White rot FASTA file July 31, 2001 167 sequences, 126 with unique heme signatures
Gene models are being determined. 47 scaffolds with 103 sequences have been analyzed 
in detail.  92 complete P450 genes are assembled now with all intron-exon 
boundaries tentatively identified.  Three of these genes were split at the ends of 
adjacent scaffolds.  Seven pseudogene fragments have been identified and two P450s run 
off the ends of scaffolds without continuations identified on other scaffolds yet.   
(x) indicates intron phase. ex follwed by a number indicates exon number
THE SCAFFOLD NUMBERS ARE NOT CYP NAMES!!.  ONLY CYP51, CYP61 AND CYP63 ARE NAMED NOW.

>Scaffold_44 CYP51 gene model complete all boundaries checked
93217 MSLSQYGPIAGLVGQAYDALASMSTSRLVLFLLINIPILSV (0)
      LPKDKSLPPVVWHWFPWFGSAAAYGEDPIKFFFDCKEK (0) 92907 
      YGNVFTFILMGRKVTVALTPAGNNFIMGGKHTTFSAEEVYG (0)
      GLTTPVFGKDVVYDCPNELLMEQKKFVKFGLSTENFRQYVGMIEEEVLQFMRNDASFK
      IYQMNDINEWGAFDVLKVMSEITILTASRTLQGKEVRANITKDYAQVYNDLDGGFTPLHF
      MFPNLPLESYRKRDAAHKKISDFYISIIRKRRENPGQ (0)
      EEHDMIAALMNQKYRVGRPLKDHEIAHIMIALLMAGQHTSSATGSWALLHIADRPDVA (2)
      EALYEEQVKHFRQSDGSWRTPEYEELKELPVLDSVIRETLRIHPPIH
      SIMRAVREDVVVPPTLAAPSEDGRYVIPKGHVVLSSAAISQVDPMLWKNANDWDPSRWSD
      PEGVAAQAYKQYDDAEGAKVDFGFGLVSKGTDSPYQPFGAGRHRCIGEQFAYLQLGTIISTFVR
      HVEMRLPETGVPPPNYHVRSHTRILRLVCADVASADDDHTPEGASQHSLQAA* 91272

>Scaffold_75 CYP61 49% to 61A3 gene model complete all boundaries checked
may be a small intron after TRKAL compared to other CYP61s
38607 MASSQAAFPSTLSDSSRHSTDSPAFIGLLPTGSWF 38711 ex1
38712 YTTAAILLSLLVIEQSVYRYKKRHLPGDKWTIPLIGKF ex 1
      ADSMKPTMEGYMKQWNSGALSAISVFNV (2) 38909 ex1
38970 RFIVMASTTEYARKILNSPTYAEPCLVHSAKQIILPDNW (2) 39086 ex2
39142 VFLTGKEHVEYRRGLNLLFTRKAL GYVLQYCLVLYAMLTHRR SLYLGIQDVITRKHFAKW 39321
39322 LADAAKDPSAKPIMMTARELNMETSLRVFCGNHIPEHGAKEISDKYWMITVALELVNFPL 39501
39502 AIPGTKVYNAIQARKAAMKWLELAARKSKESVAAGNPPECMLEEWVTILNDPAYKGR 39672
39673 REFSDHEMAMVVFSFLFASQDAMSSGLIYGFQHLADHPEVLAKVREEQER 39822
39823 VRGGDYEKPLTLEMMDEMPYLRAMVKETLRVKPPVTMVPYKTTKAFPISQDYTVPSGSMV 40002
40003 IPSFYNSLHDPAVFPDPDRFMPERWLDPNGSANTNPRNYLVFGSGPHKCIGLEYAMMNIA 40182
40183 LVLANAAVLMNWEHELTPQSDKVQIIATLFPQDGCKLKFSPRQHA* 40320

>Scaffold_86a 6 different sequences 53% identical to 86f
gene model complete all boundaries checked
60378 MLNLSLDSSSVLSLVWTASPWLLLSWILYTVLMAVYNLHFHPLAKFPGPKMAAASEWWLA 60557
60558 YVEVIKQESLSKKLWELHEQY (1) 60626 ex1
60672 GDVVRFGPNQ (0) ex2
60760 LHFSKPAAYNEIYNVKNRWDRDMKLYHIFADEVSTLTIPDYARAKKRRDLTTFLFSRKN 60936
60937 IVNMQHLVQQC (0) 60969 ex3
61021 LDTVCENIDKHIKEGKPVSIFKAFRCAAADVICTMCFARSMNATSEPGFNAQ 61176
61177 VVTAIHAAFPVIMVFKHFPLLQTLSRMVPPLLLSSLRPELNGLMKMRK (0) 61320 ex4
61378 MLTDQVKEVKAHPEILKESQQVTIYHELLKDPKNIPSDTSLRDEAVLYVTAGMDTSSDTLT 61560
61561 LATINVLSRPDVHARLMHELVEAWPHLEDAPPRYEQLEKLPYL (0) 61689 ex5
61749 TAVLKESLRLSHGVVQPMTRVVPREGAYISGHFIPGG (0) 61859 ex6
61913 SIVGMSSIFVHWNEEIFADARAFKPERWLDPEADLDPWLVAFSKGPRSCLGV (2) 62071 ex7 
62137 NLGWCELYMSIAAIFRRYELKLNGIG (2) 62202 ex8
62257 PSDLVWRDVYLPLHIGPDLTVIAKRRTV* 62349 ex9

>Scaffold_86b 6 different sequences 498 aa gene model complete all boundaries checked
64671 MDDIVLVLLVACAVALYARTKRTRYRLPPGPKGLPILGNTYDIPAKYEWLAYEKWSRDF (1)
      GSDIICLKFVGTPVIVLNSIQAINDLLEKRSSIYSDR (2)     
      VGLDRNFGFVPYGDVWREHRHLFHQYFRLDMVPKYHDRMLKHSKDLLQRLLVSPDRLMEHLRF (2)
      SVAGASILNISYGIDVQPENDHYIAVADEAIHALAVTGNAGSYL (1)
      VRYIPAWVPGAKFKRDAANWWEKTRLMIDEPFNYAKQRM (0)
65809 AQGKGMDCVTAVMLSAIGEDQDREHQELLIKQVLSVSYI 65925 (1)
      GGADT (0)
66052 TVSALATFVLAMMQNPKMQRIAQADIDRVVGGERLPSVEDRDSLPYVTAIVKEALR 66222 (2)
      WRPVIPL (1)
      AVPHRVTVDDEYKGYHIPAGSIIVGNVWY (2)
66487 AVLHDETRYPNPDVFDPTRFLTSDGQLDNNAPDPAEACFGFGRRICAGRYFALDAVWLSVACI 66666
      LATFDIAKPLDENGNPIEPSGEYTTGLLS (2)
      HPVPFKVSFKPRSAAAEALVREPISRDL* 66903

>Scaffold_86c 6 different sequences 497 aa gene model complete all boundaries checked
67683 MDYLGISILLVAALALHYFLRKKRYRLPPGPKGLPILGNALDIPAKHEWLAYAKWGQEC 67859 (1)
67912 GSDIIYLNLAGTPVVVLNSAKAAKDLLEKRSSIYSDR 68022 (2)
68152 IGLGRNFGLKPYGDTWREHRRLVHQHFRTENVPRYHEFTSKQ
      IGRLLLHLLEDPSNFVRHLRI 68340 (2)
      MAGASILRICYGIDVQPDNDHYLSVADEAIESIAATGNAGSYL 68523 (1)
      VRYLPSWAPGAQFKRDAAKWKEKVDRMIAEPFDYAKRYMAS (0)
68826 TEGAATDYIAGLLLSAMDPGRDKTQQEIAIRDSLWAAYV 68939 (1)
      GGADT (0)
      SVSALATFTLAMVLYPDVQQTAQAELDRVLGKDTLPTIEDRDSLPYVTAVVKETLR (2)
      WHPVTPL (1)
      AVPHKVTTDDEYRGYHIPARSIVVGNVW (2)
69503 AILHDPDRYPNPESFEPSRYLTSDGLLDPAAPDPTEACFGFGRRICPGRHLAYDTIWTGIASIL 69688
      SSFDISPPLDEQGKPVNPSEEYTTGMLS (2)
69836 HPVPFRANFKARSENVEALIRRITLCE* 69916

>Scaffold_86d 6 different sequences 499 aa gene model complete all boundaries checked
70591 MQTVVLAILFVFAIALPIYSRRKRYRLPPGPRGLPIIGNILDIPAGREWLTYAKWSREY (1)
      GSDIIYLNMAGTPVYVLNSIQATTDLLEKRSSTYSDS (2)
      VGWGKNFAFQPYGDFWREHRRMFHQHFHPEAVTKHHVHILKQAKDLLQRLLVDPDDFMQHLRF (2)
      MAGAAILRVSYGINVQPENDHYIGIAERAIHSLALTGNAGSYL (1)
      VKYLPSWAPGARFKRDGEIWRREVDQMFSEPFELVKRQMVG (0)
      ADGEPPDCVTASLLTTLDERKDRPREELEIAVKQAVGTSYV (1)
      GGADT (0)
71980 TVSSVATFILAMLQFPDVQRTAQAEIDRVVGSTRLPTIEERGSLPYVTAVMKETLR 72147 (2)
      WNQVTPL (1)
      AVPHKVTVDDEYKGYFIQAGSIVIGNSW (2)
72440 AVLHDETRYPNPEAFDPTRFLTPDGKLNPSAPDPVEAAFGFGRRICPGRHFAMD 72601
      AIWMNLAFILATFNIEKPLDEAGRPIEPSGLYTPGLLS 72715 (2)
      HPEPFRVKFIPRSKAAEALIRETMFYD*

>Scaffold_86e 6 different sequences 494 aa gene model complete all boundaries checked
73397 MENITFAVLFVLLLAVPLFFKRQRYRFPPGPKSLPLIGSVLEFPVQSSWLTYQRWGREL (1)
      ASDIIYLNVLGKHIYVLNSAQAVSDLLEKRSGTYSDR (2)
      VGWDKNFALQPYGEFWREHRKAFHQQFQPDMVPRYHVHMYKQAKDLVRRLIAEPNALKQHLRY (2)
      MAGALILRVSYGIDAEPNDDHYFEIIEQAVYSLTEVANTGAYL (1)
      VKYVPSWMPGAQFKRDATEWAPQVNQMFDEPFDVVKRAL (0)
74537 AEGNAPDSVCAALLSELDPRKDRAHQETVIKQAVGTAYIGGADT 74656 (0) intron lost
      TVSTLSTFVLAMMTHPDVQRTAQEHIDRVTGGDRLPTIEDRDALSYVTAIIKEALR (2)
      WRPVLPM (1)
      AVPHITTADDEYRGYHIPKGSIVMGNAW (2)
      probable seq error with extra G before AVL
      AVLHDEARYANPDAFDPTRFLTPAGTLDKDAPDALEAAFGYGRRVCAGLHFAL 75312
75313 DSMWVNVACV 75342
      LATLDIRKPVDEHGVPVEPSMAYTTGLLE (2)
      QPEPFAVVFKPRSQAAEALIYEGHDD* 75568

