLSSSQCINKSPEYDMLHDWLGTGLVTSSGEKWHHRRKLLTPSFHFQNF

 

>*CYP4CR1 whitefly Trialeurodes vaporariorum seq54_5'truncated

42% to CYP4C1   cockroach M63798

RGPMFAHFMIVDVKEKDPXFXXXXXELSFNPRGIYARFPELIKQYGGAFRIWLGPSLSIVYLSKPEEIEVILGSSKHIHKAEMYEYFEPWLGTGLLIVNGDLWFKKRKLMTSAFHFSNLNNFIPKFNRNINMLTKKLESKADGKSFNVYDCITLCTLDIISESAMSTKIYAQSEKNNRFVEAMDQAELAILKRGFSAWLHPDSWFKKSSVGKMFYKAVHVLHEFADSIIRMRKAEIALNKDQPESNDKKSEDFLKDRYKKMMTFLDMLLKCNEEGAEFTDADLRSDVLMFILAGHGTTTWCMTWALYLLSKNPDIQEKVYEEVISILGHEEKDIEMNDLPELKYTERVIKETLRHFPSVPFFGRTVHENVKLPSGYIIPANSDVTVLAYCLHMDPEIYENPKEFNPDNFLPEVCATRHPYAYVPFSAGPRNCIGQKFAMLQMKTMLAQIIKRFKVLPAPDAPEICPVTVLIFKSDTGVHVRLEKRA

 

>*CYP4CS1v1 whitefly Trialeurodes vaporariorum seq45_full_length CYP4 clan

41% to CYP4C61 Nilaparvata lugens FM163384

41% to CYP4V2 AC012525 Homo sapiens

same as Seq 51

note: NIC/VTAM is the ETAM exon boundary that is not correctly spliced in seq 51.  This explains my cyan region

MKLTIVFTLFCCLVIYRLIKKILLSYRQYQILKGVPGPPVESIILGNTSDIMASPKDAPSRARERFGTYGNVILLWILGFPFVFVAGAEQAEVFFNSKSTSVKSDIYRFLHCWLGLGLLTSQGELWKQRRKLITPAFHFTILNSFLHTFVDNTLTLVDKIAECSVEGPVEVIKMMHL

VALENIC VTAMGIKIDALKNPNMNYVRAIEN

ATHTVMLRISRPWYWNDLIFFLMPIGRQLRKDLDVIFELTGKVIKEKRAERQRKQKENGDSIKQPENEFDEEKRRLAFLDLLLEASESESTPLSDEDIRDEVNTFMFEGHDTTAVSMSFTLYLLGIHTEIQETCYQELESIFQGSDRRPTMDDLQNMKYLEQVIKESLRLYPSVPIIARNVTKDVEIGAYTIPAGTIFSVDIFFLHRDPRYFPDPEKFDPERFSVENSSNRHPYAYVPFAAGPRNCIGQKFAMMEEKVVLSYILRNFVLESMQSEEELKVLFALIIRSQADLNVKFKTKK

 

>*CYP4CS1v2 whitefly Trialeurodes vaporariorum seq51_5'3'truncated

39% to CYP4C38 Culex pipiens

cyan region is missing compared to 4C38

GKKMKLTIVFTLFCCLVIYRLIKKILLSYRQYQILKGVPGPPVESIILGNTSDIMASPKDAPSRARERFGTYGNVILLWILGFPFVFVAGAEQAEVFFNSKSTSVKSDIYRFLHCWLGLGLLTSQGELWKQRRKLITPAFHFTILNSFLHTFVDNTLTLVDKIAECSVEGPVEVIKMMHL GGVGKHMR ATHTVML

XXXXXXXXXXXXXXXXXXXXXX

RISRPWYWNDLIFFLMPIGRQLRKDLDVIFELTGKVIKEKRAERQRKQKENGDSIKQPENEFDEEKRRLAFLDLLLEASESESTPLSDEDIRDEVNTFMFEGHDTTAVSMSFTLYLLGIHTEIQETCYQELESIFQGSDRRPTMDDLQNMKYLEQVIKESLRLYPSVPIIARNVTKDVEIGAYTIPAGTIFSVDIFFLHRDPRYFPDPEKFDPERFSVENSSNRHPYAYVPFAAGPRNCIGQKFAMMEEKVVLSYILRNFVLESMQSEEELKVLFALIIRSQADLNVKFKTKK

 

>*CYP4CT1 whitefly Trialeurodes vaporariorum seq52_full_length

37% to CYP4AW1 Phyllopertha diversa (scarab beetle)