>Scaffold_86f 6 different sequences 53% identical to 86a
gene model complete all boundaries checked
77777 MLRLLVDNGLVSALAR 77730
77729 YGPAMLISIIVWTLGRVVYNLYFHPLAKYPGPRMAAATEWWQAWLEIFKAESLSLTLLELHAKHG (1) 77532 ex1
      GDIVRIGPNE (0) ex2
77403 LHFSRPSAYHEIYTSKNKWAKNPAFYRYIVSPTESTFSTCEYDKAKKRRDITLPIFSRK 77221
77220 SILGMQHLVQEC (0) ex3
      IDSMCENIDKHISEKKSVNILRAFRCCALDAVTSLCFARNTRATSEPEFRAPIEV 76969
76968 AMDFSLPLTPVLKHFPMVQVVMSWLPPDVLLWADARLGGFVQLRK (0) 76834
76780 MLDAQVEEILRDPDVLASAEHPTIYHAFLAHAPTPSVAELRDEALVYVHAGTDTSSDAL 76604
76603 AVGTLNVLGRPAVLARLRAELDTVWPRLDERPRYEALEALPYL (0) 76475
      TAVVKESLRCSHGVVHPMTRIVPRGGARISGAHIPAGTIVAESNIFVHWNAD 76264
76263 VFPEPHEFRPERWLEGKTPSGESLDNWLVPFSKGPRSCIGI (2)
      NLGYCEIYMTFANLFRRYDLSLDGVK 76021 (2)
      PSDWKWRDCYLPHYLGPEMKVVATPRLS* 75874

>Scaffold_193a very similar to 252a gene model complete all boundaries checked
33472 MDDVNLFIRARTLLDSVLVLILTSIGYAVA ex1
33562 NAVYNVYFHPLSKFPGPRMAAASRWWKTYVEVYRDESIVDRLFHLHEKYG (1) 33711 ex1
      NVVRIAPDE (0) ex2
33858 LHFSDPAVYNAIYSPKSRWNKDPLMYAPFGFGSHRSMFSTVEYQPAKKRRDLAAPHFSRK 34037
34038 SVLNLQGVIQAG (0) 34073 ex3
34127 IDELCDAMAQRAAEGKPTDIYSAFRCLNFDNVTSYCFGWSLHMVRSPDFSAEPVQNMQD 34303
34304 MHSSYQVWKHWLRTPMRLLLS (0) ex4
34473 KIKEQVDGYLERPEELDNAPHSLIFHSLMDPAQSTKLDKQSVVEEANLLIIAGTDTISN 34649
34650 ASALGTLFLLSDGGYMRDKLQAELKAIWPRLDDKPSLEVLESSAPYL (0) ex5
34841 KAACKESLRLSHGVMSPLLRVVPSQGATLGGHFVSGG (0) ex6
      TKVGICNAFVHLNPALFPDPHVFRPERWPEPGAESLDTWLVAFSKGPRSCIGIK (2) 35165 ex7
35215 NLGWCELYMNLANLFR (2) ex8
35378 RRVRAYDLWYQDRFLPYYQGPDLLVHATPVSD* 35476 ex9

>Scaffold_193b very similar to 252a. gene model complete all boundaries checked
36645 MNVWARVSEGWTALEVILVALLTSIGYVVTTA
36741 LYNIYFHPLSKFPGPKLAASSWLWKAYVEVIKGESILDRLSKLHEEYG (1) 36884 ex1
      PVVRIAPDE (0) ex2
37027 LHFNDPAVYNEIYTARSRWNKDDVMYAPFGKDTSIFTTREFREAKKRRDLSAPHFSRKTV 37206
37207 LSLQGLIQEG (0) 37236 ex3
37296 IDEFCEVITKRDADSKTTDIFRAFRCLDFDNVSSFCFGWSEHAIQAPDFNSAAVEELQH 37472
37473 SNKDFQFWKHFLRLPLPVLLLAS (0) ex4
      RIKNQIATYIDK 37690
37691 PEELDKTPHPTVFHVLMDSSHGTRLSATAMAEEASLFLIAGTDTTSNASALGTIFALSDN 37870
37871 GYMRNKLKEELKSVWPRLEDKPSLEVLESLPYL (0) ex5
38020 KAVCKESLRLSHGAMSPLMRVVPQQGAVLGGHFVPGG (0) ex6
38188 TKVGMAHTFVHFNPTLFPEPHTFRPERWLEPGAEALDTWNVAFSKGPRSCLGIK (2) 38349 ex7
38403 SLAWCELYMNIAHIFR  (2) ex8
38566 RPVRPYDLWHRDCFLPYLDGVDLLVYATPSTD* 38664 ex9

>Scaffold_252a 6 P450s on this sequence. 
gene model complete all boundaries checked
13839 MDVVRQALEGRTTKEYAGLALLAFAAYVVANI 13744
13743 IYNLYFHPLAKFPGPRAAAASRWWKAYVEVYKGESIVDRLFELHAEYG (1) ex1
      DVVRITPDE (0) ex2
      LHFSDPKVYNEIYNTRSRWDKDGEMYAPFGGNSTMFTALRYHDAKKRRDLTASLFSRK
      SVLSLQGSIQEG (0) ex3
      LDELCDIISARSAAGKTTDLFRAFRCLNLDNVTSFCFGWSLHTVRAPDFRAPPLEEVQN
      SHGGYQFWKHLMLFRAVLLP (0) ex4 joint not conserved in scaffold 193a and b
      KLKEQVDALVAR
      PDELEAAPHPIIFHSLIDPAHGAKLSAQELMEEANMFIVAGIDTTSNATGAGVIGVLSN
      PSTYDKLKTELRTAWPRLDEKPTVEVFESLPYL (0) ex5
      KAVCKEALRLSHGITSPMLRIVPPQGATLAERFVPGG (0) ex6
      TQVGVSHLFVHLNPTLFPDPHAFRPERWLEPGAESLDTWLVAFSKGPRSCLGI (2) ex7
12062 NLGWCELYLNIANLFR (2) ex8 
      RRARASGDWKDCFLPCFEGPDMLIHTTPVAD* ex9

>Scaffold_252b 6 P450s on this sequence 
gene model complete all boundaries checked
27279 MWVVTCTCAAILYMVLVGLRKRHRFPPGPKGLPLIGNVLNAPAGSSAPMVYQQWSKLF (1) 27106 ex1
27051 GSNIIHLKIFGTHFFVLNDAKTASDLLEKRSANYSGR (2) 26941 exon 2
26800 TGWDRDWGLLDYGDSWKKHRHVHHRYFHPKVLEAYHPRM ex3
      EKGVQMLLQLLHRSPADFNAHLR (2) 26615 ex3
      FMTGHIIISIVYGIETKSADHPYIGLAEEGVKAFSATAVPGRFL (1) ex4
26287 VKHIPAWFPGADFKRQAALWKKDVDAMYETPFNDIKAAI (0) 26171 ex 5
26114 RRGETNTSIVGAALAELEGQADTEEAENIIMNVAGTAYP (1) ex6
      TASDT (0) ex7
25872 TIITLEFFILAMLQHPEVQRRAQADLERVVGNARLPSIHDQALLPYITAIMHETLR (2) 25705 ex 7
      WRPPFRT (1) ex9
25581 VSLPRKSLHDDEYEGYHIPAGSIMIANEW (2) 25492 ex10
25443 AILHDEARYPNPEEFDPSRFLNTDGSIDHTVPEPVEPFGHGRRLCPGRHFAMDVIWLTI 25267 ex11
25266 ANILHVYSIEKAVDQSGNVVEPSGKCIDGLL (2) 25174 ex11
25113 SAPEPFQAVFRPRSDAAIALLRSID* 25036 ex12

>Scaffold_252c 6 P450s on this sequence 
gene model complete all boundaries checked some differences with 252b
29836 MSDSTLLAVGLIFGLLVLARVSRKRPRFPPGPKGLPIVGNLFGIPRDHSWLTYAEWGRLY (1) 29675 ex1
29611 ISNIVHFEALGQHFFVLNDEKITKEIFEGRSQIYSDR (2) 29507 ex2
29377 TGWHRNWAFTPYGESWRQNRRLFHQFFRAQAIPDYHDHM ex3
      AKGARGLVQLLLQTPENWMRHIR (2) 29192 ex3
29135 HASGSTVLDAVYAMDVDPNDNERLEGVERAVETLVEIAEAGGYL (1) 29004 ex4
28881 VKHIPTWFPGAGFKRQAMAWKRDIDALFERPYHEVKSAMGCRIFSE (0) 28765 ex 5 
(ex5 GT boundary does not match 252b possible mutation from GTA to GGA)
28706 QRGKARSCVTSSLMSMFSEKLGDPDVEETIMGIAGTSY (1) ex6 
      AGSDT (0) ex7
28473 TVFTMFAFVQAMLLYPNVQRKAQEELDRVVGRDRLPEVADRQSLPYVSAIVKEILR (2) 28303 ex 8
      WNPILPA (1) ex9
      AVYHKSLADDWYEGYFIPAGSIVIGNTW (2) 28097 ex10
28033 AVLNDAERYPDPEPFKPERFLTADGQLDSQVPDPVEVFGYGRRVCAGRHFAQTALFLYI 27857 ex11
27856 AHVLALFTIDNPLDESGHVIKPRRDCLTRL (2) 27767 ex11
27706 VPKPFKAKFKPRFTGVEELVHMSSIPTQ* 27623 ex12

>Scaffold_252d 6 P450s on this sequence 
gene model complete all boundaries checked
32807 MQSNALVIACLVAGLLAVARASRKSRQRRYPPGPNGLP ex1
      ILKNLFDIPRTYSWLTYEAWGREY (1) 32622 ex1
32563 NSDVVHFEALGLHFVVLNSTEAAKELLEGRSHIYSDR (2) 32456 exon 2
32315 TGWHRHWGIMAYGDAWRQRRRLFHQHFRPQAVPQYHEPMV ex3
      RSARTLLQLLLESPDDWMRHVH (2) 32133 ex3
32076 HVSGGTVLKVLYAVDVDPHDDEGMDVVDKALQIFMKLPEPFV (1) 31966 ex4
31828 VKHLPAWFPGAGFKRRAMEWKVHVDRMFEEPYHKIKVAA (0) 31721 ex 5
31653 QSGTARPCIATSLLSAAWEDLENPDVEEQLISVLGTAY (1) 31534 ex6
      ANSDT (0) ex7
31429 LEQTIFSVYSFVIAMMLYPDVQRKAQEELDQVVGRDRLPEIADRESLPYFSAVLKEVFR (2) 31253 ex 8
      WHPVTPI (1) ex9
      AAPHKSLEDDWYKGYFIPAGTIVFGNTW (2) 31034 ex10
30986 AILHEESRYAEPDVLRPERFLTPAGTLDPAVPDPDEVFGYGRRICPGRYFVQDALFLYA 30810 ex11
30809 SHLLAAFTLSKFVDDEGHVEEPSRETVSPIF (2) 30711 ex11
      MIPRAFKANIKPRYEGAERLVQMAFTSAS* 30563 ex12

>Scaffold_252e 6 P450s on this sequence
gene model complete all boundaries checked 
35740 MFDNGVTIALLLIGVTLLVAEALKKRHRFPPGPKGLPIIGNL ex1
      LDVPKDYHWLTYTAWSRQF (1) 35558 ex1
35502 DSDIIHLEALGQHYFVISSVDVAKDIFEGRSQLYSDR (2) 35392 ex2
35262 TGWERNFAMMAYGDSWRRHRRLFHQHFRLQNVPAYHD ex3
      QIAKGARNLAQLLLQTPDKFGRHIR (2) 35079 ex3
35023 HVVGAVILDIMYGIEVAPDDDERMEHLERAVHIFMELGQAGGFL (1) 34892 ex4
34762 VKYLPTWFPGAAFKRQAMEWKPQVDAMYEISYNEVKDSM (0) 34646 ex 5
34580 QRDQAKPCITSALLTACWDDLDQSNMEETLIGVTGTGY (1) 34464 ex6
      AGSDT (0) ex7
34346 SVFALNAFVLAMMLFPDVQRKAQEELDRVVGRERLPSADDRDSLPYISAVIKELLR (2) 34182 ex 8
      WHPITPT (1) ex9
34061 AAPHKSIADDYYNGYFIPAGSIVIGNTW (2) 33978 ex10
33923 AMLHNEERYPDPEAFKPERFLTPEGTLDPHVPDPAEGFGFGRRICPGRHFAQASLFLNI 33747 ex11
33746 SNVLATCMIEKPVDEFGNVVEPTRECTSRFFW (2)  ex11
33602 ALKPFEAKITPRFEGVENLVQTMSTYTN* 33513 ex12

>Scaffold_252f 6 P450s on this sequence this seq runs off end of scaffold
gene model complete all boundaries checked
37365 QVAVQDELDMVLGRKHLPSIEDRDSLPRVTAMLHEVLR (2) 37252 ex 8
      WHPVGPM (1) ex9
37123 GVPHRLTVDDEYRGYHIPAGTIVMINAW (2) 37040 ex10
36990 AILHDESVYPEPDIFRPERYLDSDGRLRTDMPYPVEGFGAGRRLCPGRHFAHDMLWLAI 36814
36813 AHVLTVFRIERAVDEDGREIVPEAKFEPWLI (2) 36721 ex11
      SPPEPFQCQTKLRFPEAEGLVHLAAMDE* ex12

>Scaffold_169a 6 different P450s gene model complete all boundaries checked 
14401 MDIPVPYAFIVVGALVLFFRLRKKPRFPPGPKGLPIVGNALDLPKA (1) exon 1
      RE*LTYAKWSREC (1) ALTERNATIVE EXTENSION OF EXON 1 ALLOWING A STOP CODON
      THIS MATCHES BETTER WITH OTHER SEQUENCES (POSSIBLE SEQ ERROR)
14162 RSDIIHLRFFGTHVFVLNSVKVVNELMVKRSAIYSD (2) 14052 exon 2
13928 SRTGWQRNFTFVDLGDHWKARARMFQQNLGTSTISK ex3
      HRPKLIEGNRKLLLNLLLSPDDFMKHIR (2) 13740 ex3
13689 YLSGSSILGIIYGIEVQQDHDPFVETAEKALQCLAAVINAGSYA (1) 13561 ex4
13439 VRFLPTWAPGAQFKRDAAEWYKYVTALIDGPYTYVKESL (0) 13323 ex5
      ANGENNTSIVGTLLQELSDDEKRSEQEDTIREAFGTAYT (1) ex6
      GGVDT (0) ex7
13033 TYSSVNSFILAMLKYPDVQRKAQEELDRVIGRDRLPSFDDRDALPYITAIVKETLR (2) 12869 ex 8
      WGLVAPL (1) ex9
12736 AAPHQLRVDDEYEGYFLPAGSVIIGNAW (2) 12653 ex10
12603 AILNDEKRYPHPESFIPERYLTTDGTLDSSAPDPMEACFGFGRRMCLGRYFAFDSLWIAV 12424
12423 ASLAAAFHMEKAVDESGLVIEPSGEYT (2) 12343 ex11
12271 YPLPFKAVFRPRHEGVVALIKADVSESDSL* 12179 ex12

>Scaffold_169b 6 different P450s gene model complete all boundaries checked
26938 MFSALVLSLLLAAALFLRFRRKRYPLPPGPKGLPIIGNARDIPKSFPWYTYDRWSREY (1) exon 1
26705 NSEIIYLRLVGTDVIVINSEKAANELLNKRSTIYSD (2) 26598 exon 2
26446 SVGWGGRNFAFAHYGDLWRAHRRLFHQYFHPGAVPAYHAKS EX3
      TLEVRRLLPRLLSHPDDFMQSIR (2) 26273 ex3
26219 TMTGAIILGITFGMELQPENDPFVALAEEALHAMAQVGNVGSYI (1) 26088 ex4
25957 VQYLPSWAPGAAFKRQAAKWNKIVLEMYEKPFQTIKQAL (0) 25841 ex5
25782 ARGEAPPSILTSMLETLDPEEDNAARESDMRHVTGTAYT (1) ex6
      AGADT (0)
25547 TVSSLGTFILAMLLHPEVQRRAQEEIDRVVGSDRFPEYDDRDSLPYITAIMKETLR (2) 25383 ex 7
      WRQVTPL (1)
25257 AVPHRLRVDDEYNGYHLPAGSVVVGNSW (2) 25171 ex9
25117 AMLHDEERYPNSDLFDPTRFLTPDGELDPDAPGPELAAFGFGRRICPGRYFAMDSMWIAM 24938
24937 AHILATVNIEKAVDDAGNILEPSGEYT (2) 24845 ex10
24786 YPVPFKVAFKPRSAAADALIQGGTPLA* 24703 ex11

>Scaffold_169c 6 different P450s pseudogene gene model complete all boundaries checked
28974 MSGHAVYVLATATRCNHGGSTEPSSPSYSS ex1
      GPPGLPLTGNLLELPMRLGWLAFTEWSRKH (phase 1 GT missing) 29153 ex1
      GSDIIQLEVFEKHVLVISSLHTVWELWAHPYTAHG (phase 2 GT missing) 29312 ex2

>Scaffold_169d 6 different P450s defective GT bound on ex3
gene model complete all boundaries checked
29901 MGWTLCLYALLGLTGLWV
29958 ARVRRPRQRYPPGPTGLPVLGNVFDVPLENGWLVFDQWARQY (1) 30083 ex1
30155 DSDVVHAEALGRHIYVVNSAKAARELFDGRPHVYSD (2) 30262 ex2
30408 KSGWWRSWVMLPYGDYWKEHRRLFHQHFRPQSLPQY ex3
      HEKQAKAARRLVRLLLDSPQDYAKHIR (no GT here in stop codon) 30581 ex3
      YATGSSILNVVYSFDAQPGDPRLELVEAAMGTANELMHTGVYL (1) ex4
30890 VKHLPMWFPGAHFKRQAARYKRLVDDMFEIPYAQLKSSM (0) 31006 ex5
31067 QEGTIEPCFAAALLSEAEDSASPERDDMFMNLAGTAYA (1) 31177 ex6
      AGTDT (0) ex7
31315 IMMTLLTFILAMVLHPEEQAAVQEEIDRVVGRDRLPGLADRESLPRVTAVIQEVLR (2) 31479 ex8
      WHPPLPL (1) ex9
31595 ATPHRAASDDEYNGYHIPAGALVLGNCW (2) 31678 ex10
31735 AMLHDARVYPDPDVFRPGRFLAAGGDAPRADVPLPAEAFGFGRRICPGRHFALDSLFLF 31911 ex11
31912 AHLLAAFRIEHAVDAEGNVVPVVAAFEPQA (2)  ex11
      PPKPFKARFTLRYCGAENLVRGGVRAG* ex12

>Scaffold_169e 6 different P450s
gene model complete all boundaries checked
36710 MALLVYFCAGLVPVLLLVLGLRKRPRYPPGPRGVPIFGNI ex1
      FDVPMKYAWLEYVKYGQQY (1) 36534 ex1
36476 KSDIVHFQVLGQHIVVLNSLQAVGDLLDKQSSIYSD (2) 36369 ex2
36225 RTGWSRSWVQMEYGDQWRMHRRLMHQHFRSTMIPQ ex 3
      YHPKQTKAVRRLIQSLLEQPEHFMEHVH (2) 36046 ex3
35992 FLSGSLILDVVFSFDVRPGDAILALAERAVDTTKAIIAAGVWL (1) 35861 ex4
35733 VKYIPSWFPGAGFKRIAAKWKTDVNKMFDVPYAKFKDSM (0) 35617 ex5
35558 REGSATPCFASALLSGAEDDNGGVIDNQDEVFISLTGTAYV (1) 35439 ex6
      AGSDT (0) ex7
35306 LSDALSTFLLAMIAFPEKQRAAHEALDCVLERKRLPGVEDRDALPHITALAYEVLR (2) 35145 ex8
      WHPVVPL (1) ex9
35015 SIPHRTTADSYYKGYYIPAGSTIFPNSW (2) 34929 ex10
34882 AILHDEALYPEPHLFRPERFLNEDGSLHAHARDPIEAFGYGRRICPGRHFAHDALWLAI 34706 ex11
34705 AHILAVFKIERALDVDGNEIEPKLDFMPHFLS (2) ex11
      MPKPFKCRFTPRFPDAANLALSASSDY* ex12

>Scaffold_169f 6 different P450s gene model complete all boundaries checked
      MAVLLAAGYY
39658 ILSVAVFILLYNASRRRQRLPPGPKGLPLIGNLFDVPNDYAWLRYKELGQQY (1) 39503 exon 1
39451 GSDIVHMQALGNHILVLNSMKAAVEILDKRADISSD (2) 39341 exon 2
39206 SSGLGRAWTQLGHNDSWRIHRRLFHQHFRPSAISQYHTKQT ex3
      KAIHRMLSFLRESPAQYMDHIR (2) 39024 ex3
38973 FMAGSMILDVVYTLDVQPGDYRIKLAEMVAHVSTEVFTAGVWM (1) 38842 ex4
38718 VRHLPTWFPGAGFKIQAAKWKTTVDRSYDIPYEQFKASM (0) 38602 ex5
38540 HEGGGEPCLASALLSSAEDVEELERMDKVFSSLTGTAYI (1) 38427 ex6
      AGTDT (0) ex7
38316 TVSTLASFVLAMTIFPEAQLAAQAEIDRVLGGTRLPDINDKANLPQVTAILYETLR (2) 38152 ex 8
      WNPVLPL (1) ex9
38034 ALPHRTTADTSYDGYYIPAGTVVLGNSW (2) 37948 ex10
37900 AILQDETLFPEPQLFKPERYLNGDGSLNSSAHYPIETFGFGRRICPGRYFAQDAVWLAI 37724
37723 AHILAVFKIERARDGDGKEIVPTPD (2)  ex11
      MPKPFECKFKVRSPQAESLIESAALGG* ex12