MDSITIILLLVSFFVWLVTLVQPSKKHRQFGDLIPGPKPFPIVGNVPDVGVNSKLVTQTMGKIADKYGSIFRTYLGKDLFVVVSNPVDIETILAENKQLVKTRKSMEGGRPWIGEGLLLAPEEKWKINRKRLLPAFHLKMLENFVPVFNKNALILIKELNSLMDQQEVNISELSARTALRNICETAMGVSLDSLSTNDVYPKTIEKLSSLYATKIFVPLLEYKFIYNLHPIGWQEKRLLKYVDSITDKVIKSRKAENKRWDLTLETQDLAEGQRKRMIFLDLLLKIQEEDPSFDDQQIRDEVNTFMFAGHDTVAATSAFCLYLLSKDRDIQDKIYEETENILGGDDRSLEFKDLQEMKYLEQVIKETLRIYSSVPMIGRCPAFDIKLKSGLVIPAGCEIVCWLHRMHNDPELFPDPKVFNPDRFSAENMKNRHPYSFMPFGAGPRDCIGMKYAYNELKVILANLVRNFVFLPGENQDELNLMTEIVLKTEPDIHVKVKQR

 

>*whitefly Trialeurodes vaporariorum seq73_5'3'truncated CYP4 clan

41% to CYP325F1 Anopheles gambiae

too short to name

YSLSSARIKVKELVDPLRXFVADILEEQITRRNELRRNGIPKDIPQTFINILLNSIETGVITKEKAHEEMNEMFIAGSITTAISNAWIFKNLAMHPDIQEKVYREIIDTCGHSEITSSDFSRLVYLDMVVXETLRLFGAPIVGREIVEDLKVDEKTTIPAGIGVLLFIHGIHTNSDYWERPGEFYPEHFASSNKARRPEGAYIPFLIGPRFCPGNKYAMQSLKFGGQYNASLRVFNRRKAADGLERQLLPFMFMACPLKDSVPNQEEESQSTS

 

>*CYP380D1 whitefly Trialeurodes vaporariorum seq81_5'3'truncated

53% to CYP380C6 Acyrthosiphon pisum LOC100167889

KQHCGTGVEFDLWHPVASLNLDIICQTALGVEINTQDGQNSDFATALARASELDYMRIYKPWLHPDFIFDRVSWASELKEVYKTLHGLPKEVIQRRKKEFALSKEQNETEEYTPENGKKLKVFLDILLELNDQGLFEFSDQDMLDEVVTMMVGGSETSAVTNCFCILLLAMHPEIQDKLFEEQLSIFNGEDRPVTLDDLSKMIYTEQVLKETLRMFPAGPVFLRTVKEDTKLTGNHTLPAGASLVIAPIMTHTSPEIWPEPQKFNPDNFSAENLEKKHRYSFIPFSGGPRGCIGSKYAMMSMKTTISTFIRNYKVSTTTTLETLRLRVDLLIRASKGWNVTLESRQCPKSSLIEGS

 

>*CYP380E1 whitefly Trialeurodes vaporariorum seq93_5'3'truncated

46% to CYP380C6 Acyrthosiphon pisum LOC100167889

49% to CYP380D1

ICKTTMGYDLKINEQTNAQSPEQEXAKXLEEASVLDSMRIYKPWLHPELIFTLMRYIQGFDKLYEQLKFLPNLVITRKKAEFAEKQKQKQLGESEPSEEEALGAKKKYKVFVDILLEMSAEGANFTDKDITDHVITMMVGGTETSAITNCFCLLMLAMYPEFQDKAYEELESVFGDSDRDCTAEDLVQMPYLEQCLKETLRLFPPGPVFIREATEDIQIKKMRHSKRMLG

 

>*CYP403A1 whitefly Trialeurodes vaporariorum seq94_5'3'truncated

31% to CYP351A7 Tribolium castaneum

top hits in human are all CYP4 = CYP4 clan

LYNAFIKRTTKCRCTKCFASLLPTEEFVFIVDPHLMQAILRSSHCNDKDVLLYDNFIFPGMLVSSNGKLWLEKRRTANLGFLPNILARLDAIYLQHVNQFLDNMRQYAVSKETFDVFPEVVWMVEDILGDTFIGVPMDVQKKKDPNIVXYMMKFTGQLIERCFIPFLRPKIIYSIFRGWRTLDDMIQLGEYTSHEIVTKRIQHRKRLKKNGESEDTKLEFGENIYLDNLLDQLETEDEENLDGVVHELLEFLIAGTGPASIMISWVLIISGMFPEVGEKLHAEIEEFVASDEESMDIKTCAKLEYLDMVIKETLRHFTAPFIFRQTKEDVFIKGFPTIPAGARLGLLFHALHHHPAYWERPMEFYPEHFLPENVAKRPNGTFNPFSGGMRDCLGAKYAMQTMKCVLTQILSKVKFKPARMKPWTNVYNEVLFEYALVQMAADGFFVTVEFKEKTEFIQTNKYSISI