>Scaffold_205a 13 different P450s on this sequence 59% to scaffold 4
gene model complete all boundaries checked
7562 MELPAHTKYLLACLAFAIFVLLHSKRRRPRYPPGQRGLPLVGNLWDIPTEYAWVKYREIGAQL (1) 7735 ex1
7804 GSDIIHFEVLGSHYVVLNSDKAVKEVLEKRSHNSSD (2) 7914 ex2
8041 RTGWHRNWALLEYGDYWKDLRRIFSQYFRPSAVPQYHSKQTKAVRRFLNLLLNSPDDFTKHIR (2) 8229 ex3
     YLAASAILDVVYGFDVRPGDPRIELVERGVHTLTDISAGVYL (1) 8407 ex4
8527 VKYIPAWFPGASFKRKAAGWKVLVDAVYEVPYSQYKDAM (0) 8643 ex 5
8707 REGTAKPCFAGTLLSEANPDGDLDETFRCLTGTAYV (1) 8811 ex6
     GGADT (0)
8935 VSSTLLTFMLAVTMFPETQDPAHEELDRVLGRKRLPDIRDRDDLPYITAMLHEVLR (2) 9096 ex7
     WHPVAPL (1)
9227 ALPHRLTADDEYEGYHIPAGAVVFGNAW (2) 9310 ex9
9369 AILHDPATYGDPDVYAPARYLTADGRALRADVPYPLEGFGFGRRVCPGRPFAHDILWLA 9545
9546 LAHVLAVFRVGRARDAHECEVPPRGVFTPGLI (2) 9641 ex10
     SVPEPFGCRFVPRFPGAEELIRQSAMPE* ex11

>Scaffold_205b 13 different P450s on this sequence
defective GT boundary on ex10
gene model complete all boundaries checked
      MEDTSRSLVGPSLWAVFALGL
10923 LFAFCLRRQPRYPPGPRGLPIVGNVFDIPMNVGWKVFRDVSRCF (1) 11054 ex1
11111 ESDVIHYEALGSHLVVVNGAKAAKELFERRANNYSD (2) 11218 ex2
11354 STGWHRNWGQLEYGDRWRQHRRLFHQHFRPMAVSQYHPRQVKGVRVLLRALSESPEDFQRHIR (2) 11536 ex3
11593 FMAGATIMEIVYAYDAQPGDPRIKLVEDAVDTLTFVVNAGVYL (1) 11724 ex4
11847 VKYVPNWFPGASFKRQAAEWKKLVDALYEQPYQEFKATV (0) 11954 ex5
12023 KEGNAKPCFAATLLSSVENDEDIENLEELFMGLTGTAFV (1) 12136 ex6
      AGSDTV (0) ex7
12260 TIASLNVFILAVTIFPEAQRSAQEEIDRVLERKRLPTMEDKVLLPHVTALVHETLR (2) 12424 ex 8
      WHPPLPL (1) ex9
12547 AAPHRVIEDDEYEGYFIPAGTTIIGNAW (MISSING PHASE 2 GT)  12633 ex10
12682 AILRDEDLFPDGDSFKPERWLNEAGALRDDLPYPMETFGFGRRICPGRHFANDVLWLAI 12858 ex11
12859 ANILTVFSIERALGEDGQPIVPEAKFSPRLI (2) 12951 ex11
13015 SKPEPFKCAFKHRFSGAEDMIRLAAIVEE* 13098 ex12

>Scaffold_205c 13 different P450s on this sequence 
exon 11 extended by 10 amino acids (lower case ) due to missing GT boundary at the 
expected site
gene model complete all boundaries checked
      MESLTLRNCASAFLAG
14073 LLVLACGLVLRPRRRPRYPPGPKGLPLVGNMLDIPTEYAWERYYELGKEY (1) 14222 ex1
14277 GSDVLFFRVLGSHFLVLNSAAAANELLEKRANVYSD (2) 14387 ex2
14522 RTGWDQNWAFWEYGEGWKQARKMFHQHFRPSAAPQYHLKQ ex3
      TKAARRFVKLLLESPASFAQHAR (2) 14704 ex3
14752 FLAGSAILDAVYAFDVQADDPRIALVERGVHTLVEISRGVFL (1) ex4
15004 VKYIPSWFPGAGFKRQAAQWKDAVDATYSDPYRQFKTLL (0) 15111 ex 5
15177 RNGQAEPCVAASLLSSSGDEPSGALDDLLKSVAGTAYV (1) 15287 ex6
      GGSDT (0)
15410 VSATLTTFILAMTMFPDAQAAAHAQLDEVLKRTRLPEMADRAALPYITAILYEVLR (2) 15571 ex7
      WQPAGPL (1)
15698 GLPRRLMADDEYRGWHIPAGTVVLPNIW (2) 15778 ex9
15843 AMSHDPGTHAVPAQFVPARYLAADGTLREDVPCPADVFGFGRRVCPGRPFAQDVLWLAI 16019
16020 AHVLSVFRMEGPMGERGEIRHSRLFTPGLIrrvgrplerg (2) 16109 ex10
16168 RLPEPFACSFRPRFPGAENLVDAGVVG*  ex11

>Scaffold_205d 13 different P450s on this sequence
gene model complete all boundaries checked
      MELPPVPHPLIAYLCAGLLLAGLVVTRL
17227 RRRRHYPPGPKGLPLIGNLFDIPTDYAWKIYRAFGDQY (1) 17340 ex1
17399 GSDIIHFEIFGTHLVILNSAKAARDLFEKRSSIYSD (2) 17509 ex2
17641 RTRWGRSFGFMQHGDEWREHRRLFNMHFRPSAIAQYHAK ex3
      QKSAVCTLLRSLLDAPEQFREHVH (2) 17826 ex3
17889 FMAGDVIMGIVYGFDVQPGDSRLQLVEKAVMTLNQIVNAGVYL (1) 18020 ex4
18140 VKYIPAWFPGAGFKRHAAEWKKLVDDMFEIPYRESMKSL (0) 18235 ex 5
18312 QEGKCESSFAASLLAQLEGQESPDNIERIAMDVLGTTYV (1) 18431 ex6
      AGSDT (0) ex7
18545 IITATSTFLLAMILHPEVQITVQAELDALLEGARLPNISDKAALPSVTAVLQEVLR (2) 18712 ex 8
      WNPGLPL (1) ex9
18841 VPHRVVADDEYKGYHIPAGAAVIGNTW (2) 18921 ex10
18984 AMLHDETTYPDPEPFKPQRFLNEDGTLNADVPYPTDVFGHGRRMCPGRHFAHDMLWLTI 19160 ex11
19161 ASILTVYKVERDVDEDGQEITPTASFTS (2) 19244 ex11
19304 RVPTPFRCRFTPRSASAESLIRSSGVSTE* 19393 ex12

>Scaffold_205e 13 different P450s on this sequence 
gene model complete all boundaries checked
      MEQSTLHILPYLCASIPVLVCL
20067 LVLRLRRPHYPPGPKGLPLVGNLFDVPLSHGWVAYRELAKQY (1) 20192 ex1
20254 GSDVIHLEILGSHIVIINSAKAARDLFDKRSNIYSD (2) 20364 ex2
20499 NTGWHRNWGFMAYGDYWRKHRRLFHRHFRPAAVPQYHSAQAKGVHNLLKLLMRSPERFREHIR (2) 20681 ex3
20733 FMAGSTILDVVYALDVQPGDSRIELVERAVHTSTEIVAAGVYL (1) 20864 ex4
20981 VKHIPSWVPGAAFHRKAAAWKALVDRMYEEPYNQFKASM (0) 21097 ex5
21154 KDGNAKACLTASLLMEAESTHQLDAIEDILISVTGTAYG (1)  21273 ex6
      AGTDT (0)
21398 AVASLNTFMLGITMFPHTQLAAQDELDRITARQRLPTMEDRENLPHVTAILQEVLR (2) 21565 ex 8
      WNPAAPL (1)
21695 GLPHRTVRSDEYNGYFIPQGATIIGNSW (2) 21778 ex10
21829 AMLHDEAIYPDPGSFKPERFLTEDSTLRSDVPYPIEAFGFGRRICPGRYFAHDLLWLTI 22005 ex11
22006 AGILAVFRIERARDEQGDEIVPAGDFSR (2) 22086 ex11
22147 SPEPFQCRIVPRFAGAEALIHGTGLLG* 22233 ex12

>Scaffold_205f 13 different P450s on this sequence 
GT boundary on exon 1 missing GGT = GGC gene model complete all boundaries checked
      MEWSLSLGYALLGLGIMW
22749 VVKYAQRPRRRYPPGPKGIPILGNVFNIPLENSWISFDQWSRQY (Phase 1 GT missing) 22880 ex1
22942 ASDIVHVEALGKHVYVVNSARAAKELFDGRANVYSD (2) 23049 ex2
23188 KCGWSRSWAMLPYGNYWREHHRLFHQHFRPQSMVRYHEKQRRGARRLLQLLLDTPEDYEKHMR (2) 23370 ex3
23422 YAAGSTILDVVYSFDVQPNDPRIELVEAALGTANDLMHAGIYL (1) 23553 ex4
23678 VKHIPTWFPGAQFKRLAAKYKRLVDNMYTVPYSQLKASV (0) 23785 ex5
23848 KLGTAQPCLVASLLSEADEHVTPERDEIFMNLAGTTYA (1) 23964 ex6
      GGTDT (0) ex7
24083 IVIALSIFILAMILHPEQQVAVQKEIDRVVGRDRLPELADRESLPRVTAVIQEVLR (2) 24261 ex 8
      WHSPLPL (1) ex9
24382 ATPHRATSDDEYNGYYIKAGSVVIGNAW (2) 24465 ex 10
24518 AMLHNENVYPDPASFKSERFLTPDGKLRDDVPFPIEAFGFGRRICPGRHFALDSLFLLV 24694 ex11
24695 SHILAVFTIEHAVDADGHIIPVEPEFEPQAFRWA (2) 24775 ex11
      PPKPFKAQFKLRFLAAEDLIHGSALE* ex12

>Scaffold_205g 13 different P450s on this sequence 
GT BOUNDARY MISSING ON ex6 GGT = GGC
gene model complete all boundaries checked
27389 MLTALSCVFAEALAVWAVSSWTRPRHEYPPGPKGLPFLGNMFDIPMKYGWVTFANWSRLY (1) 27226 ex1
27153 GSDIVHVQALGKHIYVINSAKVAKDLFDGRPHIYSD (2) 27043 ex2
26911 NSGWKRAWALSPYDDEWREYRKLFHQHFRPSAVQQYHHKQTKAVRRLLQLLLDTPEDFLAHLR (2) 26723 ex3
26667 YAAGSSLLDVVYSVDALPGDLRITLVEKAVHTFAKLLETGVYL (1) 26536 ex4
26416 VKHIPAWFPGADFKRQAAEYRQLVDDMFKVPYQQFKDAW (0) 26315 ex5
26239 RRGTAQPCFAASLLTDADPLDGSEHEELFINLTGTTYA (phase 1 GT missing) 26123 ex6
      AGSDT (0)
25997 TVAAMSTFMLAMALHPEVQRWVQEELDRVVGRGRLPEMADQPALLRVMATVHEVLR (2) 25812 ex7
      WHPPLPL (1)
25694 ATPHRAMADDVYAGFTIPAGSIVLGNSW (2) 25611 ex9
25556 AILHDDKTYTNPHTFDPRRFVGPNAQPFPEVVFGHGRRECPGRHFALDILFLAV 25395
25394 AHVLSVFAIERVDNSDPGIGDIQGLFTPHVL (2) 25344 ex10
25247 SYPKPFKASFKPRFPGVESLVRTAALSEI* 25158 ex11

>Scaffold_205h 13 different P450s on this sequence 65% to 205a
gene model complete all boundaries checked
      MSRFLYDYST
30650 LLYLCAGITFVVLITLSSRPRRRYPPGPKGLPIVGNLFDVPTDHGWKRYQEIGKEY (1) 30483 ex1
30419 GSDIVHFQVFGSHIVVVNTAKAARELLDKRSNIYSD (2) 30309 ex2
30181 KTGWHRNFSLMPYGEGWRTRRRLFHQHFRPMAVPQYHTRQLKAVHGLVQSLFEAPQNYKEHIR (2) 29993 ex3
29936 FMAGSAILDIIFAFDIQPGDPRIEIVEKGVQTATEFMCSGVYL (1) ex4
29691 VKYLPSWFPGAGFKRQAAKWKALVDDMHEIPYYQFKQTM (0) 29575 ex5
29520 REGKAKPCFASTLLSSAAENDKDSLESLDEIFMSLTGTAYV (1) 29395 ex6
      AGSDT (0) ex7
29280 TISALNTFVLAMTMFPETQAAAQEELDRVLGRKRLPDFDDRDSMPYLTAMVYELLR (2) 29110 ex8
      WHSVLPL (1) ex9
28990 GLPHRTLADDEYNGYFIPAGTVIVGNCW (2) 28904 ex 10
28853 GMLHDDDLFPDPDIFRPERFLNADGTLNSDAHFPIETFGFGRRICPGRYFAQDLLWLTIA 28674 ex11
28673 NVLAACSIERVVDEKGFEVRPTGDMTPRVL (2) 28584 ex11
28524 SMPEPFECNIRPRFSGAEALVRSACLND* 28438 ex12

>Scaffold_205i 13 different P450s on this sequence
gene model complete all boundaries checked
34928 MEALASRITVYLCAGVVLVYVFSRVFKRRPHYPPGPRGLPIIGNLLDVPSLYGWIAYKNLGDQC (1) 34755 ex1
34674 GSDIVHLEVLGSHYVVLNSAKAARDLLDKRSNNYSD (2) 34564 ex2
34440 RTGLERGLGMLPYGDYWRLHRRLTQQHFRAAAVPQYHARQAKVVRKLLHSLLDSPERFMDHIR (2) 34252 ex3
      FMAGAIILDIVYALDVHPGDHMIEVVETAMGRINEIINAGVFL (1) 34073 ex4
33951 VKYLPSWFPGAGFKRRAAAWKVDIAPMFEAPYERFKQSL (0) 33835 ex5
33778 GGTTRPSFAGNLLSRVQNEEELSQLEDVFMNITGTAYG (1) 33662 ex6
      AGSDT (0)
33543 TLATLTGFVLAMTIFPEKQLAAHAELDKVLERKRLPEVEDMQYLPSITALVYEVLR (2) 33373 ex7
      WNPAAPL (1)
33241 GIPHQTIVDDEYNGYFIPAGTVVIGNAW (2) 33155 ex9
33111 AMLRDPNTYPDPDTFKPERFLAKDGSLRDDVPYPTEAFGHGRRICV 32974
32973 GRHFAQDVLWIAIAHILTVFRIERAVDEDGREIVPVPDYTPHFV (2) 32854 ex10
32788 TMPKPFKCRFTPRFPGAEGLIRSAADASNE* 32696 ex11

>Scaffold_205j 13 different P450s on this sequence 55% to 205b
gene model complete all boundaries checked
      MLDRSVLLPCLVG 
36862 IVAAIIIVSRRGRERYRFPPGPKPLPLIGNLLDAPTDLGWYTYAKWARQY (1) 37011 ex1
37076 HSDIIHFEVFGQHFYILNSVRVAKDLLERRSQVYAD (2) 37180 ex2
37320 RTGWHRVFSMKAYGESWRQQRRLFHQHFRQQAIPEYHAELTNGARMLLRSFLESPNHFLEHIR (2) 37508 ex3
      HISGGTILAVLYGIDVDNYSAERMESIEKAIEIVTEIADGGVYL (1) 37692 ex4
37811 VKYLPTWFPGAGFKRRAAEWRVHVETMFEAPYGDVKRDM (0) 37927 ex5
37985 KLGKAKPCVATKLMSAFGDKAEDPEIEELLICVTGTAY (1) 38098 ex6
      AASDT (0)
38216 IVFAMIAFVRAMMVFPEVQCKAQQELDRVVGRDRLPVISDQASLPYLAAVTKELLR 38383 ex 7
      WHPITPI (1) 
38513 AVPHKSTTDDWYDGYYVAAGSIVIANVW (2) 38599 ex9
38655 AMFRDEERYPDPEAFRPERFLTAEGTLDPAVPDPVEVFGFGRRMCAGRHYVDAALFLAI 38831
38832 AHVLHALTIEKPRDARIPVVDPPPGYALSRL (2) 38924 ex10
39002 APEPFEADIKPRFEGVERLMQMSSLHSF* 39088 ex11

>Scaffold_205k 13 different P450s on this sequence gene model complete all boundaries 
checked
      MLSSTILVFSS
41551 VCTLAAIVAIVRRFGGKRRHHFPPGPKGLPIVGNLFDVPTNFGWYTFAKWAQQY (1) 41390 ex1
41324 NSDIIHFEVLGKHFYVLHSAALAKELFERRSQTYSD (2) 41217 ex2
41068 RTGWHRVLTLTPYGEYWRQYRRLFHEHFRAQVIPQYEDKMLTSARNLLRLLLETPDRFLRHIR (2) 40880 ex3
40828 HASGRTMLDIVYALDTEAHNNAVILESVEKAIEIFAEVAEGGAYL (1) 40691 ex4
40579 VKYLPAWFPGASFKRQAAAWRVHVDTMYEAPYQDVNRRL (0) 40463 ex 5
      LAGKAKPCITTSLISAFSDKCEDPDVEESLISFAGTTY (1) 
      AGSDT (0) 
40175 SVFKMTIFMRAMLLFPEVQVKAQEELDRVVGRDRLPELADKDSLPYISALYKELLR (2) 40008 ex7
      WHPLFPL (1)
39869 AFPHKSTVDDWLDGYFIPAGSLIIGNAW (2) 39783 ex9
39734 ATLHDEERYPDPEAFRPERFLSDDGKLDPSVPDPVEAFGYGRRICPGRHYADASLFLYI 39558
39557 AHILFAFTIRKPLDERGNVIEPPPG (2) 39492 ex10
39394 VPEPFKASIKPRFEGVEELIQLSTQLATSD* 39302 ex11

>Scaffold_205L 13 different P450s on this sequence 
region between 41600 and 44300 searched for P450 exons and this was the only one.
Pseudogene fragment, lone exon gene model complete
42834 RFLMAERALRTDVTFPIEVFGYSRRICLGRQFAKDVLFLAISNILAIFTIEKAVDEHSGSIEVQNAFLPHAIRCA 
42610 ex10

>Scaffold_205m 13 different P450s on this sequence gene runs off end of scaffold
frameshift in exon 2 gene model complete all boundaries checked
end of this scaffold matches end of scaffold 180 but this P450 sequence does not 
continue there
44302 MPDCTTIGYLLASVALAYALASRHPRSSRYPPGPRGLPLLGNLFDMPRKHSWTKHQELSKTY (1) 44487 ex1
      ESDVIHYQVLGLHIMALNSG (frame shift) EAVRDLLNKRSTIYSD (2) 44652 ex2 
44788 RTGWHRNWALMRYGDAWKERRRHFHEHFRPQAVSQYNFKQVKAARILLNSLLESPRAFSEHIR (2) 44976 ex3
45034 FMASSLILDIVYALDVRPDDPEARRVERALETLAEISASVFM (1) 45162 ex4
45291 VKYLPSWFPGAGSKRQASIWKNIVDEMFETAYQVCKNSA (0) 45389 ex5
45479 QHEYVRPCFTTALLSEVSDPANMKEMDEIFMSLAGTTYI (1) 45583 ex6
      GGSDT (0) 45650 ex 7
Scaffold 205 ends at 46031 

>Scaffold_223a N-term gene model complete all boundaries checked
sequence runs off end. Probably continues on scaffold 182
700 MALHPRQYRLRFLRDVLRAVVWPQLVLNTVLYAAGLRVGPVLRVLLSLLAVPLYGT 533
532 ARTLLAQQRNAAWAG (1) 488 ex1
416 PCVRGRWPGNVDVVLGFVRSLREDYLMQFLDDLFRAHGCRTLNMRLFWEDQ (0) 261 ex2
207 IWTIDEGHVRHMIAGAGVECFDKGYYWQERL (2) 115 ex3
58  ESFLGNGIFNRWAYMD (0) 11 ex4

>Scaffold_182 N-term exons 1 - 2 missing off the end of this seq. 
The missing part is probably on scaffold 223a
gene model complete all boundaries checked
76   QRAIARPWFAKDRISDLNIFDRHTSTTLALIADFADRREAFDAQDLFARFTLDSASEFLFG 258
259  KCAETLHGTLPVAGRAKLGPKGSSVEDEFGSFAWAFE (0)
     ELFHDKTAKHRKVIQDWLQPIVREALHSKAAAARGEDTGE 609
     GTFLSHLTKTTD (1) 645
702  DPQDIAYSILNMLLAGRDT (0) 758
808  TAAALSFTVYLLALHPEVVEKLRAEVVQAYGSDGRPSVEDMKSLKY (1) 969
997  LRAVLNETMRLFPPVPLNIRTSDDTPRVFPASAGAPKYYVPPRTPVVYSSVIIQR 1161
1162 RKDLWGADALDFRPERWLEPETARRLAENPFMFMPFHAGPRL (0) 1287
1338 CLGQNFAYNEMSFFVVRLLQRVAALELAPDAQPEGSLPPARWKNGEGRQAVEKIWPGSSV 1517
1518 TTYIKVSSTRSRPCG*

>Scaffold_223b 603 amino acids gene model complete all boundaries checked
8694  MELHPRQYRLRFLLDVLRAIVWPQLVFNAALYLAGFHPGAFLRVVASV 8837
8838  LAVPLLGTVRTAISQRRNKIQAG (1) ex1
      AALGAKEVPCVRGKWPGNLDIVLGFVRSLKEAYLMQFLDDLFREYDCKTLNMRLLWEDQ (0) ex2
      IWTIDEAHVRYMLAGPGFEWFHKGYYWQERM (2) 9282 ex3
      ESFLGNGIFNRWA (2) ex4a possible error here see 223a above
      YTI (0) ex4b required to maintain phase at joints might be false
9493  QRAIARPWFVKDRISDLNIFDRHTTTTLALISEFVDRREAFDAQDLFARFTLDSASEFLFG 9675
9676  RCLDTLHGTLPVAGRAKMGPKGTAIEDAFGSFARAFE (0) ex5
9850  DVQVQIARRTRIGKPWPLFELFTDKTAPSVAVIHDWLRPIVHEALAKKSAASAEKESGED 10029
10030 STFLSHLANSTD (1) 10065 ex6
10124 DPQDIAYSVLNMLLAGRDT (0) ex7
10227 TASVLSFVVYFLALHPHVTEKLRAEILQAYGPDGRPSVEDMKDLKY (1) ex8
10419 VRAVLNETMRLFPPVPMNLRLSDAHPRIFPASGSAPKYYVAPRTVILYSIFLVQR 10583
10584 RTDLWGADALEFRPERWLEPATARLLADHPFAFTPFHAGPRL (0) 10709 ex9
10771 CLGQNFAYNEMTFFIVRLLQRVSGFELAPDAQ 10866
10867 PEGSLPPARWKYGEGRQAVEKIWPASSVTTFIKVSLA 10977
10978 SMPCCGERWLKRRRQGGLWVRAVPA* 11055 ex10 