 

>*CYP403A2 whitefly Trialeurodes vaporariorum seq83_5'3'truncated CYP4 clan

38% to CYP351A4   Tribolium castaneum

65% TO SEQ94

DASLESGQKIYLDILLDMFETADDGNLDDVVEDMIEIWEAGISTTTSIACWVCLLSGVFPEVGEKLHAEIEEHFSSDEQSMDIENCAKLKYLDMVIKEALRHFTVPISFRQNEEDVFIKDVGTIPAKARIGLFLTALHHHPAYWEKPLEFYPEHFLPENVAKRPNCAFLPFSGGKRVCPGEKYAMQTLKCTLTQILSKVKFRAAKMKPWKNVYSENSHTLGFTLIPPDGFFVTVEFKDNILNDRL

 

mito clan [9 sequences]

CYP12, CYP49, CYP301, CYP302, CYP314, CYP315, CYP334

 

>*whitefly Trialeurodes vaporariorum seq98_5'3'truncated

64% to CYP301B1 Tribolium castaneum

63% to CYP49A1  Acyrthosiphon pisum LOC100161793 Heme region

too short to name

VTAVDYFPDPDSFTPERWLKSNKQTHHPFASLPFGYGRRMCVGRRFADLEIQTIITKMIQAFKIEYHHEELEYRIHPMYMPDGPLRFKCIDR

 

>*CYP301A1 whitefly Trialeurodes vaporariorum seq105_5'3'truncated

75% to CYP301A1   Tribolium castaneum

VLNHGEPWREFRTKVQKPVLQIQTVKKYIEPIEDVTNYFLQRMTEMRDTKNELPTDFDNEVHKWSLECIGRVALDARLGCLDPNLPKNSEPQKIIDAAKYALRNVAILELKFPFWRYIPARISPLWNRYVRNMDYFIEICMKHINEAVNRLSTKTEVNEKDLSLVERILASEPDPKTAYVLALDLILVGIDTISMAVCSMLYQLATRPEEQEKLYEELVRILPSPDEPLTASKLDQMIYLKAFIKEVLRVYSTVIGNGRTLQADTVICGYKIPKGVQLVFPTIVTGNMPEYVSQAEKFYPER

 

>*CYP301B1 whitefly Trialeurodes vaporariorum seq108_3'truncated

70% to CYP301B1 Pediculus humanus

MASRLGKRLSKILSSPQATQPLRHKSTVLPAESGAGGCPAMHVGEADAKELGAVKDYSQVPGPRPIPFLGNTWRFIPYIGDYKIEEVDRVSLRLHRQYGDIVKISGLIGRPDMVFLYDADEIEKVFRNEELMPHRPSMPSLNYYKHKLRKDFFGDDAGVIAVHGENWYQFRTKVQQPMLQPRVSRLYVEPISNTADEFVNRVREIRDSKLEVPADFLNEIHKWSLESIARVALDVRLGCLDGSKCRRNSRAHRCC

 

>*CYP302A1 whitefly Trialeurodes vaporariorum seq78_5'3'truncated

56% to CYP302A1   ortholog Nasonia vitripennis (jewel wasp)

IEGETCSEHRQLISHRTVFKGDLKCFIKTRQVKYINGVGVDLLLAGIDTSSYTSSFALYHLARNQAPQELLRKEVNKLVDAANSNGSITVEMLKNASYTKAVLKEIFRMNPISVGIGRILAKDAVFSNYFVPKGTTVVTQNQVSCRLSEYFKDPDEFRPERWLKSNASHQPVSPYLVLPFGHGPRSCIARRLVEQEMCVLLMKIVYNFNIVWNGKGDLDCKSYLINKPDAPIALSFLPRF

 

>*CYP314A1.a whitefly Trialeurodes vaporariorum seq113_3'truncated N-term

(join with seq 77, 12 aa missing in gap)

40% to CYP314A1 ortholog to shd shade Pediculus humanus

MKVIFKMSPIIKQGWTLTDLSPVLLLAVFLIFAEYKSWSSHWLIIKSYRIIGKKKVFRKKTIKDVPGPYSLPIFGTRWLYSKFGGYRMNKIHELYADMFEKYGGIVREEVSVELPGG

XXXXXXXXXXXX

 