>Scaffold_74 gene model complete all boundaries checked
60930 MPHPFSRYRLRVFGDFVR 60983
60984 IVLAPSFVFWSAVQILKLRLGLLSPAAWLTFLFAASYARVQYRGFLQRQEARRRG 61148
61149 GVLPPEVVGRWPGNIDILIKLGKASLTAYPGSFYLDLFEEYQSTTLNLKLLWSDLVRCLS 61328
61329 FCRLSAVLKTLSQIITMDEEHIKHILTTGFNHFWRGRRQKERM (2) 61457 ex1
61557 YAPSGASRRHDTDSQGDVSQEWKK (0) 61628 ex2 
61691 HRALARPFFARDRISDFDLFEKYAGATLGILGGLAGRGAAVDVQDLYARFTLDAAAEFLFG 61873
61874 ERLDTLHGALPVAGQAKLGSKGAATDDAFGAFVRAFEASQDIITTRQVRGYFWPVREL 62047
62048 FQDKVAPHAAVIGAFLEPIVQRTLDRKAKMRAAGVSPTTEHDTFLDYLADHTE (1) 62224 ex3 
62264 DPKVIRDQLLNILMAGRDTTACLLTYVTYVMAMYPDIMQKMRQEVLHV 62407
62408 CGHDAPNFEKLKALRY (1) 62455 ex4
62512 VHAVLNETLRVFPPVPMNVREVRARGVVLPHADPTYAAAPAPLYVPGGTVVMYLPVLTQRNT 62697
62698 ALWGDDADVFDPDRWLDARLRRFTENPMMYTPFSGGPRI (0) 62814 ex5
62879 CIGQNYARNEATYLLVRLLQQFDAVALAPEAQ 62974
62975 PAGSLPPPEWRHARGRAAEERIWPAYAITLYVKVRLSLQWLYC* 63106 ex6

>Scaffold_232 42% to scaffold 7 gene model complete all boundaries checked
22610 MALPPGLQYLLPQLPLLLAPPAAVLLAAHAARAFAGTAAPAWALALACVLSWPVALTALV 22789
22790 QLRAHRVAREAAARGARLPPAVEARYPGGVDLMRRNNSEVEEHIP (1) 22891
      GYRLSEFGRQYGWTYNFRMLFQDRVRGRPRPRPPG (0) 
23199 RILATDFTSYEKGAVFSAQMKSLLGTGVFNADGDLWK (2) 23318 two introns missing
23351 FHRAMTRPFFSRDRISHFDVFDR (2) 23437
      HAEDALKLAKARLSEGVPIDWQ (0)
      DLVSRFTLDSATEFLFGQDVRSLSAPLPHPPTAPQA
      QHDTHDAEHPANRFAHAFLQAQLASARRSRYTAAWPLWEFWE
      NKVEKHTRVMDEFIQPLLRDALARKAKGADAQAEEAVADGETLLEHLVKLTD (1)
      DPQIIHDETLNILLAGRDT (0)
      TAITLTMAGYMLAEHPDILQRLRKEILDTVGTRRPTYDDIRDMKYLRAFINEVLRMYPPV (2)
      PFNVRFSTAPTVWPSPEGDFYVPAGTRCMYSVFVMHRRKDLWGPD (1)
      ADKFDPDRFLDERLGKYLTPNPFIFLPFNAGPRICLGQQ (0)
      FAYNETSFMLIRLLQRVSKIELHPEVSPQSVAPPGWAASSISD
      GKDKVVFKSHLTMYVQGGLWVTMQFENPEEH* 25024

>Scaffold_293a 98% to CYP63A1 SUBMITTED SEQUENCE PROBABLY SAME GENE
100% IDENTICAL TO AF005475 FROM BEGINNING OF EXON 9 (TAGT)
gene model complete all boundaries checked
27142 MGLTQAQRLVLGQLARLVAPALAVCVLLAAARRTQLVRAPVWADALIALIAIPLFHVGRA 27321 
27322 HWRYARLARKAARLGAALPPRWEGKLPGSVDVLQLVDEAYRHGFLS (1) 27459 
27508 DYFYEKFGELGHTYNFYVLWDMDYCTEDAAVIK (0) 27607
27658 AVLATDFNNWVK (1) 27693
27747 GERFDSYMHSVLGTGVFNAD 27809 (1)
27860 GELWK (2) 27874
27923 FHRSMTRPFFARERITDFETFNRHAEEAILKMKERLREGFAVDFA 28057 (0)
28110 DLISRFTLDAATEFLFGACVHSLAGALPYPHGAPAHLHTTRARIPADDFAAAFRAAQDAV 28289
28290 SHRARLVWLWPWFELARSRTDAPMRTVDRYLTPIIERALAMSRAAKQAPQGEKEEVADGE 28469
28470 TLLDHLARYTT (1) 28502 
28555 DPTILHDEILNIMIAGRDT (0) 28611
28663 TAGTLTFVVYFLTQHPNVLQRLRQ 28734
28735 EILDVVGPSNLPTYDDIKQMKYLRAVLN (1) 28818 no GT boundary here GC instead
28868 ETLRLYPPV (2) 28893 
28953 PWNMR (2) 28967
29022 YAVKDGILPNSEPDGKPWFIPAGAS (2) 29096 
29151 VSYSVHCMHRRKDYWGPD (1) 29203
29250 AEEFDPDRFLDERLHKYLTPNPFIFLPFNAGPRICLGQQFAYNEMSFFLVK 29303
29304 LLQTFEDISFERDAFEPNALPPAEWAKFPGRKGKEKFWPRAHLTLYSE (0) 29552
29597 GGMWVKMREAQAMGPQVA* 29652

>Scaffold_293b Length = 30818 sequence runs off end continues on 301b
gene model complete all boundaries checked
29971 MLVSVDALALRTLVYELTYLLYPAVPTAAALVLLQRLGSVWLPTWTIVLLSLCSVPVAHRILVWL 30165
30166 KDWRAARKAASMGAILPPRLKGRWPGSIDLLRQLTKTFETGFLS (1) 30297
      ELLWDYMHVLGQTFEVYILWDSNYVTSDANVIK (0)
      TILATDFDNFVK (1)
30589 GEKLDVCVRPVLGTGVFNSD (1) 30648
      GEMWK (2)

>Scaffold_301b = 92% TO SCAFFOLD 301A 
100% IDENTICAL TO 63A2 EXCEPT AT ONE INTRON JOINT 
gene model complete all boundaries checked sequence runs off end
sequence appears to continue on 293b
      YFVK (1) PROBABLE FRAME SHIFT AT BEGINNING OF EXON 4
28695 XEKLDVCVRPVLGTGVFNSD (1)
      GEMWK (2) 
      FHRSMTRPFFTRERISHFDLFDRHA (1) 28444
28388 DATMAKMKARLAEGFAVDFQDLISRFTLDSATEFLFGQCVHSLASVLPYPHDAPAHLQ 28215
28214 TTGASRTEDFARAFAEAQDAVSFRLRMGWLWPWFELFGSRTKAPMAVVDAFLDPILRDAV 28035
28034 ARADKIKRENGGRVPEVKGEIEEDETLLDHLVKYTN (1) 27927
27871 DPKILHDEVLNIMIAGRDT (0)
      TGGTLTSAVYFLSQYPEVLRR 27695
27694 LRKEILEKVGPTRRPTYDDIREMKYLRAFIN (1) 27584
      ETLRLYPAV (2)
      PWNVR (2)
      YPVKDTTIPGPHPDKPYFIPANTP (2) 27319
      VSYSVHCMHRRTDYWGPDAEAFDPD
27193 RFLDARVQRYLTPNPFIFLPFNAGPRICLGQQFAYNEMSFFVIRLLQHFDEVQLCEDALA 27014
27013 PDCRVPDAWRGAPGRKGVERFWPKAHLTLYAK (0)
      GGLWVKMREASTSEAVV* 26810

>Scaffold_301a CYP63A3 
85% TO PC-2 CYP63A2 BUT ONLY 4 DIFFS FROM KILH ON 
gene model complete all boundaries checked
26344 MPSSIDFPDRLVLRVIAYELVFLFYPAVPAAAGLVLLRRLTDIWLPTWAIVLLSVCSLPVVHGLSIWR 26138
26137 NHWRAARKAARMGAVLPPRLKGRWPGSIDLLMRLTDAFETGFMS (1) 26006
25949 DLLWEYMHTIGQTFEVYVLWDSNYVTSDANVVK (0) 25851
25697 AILATDFTSFVK (1) 25662
25698 GKKFDVCMRSVLGTGVFNSD (1) 25639
      GDMWK (2)
      FHRTMTRPFFTRERISHFDLFDRHA (1) 25433 (EXTRA INTRON HERE)
25379 DDAMAKMKARFAEGYAVDFQ (MISSING INTRON HERE)
      DLISRFTLDSATEFLFGQCVHSLASVLPYPHNAPAHLQ 25206
25205 TTSASAAEDFARAFAEAQTVLNFRIRMGWLWPWFELFGSRTKAPMAVVDAFLDPILKAAV 25026
25025 ERADQIKHENGGKVPEAKEEIDEDETLLDHLVKYTN (1) 24918
24855 DPKILHDEVLNIMIAGRDT (0) 24805 
24748 TAGTLTSAVYFLSQYPEVLRRLREEILEKVGPTRRPTYDDIREMKYLRAFIN (1)
      ETLRLYPAV (2) 24515
      PWNVR (2)
24380 YPVKDTTIPGPEPDKPYFIPANTP (2) 24318
24258 VSYSVHCMHRRTDYWGPD (MISSING INTRON HERE)
      AEAFDPDRFLDARVQRYLTPNPFIFLPFNAGPRICLGQ 24091
24090 QFAYNEMSFFVIRLLQHFDEVQLCEDALAPDCRVPDAWRGAPGRKGVERFWAKAHLTLYAK (0) 23908
      GGLWVKMREAPTSEAV* 23800 