>*CYP314A1.b whitefly Trialeurodes vaporariorum seq77_5'truncated

61% to CYP314A1   ortholog to shd shade Pediculus humanus

missing N-term

NKSSKFPFRPPNEVTSYYRKTRPEKYTNLGLVNEQGETWHHLRNTLTPSLTSVQTMIRFLPELNQVADDFNTLITNSRQENGVVHSFEELANRMGLESTCTLILGRRLGFLEQEVNPVASRLADAVKAQFISSRDTFYGLPFWKMFRTPAYDRLVESEDTIYEIISEMVDEARRDESEKAAVDPVQTVFMSILKAEGLELCDKKAAIXDFIAAGIKTLGNTLVFLLYLVAKHPEVQEKIYEELNELISDGCPLMTGTLKNAKYLRACIMEAFRVLPTAPCVARILESETELSGYTLPAGSVVLCHTWLASQEESNFPDAKEFKPERWLNDSKEPFLVCPFGVGRRMCPGKRFVELELQVVLAQTVRKFHIDFDEELDLQFEFLLAPKSPTNIILRDRH

 

>*CYP315A1 whitefly Trialeurodes vaporariorum seq80_3'truncated

39% to CYP315A1   ortholog Nasonia vitripennis (jewel wasp)

MVPHFPKLLPRSKSLPLRYLSSVIAKTFSSGGENIPTPRKWGSLHTLSVMLKSRFGKKLHKYIDDMHLRYGPIFRETLGPVSAVFISDPNEMRRVFAHEGKHPKHVLPETWLLFNEKFKYQRGLYFMDGEEWLYYRKLLNSLLLKNYNEQQLLTWCEPIVNRSISEWYVSSREGEILELELQLYKLSINFMLAVMIGSSTPDHLHKFQNEVALLAISVRNIFKESVALSQIPAETAAKWNLPAWKRFVEAVNNSLTDASLILKEIQPIVNSDGLVYQLMQQNIPEAKISSIVVDFILAAGDTTATTTQWALYLLGFHPKTQTAVAEESQNCNLVETCESELMRGVLRETLRLYPVAPFLARFLPKDVKLFDSYIVPANEMIVLSVYSSSHNEKYFPQAEEFIPNRWKRTDEDRLLGVNDPFASLPYAMGARSCIGRKIAQSQICFTIAKIIKDYNVENMDIVDMNLHLIPVPSKPIRLHFESRV

 

>*CYP353C1 whitefly Trialeurodes vaporariorum seq85_full_length

46% to CYP353A1 Tribolium castaneum

cyan too long

MSSIFSHNYVRFFSKISLPFSEIPSPPSLPLVGHALLFSENGPYRLDRLPEAVADLTSKFGPVFLLKLGPQELIVSSDPDDVRIMYQNEGRLPKRPIFPALYHVRKKNYGSVGVTPGNGEEWHHFRTALNPILKPATVNSYLPGLNMVAADFMXYXEKNMSEDNILSDICSHFLKFSIEAISTVSPGIKYSILRDPPTLNAAAIVEANKDFMEGVYLTLMGLPWWKLWKTKPYKQLENSHSVIYSSIKNELQVMREKCNAGKLKDSPFMELLFSNKSLSSEDQIMLAMEIFLGAIDATATTLSMLLYYLARNHDCQLRAYENAKSDDDSRYLLACIKETLRLSPTSIANSRFLASDAVIGGYKVPAGKCVTTFHPISGVSEKYFYNPQKFEPDRWLKENKIEISHPYASLPFGFGPRMCPGKRLAEQEIIILIKAILLKYRLEDDGNPTPVGMVARMNRIPDRKINIRFSSRH

 

>*CYP404A1 whitefly Trialeurodes vaporariorum seq86_full_length mito clan

32% to CYP301B1 Apis mellifera, 38% to CYP44A1 C. briggsae

MIVSRRNKAQISGLIENLNLCMSGKQFHTEVESKANVGVRPFSEIPGPFCLPILGNLYQYKLGFYDVHKYHAVLEDLYRRYGPVVKEKLGPKTIVHVFSPDDAKTVYLNEDRMPYVTPLQEVIQVYRQKEAFSPGLGNINGETWYRLRNAIRHLMLQPKEVQEYLPGVQSIADELIEMIHRKRDSENIVATLQDELNKYIQEAAGFVCFDRRLGYFTDEKSKLVKEIFTANRTVFHLSGILKFSLPLYKYWNTPKWKRLVAAEDIIMRTSIQYVNETIDSLQTLEKEGDLSNDRYPFMKSLVAKKELSLEDVTILTLSLFTDGLSTTVPSLLFNLYCLAANKDAQEKAYQEICEVTNGSKTLSVSMINRLSYLKAAIKETFRVLPNGTEIARILKKDLLLSGYQIPAESIVTLNMNVHFKSEEYFKDPEVYRPERWLRGNEGSTINPYLLIPFGHGTRSCSGRRFAEQDMVVVLCKILQNFSLAYPVEEKPLEAVFDTLLFPNKPLKVQFIPR