>Scaffold_115a GENE MODEL COMPLETE exon boundaries all checked
17359 MTPSHSFPDLVASCISAWTLCFALGFSIAAASFYSLFGPFN (0) 17237 ex1
17188 LHHIPTVGGSSIPLISHRGARKYMRDAKGVLQDGYK (0) 17084 ex2
17018 HKGKAFKVALTDRWLVVITGKRLVDELQKMPEDVASFVGAVAD (0) 16890 ex3
16837 FQGLRYIFGQKVLDDPFHVNIIRSHLTKHLSSVFGDICDEIYVAFSELIPQQDEE (1) 16673 ex4
16616 WVPVHAIQVVRTIVARASNRVFVGLPVC (1) 16533 ex5
16483 RNAGYLSLAVNFIVDVAKARDFIALFPPVLKPLAAKMTSDIGTRVQEGMQYLEPLINERL 16304 ex6,7
16303 RLMEKFGKDWTDKP (0) 16262 ex6,7
16206 NDTLQWMMDGIMERDGTIEQLVRIVLLENFSSIHSSSN (0) 16093 ex8
16037 TFTHALYHLAANPEYITPLREEVETAISEEGWTKAAMSRLRKVDSFLRESLRLNGINP (1) 15864 ex9
15807 VSMQRKALISFTFSD ex10
15762 GTYIPKGTILVTPALATHHDEDNYEDATTFKPFRFVGENPEDDVPLVTTSADFVPF 15595 ex10
15594 GHGRQA (2) 15577 ex10
15514 CPGRFFAAHQMKAMMAYLVLNYDVKFE 15434 ex11
15433 NEGVRPQNVHGVLSVQPDPKARVLCRRRKSSYT* 15332 ex11

>Scaffold_115b 48% to scaffold 297 GENE MODEL COMPLETE exon boundaries all checked
20897 MSLHQVYDAVVAHGDMGTLLVYMAYSVPLVMFLYSLFSPAS (0) 20775 ex1
20722 LRHIPTEGGPSFPLLSYKAARAYLRDATGILQRGYDK (0) 20612 ex2
20557 HKGKPFKVAMPDRWVVVLTGKKLVDELQRLPDDAVSFIKGASD (0) 20429 ex3
20374 LSGTEHMFGRQVIDDPFHVPIIRTHLTKNLAPMFSDVFDEVSIAFQELIPACDGE (1) 20216 ex4
20160 WVPVHAIKVARSVVARTSNRIFAGLPIC (1) 20077 ex5
20024 RHPEYLNLVINFTVDVAKGRYALLLFPPALKGIAAKILTNIDGRIKEGLKYLGPLIEQRM 19845 ex6,7
19844 ALAEKFGNDSSEKP (0) 19803 ex6,7
19746 DDMLQWIIDEVRARNQSVFEVVRTVLLVNFAAIHTSSN (0) 19633 ex8
19582 SFTHALYHLAANPEFIAPLREEIETIVSEEGWSKAAIGKMWKLDSFMRESQRYNGINS (1) 19409 ex9
19353 VSVKRKALKPLTLSDGTFIPKGTVLVTPTVATHFDDDNYKNPTVFDPFRY 19204 ex10 
19203 YREKEQDMSAVKHQFVTTSPDYVSFGHGKHA (2) 19111 ex10
19051 CPGRFFAANELKAMMAYVVVNYDVKFEK 18962 ex11
18961 EGVRPENIYAAMGISPDPNARVLFRKRESIVSV* 18860 ex11

>Scaffold_115c pseudogene fragment GENE MODEL COMPLETE exon boundaries all checked
46242 NDLLQWIMDEAVARDKS (frame shift) QEEIARMVLFLN (frame shift) FGAIQTTSC (0)  ex8
46591 VSMFPNILTPVTLSDGTFLPAGTTVVTPVLATHYNEDNYTNAALFDPF*SCKDNRS 46758 ex10
46759 GGQQFVRTSADCVTLGHGRML 46815 ex10 (phase 2 GT missing)
46882 CPGRFFAAAELKTLVAYVLVNYDLRPETEGVRPVNIYKGLTV*PSETAKVLFKKRQTDE* 47061 ex11

>Scaffold_115d GENE MODEL COMPLETE exon boundaries all checked exon 3 GT boundary 
wrong
47583 MVLTTDFGGISTTHVVIGAFVTWLLLRYFSAKN (0) 47681 
47736 LRHIPTVGGPSVPILSIVALYNFLANGKKVVLDGYQK (0) 47846 ex2
47898 YKGKAFKVALLDRWLVVLCNPKLVEELQKLPEALVGYSLLEAX (0) 47993 ex3 probable frame shift 
to GT
48098 IFETKHIFGADLLTDPVHLVLLRTLTRNLGQVFGDMYQEVETSFQELVPANEKE (1) 48241 ex4
48303 WLPVHASPIMRTIVTRAANRVFVGVPVC (1) 48386 ex 5
48441 RDEGYLHLMVHFAEDVNKAFGLYTVVPSFAQGFVARKAKAVMDDCIERCLGYTRPTIKDR 48620 ex6,7
48621 TTMMDSFGDNWADKP (0) 48665 ex6,7
48723 NDMIQWTIEETKARGQGEYDMARMLMFINSGAVETTSQ (0) 48833 ex8
48893 AVIHALYDISVRPELADELREEVERAIAEDGWTKDATNKMRKLDSFLRESQRINGPMI (1) 49066 ex9
49123 VSMFRLVREPVTLSD ex10
49168 GTFLPAGTTIASPTLGAHFDDSIYPNASTFDPLRFYKAEAAGQPQFVTTSPEYLTFGHGKHA (2) 49353 ex10
49408 CPGRFFAVNELKAILAYMLMHYDIKPEQDGVRP 49506 ex11
49507 ENKSMGLGVLPNPDAKVMFRKRHAG* 49584 ex11

>Scaffold_115e GENE MODEL COMPLETE exon boundaries all checked
50547 MSSMNAPALPATHIVAGAILVWLLVRTFGTQN (0) 50642 ex1
50697 LRHIPTEGGPSLPIISFLGLHAFLTRSREILEDGYQT (0) 50807 ex2
50857 HKGRAFKVALIDRWLVVLSGKKLVEELQKMPDDTVESATTE (0) 50979 ex3
51041 MFNMQHVFASNWHKDPVHSSLLRSLTRNLGVVFSDMFDELDTAFRECVPANAER (1) 51202 ex4
51255 WLPVQAHTTMASIVTRAANRIFVGLPVC (1) 51338 ex5
51397 RDAGYIHMMIHVAEDVSDAVRTLSMLPTFMKPFVARRATVIDQRIQQCLDYLRPAIADRM 51576 ex6,7
51577 SMLERFGKDWEEKP (0) 51618 ex6,7
51670 NDVLQWIIDEVTARNQGEDEVARIVLFINFGAIETTSF (0) 51780 ex8
51835 AVTHALYDIVSRPGLADVLREEVEAAVATEGWTKAATNKMRKLDSVLRESQRLNGPTT (1) 51996 ex9
52075 ASMFRRVLQPVTLSD ex10 52116
52117 GTYLPAGTTVVTPTLATHFDDTNYADAQTFDPLRFYKPDGVQAQLVTTSADFVTFGHGKHA (2) 52299 ex10
52363 CPGRFFAANELKAMMAYILMHYDIRPEREGVRP 52461 ex11
52462 ENVYRGLNVLPDANARVFFRRRQTD* 52539 ex11

>Scaffold_137a GENE MODEL COMPLETE exon boundaries all checked may be seq error
at the end of exon 4 GGT replaced by GGG no GT boundary for exon 4
      MARSDILDALSLGRTELSTTYLVFGLFLALFLYSLFSPAS (0) ex1
      LRHIPTVGSSSLPLLSYKGAYDFLRDGRSLLQRGYNQ (0) ex2
      YKGKVFKVAFTDRWLAVVTGRKLVEEVQRLSDDVISFPDASGE (0) ex3
      VTGFKYIFTKCALSRDPFHVNMIQRQLTKHMSVAFDDLHDEFETAFKELLPHNETA (1?) ex4 bad GT 
boundary
      WVPVHAIEVARKVVARASNRIFVGLPVC (1) ex5
      RDKAFLDLMVNFTLDVARARDLLALFPPALKPFVAKLVVKLDSRIEEGMQVL ex6,7
      RPIIQERMEIIEKFGKDSPEKP (0) ex6,7
      DDMLQWIIDALVERNEPMEQVVLITLFVNIAAINTSSN (0) ex8
      SFTHALYHLAARPEWIAPLREEAEAVIGNEGWTKNAMGKLVKIDSFMRESQRYNSIVP (1) ex9
      LTCMRKALQPFTLSD ex10
30210 GTHIPRGTILVTPAIATHFDDEHYADAASFDPSRY ex10
      VPVADAKQGGAPKQYVTTTAEYVPFGHGKYA (2) ex10
      CPGRFFAGTELKAMMAYLVLNYDVKF 29873 ex11
      AQEGVRPPNAATTLSTRPHQEARVLFRKRNSSVQ* ex11

>Scaffold_137b GENE MODEL COMPLETE exon boundaries all checked
      MAFSDVVATVGAGPWVAYMMCAVLLALLLYSLFSPAS (0) ex1
      LRHIPTEGGSSLPLVSYLGAYNVLRNLQSVLQRGYDK (0) ex2 
      HKGKAFKIALPDRWVVVLTGKTLVDELQRMPEESASFIDATTE (0) ex3 
      LTGFGYIWGPRMRKDPCHVPIIRNQLTRQLSSAFGDIYEEIELSFQGLMPACEKD (1) ex4 
      WTPVHVIEVARDVVARASNRVFVGLRVC (1) ex5 
      RNPDYLDMLVDCAVSVASARNTLMLFPFVLKTFAAKNVVNMDRRIRRGMQHLGPIIEE ex6,7
      RMSLLRSLGNDWPDKP (0) ex6,7
      DDMLQWIIDEVAARQMPKEDVVRNIMFLNFAAIHTSSN (0) ex8
      SFTHAIYHLAANPDYLGPLREEVEAVTAKEGWSKTAMGRMWRIDSFLRESQRVNSINP (1) ex9
44032 LTVIRRTRTSLTLSD ex10
44077 GTFIPEGTVVAAPAYPTHFDDENYVGGDTFDPWRY ex10
      VREKEQDLSPSKHQYVTLSPEYVPFGLGKRA (2) 44274 ex10
      CPGRFFAANELKAMLAYLVVNYDVKFEK 44418 ex11
      EGVRPENMHVGLTISPDPAAKVLFRKRRS* 44508 ex11 

>Scaffold_137c GENE MODEL COMPLETE exon boundaries all checked
      MASNHLFSGVLPLDRAASTLGYLVCGALLALLLQNILTTIS (0) ex1
      LRHIPTVGTSTLPLLSYKGAYDFTRDIKGVFQQGYAK (0) ex2 
      YKGRAFKIAFTDRWFVVLTGRKLLEELHRLPDSTTSFNHASGS (0) ex3 
      ITGSTYIYGRGWLSDPWHIPIIRDRLTKHLAASFGDMYDELETAFRELMPSCEEE (1) ex4 
      WVPVHFITMARTVVARTSNRVFVGLPAC (1) ex5 
      RNLGYHTLLVNFALDVSKARNRLAWLPPALKRVAARALTRIDSRIEEGMQYL ex6,7 
      GPTIRARIVEMERYKGDWPDKP (0) ex6,7 
      NDILQWIMEELIARKMPMEEAVRIILRINSSAVQTTAN (0) ex8 
      SLTHAIYHLAANPDLIAPLREEVDAVITDEGWTKLAMSKLSRLDSFMRESLRLNIVNP (1) ex9 
      LSVRRMALKSFTFSD ex10
46572 GTFIPKGTLMVTPAHATHLDEANYEHASVFDPWRF ex10
      VHQKEEDLSPTKHQFITTSPEFVAWGHGKHA (2) ex10
      CPGRFFASNELKAMMAYIILNYDVKFA 46910 ex11
      RAGVRPDNVYSGLTVAPNQEANVLFRRRQTQ* 46956 ex11

>Scaffold_52a GENE MODEL COMPLETE exon boundaries all checked
10827 MLVLLGFVSLVLFLVYRRSVRASRGRLPPGPPADPIIGHMRVFPRANHGEVFHQWSKQYG (1) 10651 ex1
10594 DVLHLDVLGKSIIVLNSQEAANDLLDKRSANYSDRPEFPAFNL (2) ex2
10414 LGWDSMLVFLRYGPAFLRQRRLMQQPLTRTGVVVFRPVQLQQCHVLLKNLLASPKDFDAHLRR (2) ex3
      RFASAITLEMTYGHKVSSDDDAYLDIADKVNVVLTKMSKAAILDLFPRAKH ex4,5 fused 
      LPSWFPGAWFIRYAN (1) ex4,5 fused
      DHRHLIWEMASKPFEQVEQQL (0) ex6 
9796  AAGTAQPSFVSMHLEEMHRQNTHDADNVSALKTAAAHMWTGGEET (0) ex7,8 fused
9605 STLLIFVLAAVRNRDAVRRAQAELDRVLGPGRLPTFEDMDALPYVEAFIKETIRFHSALPL 9423 ex9,10,11 
fused
GIPHRAMADDVYRDMLIPKDATVLVNST (2) ex9,10,11 fused
9285  ALARDPAAYSTPERFWPERFLPPHSEPPPVGLGFGWGRRVCPGRHLAEASLWIVV 9121 ex12,13 fused
9120 ASMLAAFDIAPVQDAHGRDAPPELRFTQAIT (2) 9031 ex12, 13 fused
SHPEPFECSITPRSEKVAQLIMQL* ex14

>Scaffold_52b GENE MODEL COMPLETE exon boundaries all checked
      MGFLTALLLVFVLLCVALVRAVRRRRARPPYPPGPPADPLIGHIRIMPSTDNAHEVFHDWAQQYG 18706
18707 DVMSLDVLGTRYVILNSAEAATDLLEKRNSKYADRPTFPMYER (2) ex1,2 fused
18891 VGWKDTLVFLPYGPYFRKQRKMLQLPLEKERVTDFRHIEEQETCVMLYNILSDPDNTDAFVHR (2) ex3
19129 RYTTAVTMELAYGHRVVSNDDEYLKAADMVIDVLRSVTRPSLLDVSPI 19269 (1) ex4
      FEYLPAWFPGAWFVKCIK (1) ex5
      EIKPVVLREIQHPVSVVQQEL (0) ex6
      MAGTAKPSFVSQQLEDLSRENGLSQEDLYTVSMVAHQIF (1) 19663 ex7
      GGSET (0) ex8
19790 GWHTIMTFIACMLTNPDVQRKGQEELDSVVGRGRLPDFTDRDSLPYIDCIVKETMR (2) 19945 ex9
20000 WQPVVPL 20020 ex 10,11 fused
20021 SVPHKAMEDDEYRGMHIPKGATIIPNAR (GT boundary missing AGGT = AGGC) 20098 ex10,11 
fused
      GITWDERHFHEPRTYKPERFLPRPQGAGEVFPQGAVFGWGRR (2) ex12
20341 LCPGRYLADDVVWLAIARILAVFDIQKAVDADGNVVEPHIEFTTVLT (2) 20478 ex13
20541 SHPKPFPCSLRPRSEKAAELVRQAYDMHMANVAV*  ex14

>Scaffold_52c GENE MODEL COMPLETE exon boundaries all checked
      MGFLTALLLALVLLCAIWVRAVRRRRGRLPYPPGPPADPLIGHIRIMPSTDVAHEVFHGWAQQYG ex1,2 fused 
21628 DVMSFSVLGTRYVILNSAEAATDLLEKRNSKYADRPTFPMYER (2) ex1,2 fused
21810 VGWKDALVFLPYGSYFRKQRKMVQLPFEKEKVTDFRHIEEQESCVMLYNIFSDPDNRDAFVHR (2) ex3
22044 RYTTGVTMELTYGHRVVSDEDEYLKAADMIIDVLRSVTRPSLLDVSPL (1) 22184 ex4
22247 FEKLPAWFPGAWFVKCIK (1) 22282 ex5
      KTKPVVLREIQRPVSVVQQKL (0) 22406 ex6
      MAGTAKSSFVSQHLEELSREKGLSEEDLYTVSMAAHQVF (GT boundary missing) 22579 ex7
      GGTET (0) ex8
22710 AWHTIMTFIACMLTNPDVQRKGQEELDRVVGSGRLPDFTDRDSLPYVDCIVKETMR (2) 22865 ex9
22918 WQPVVPL 22938 ex 10, 11 fused
22939 SVPHRAMEDDEYRGMYIPKGATIIPNAR (GT boundary missing AGGT = AGGC) 23016 ex10,11 
fused
      GITWDERHFHEPRTFKPERFLPMPQGAGEVFPQSAVYGWGRR (2) ex12
23254 ICPGRYFADDMVWLAVARILAVFDIRKAVDADGNVVEPRIEFATVL (2) 23391 ex13
23456 SHPKPFPCSLQPRSEKAAELIRQAYEMHMANVEA* ex14

>Scaffold_52d pseudogene GENE MODEL COMPLETE exon boundaries all checked
      ICPGH beginning of exon 13
25670 SHPKPFPCELRPRSARAAALINEAHEMQLTNAEA* ex14 

>Scaffold_52e GENE MODEL COMPLETE exon boundaries all checked
      MGPTAFVAILLCAVLLVQAVRRRRTPLPYPPGPPADPLIGHLRIMPDTSTAPEVWHSWSRKYG ex1,2 fused
26391 DVMSLSILGKRVVILNSEEAVTELFEKRGAKYADRPSYPLYER (2) 26495 ex1,2 fused
26566 VGWKDALILLPYGTYYRKLRKMLQLPFEKDKAPNYRHIQEQEACVLLHNFLRDPSSVESPIHR (2) ex3
26808 RYTAAIIIEIAFGHRVLSDDDEHLKAADMFVEVQHGAGRPSLLDVSPI (1) 26948 ex4
      FEKLPSWFPGAWHVRYIK (1) ex5
      EKRPMILHAIQHPVSVIRQQL (0) 27169 ex6 
27229 VDGTANPSFVSQQLNDLIREGGLTPENQYDLSIVAHMIFG (1) 27342 ex7
      GGSET (0) ex8 
27459 TWNTLTTFIACMLMNPEVQRKGQEELDRVVGRGRLPDFTDRDSLPYIECVMKETMR (2) 27620 ex9
      WHPVAPL 27691 ex10,11 fused
27692 AMPRRAIEDDEYHGMYIPKGAMVIANI (GT boundary missing CGGT = CGGC) 27772 ex10,11 
fused
      SLTWDERRFHDARSFKPERFLPKPEGAGEVLPPSFAFGWGRR (2) ex12
28004 ICPGRYLADDVVWIAVARILATLDIRKPKAADGSIIEPRIEFEAALT (2) 28141 ex13
28202 SHPKPFPCEIRPRSDKAAELIKQAYDMHMASVET* ex14


>Scaffold_180 similar to AT002920 Pleurotus ostreatus cDNA.
seq contines on scaffold 519. Joint bewtween ex2 and ex3 not well supported
gene model complete all boundaries checked
     MLLGTTYL
1241 ITLLTLLSVGIAPLFTLWRRKRTSEAYLPPGPPALPFVGNLFQLPRKSVPRTFATMSQQY  (1) exon 1
     GPLYYMRVINRHFVIVNDLDLARILFDKRGAIYSHRPRL (0) ex2
     PMAQEVVKRDTMLFMNYGPEFRKSRKLVSTFLNQRNASKYWPAQEIESLKFVLAVQRNPSDWLKLTRW (2) ex3
     TATSLVIRLLYGIEVQDKDDALVGLAEDFARLTTETTEPGRWLVDAFPI (1) ex4
     LRHVPAWLPGAGFKRWAKRAKARMDEFATLPYVMAKDKI (0) 266 ex5
     EKGDITPCWTAEKLLETTEPLTEQDEKEIRHTATSMYS (1) ex6
     GGSDT (0) ex7

>Scaffold_519 sequence runs off end. seq continues on scaffold 180
gene model complete all boundaries checked
    GGSDT (0) ex7
216 TNAMVATFILLMLHYPEVQKKAQEEIDSVTGGTWVPGMRDRERFPYINCLVKELFR 392 ex8
    FSPAVPLVPHSLHEDDVVEGYLIPKGSWVMANMW (2) ex8
532 AFMHDEARYPDPETFTPERFEARPGVEPQDDPLDIVFGFGRR (2) 681 ex9
713 ACPGYLLGVASVYLNIVHLLFAFDIAPVKDAAGASVLPPIEFSDGHVA (2) 847 ex10
    HAKPFECDMRERSAERIALIEHTAHSMQ* ex11

>Scaffold_15a 35% to CYP61 missing top of gene in run of NNNNNNNNNN 
gene model complete all boundaries checked this might be a pseudogene
3229 GMLIVIALPQTSGIIQW
3280 FLALIGKHPDIQARAHHELDAVVGRDRWPMAEDEKDLPFIRAIIKEVLRVHAPFWN  
3448 ATPHSSTEDFVYNGMYIPKGAAVILNCFTLHHNEARYPDPY (0) 
     TFNPDRFLGDDLSSAESAHQANAMERDHWSFGAG (2) (AG boundary missing near TFN)
     RRICPGINVAERILFLAISRLLWAFTVHELPTEPISLEEYEGTSGRTPVPYRV
     HLLPRHERVHAALEAEQEIAACEL*

>Scaffold_15b N-term first exon not too well supported similar to 249
gene model complete all boundaries checked
      MITVNRPSTQDSVIATVACAI (0)
54042 IVYFVCKRWEPWRLAVVVPLTMLPPLVLSLPLAASVGFLNAVITTSSTFASALVAMLTF
      YRLSPLHPLSQFPGPLQCKISGFWMAWIVSRGKRHVYIQSLHEKYGDYVRI (1) 54380
      GPNEVSINDPTAIPQILGSYGWPKASGMSGRALHQDPLPLISLLDDAEHSRRRKSWN
      RAFSSAAVREYQPVVAQRATQLVQALQEQRSVVDLSQWMSYFT (2) 54727
54859 FGGGTEMLREGDKAGLWQLLKDGM (2) 54930
      SAIFEHVPWLSHYILHFPALIRSLTDLRALAFGRSKLRYERGSTTKDLFYYL (0)
      SNEDHADAEMPPMKVVISDAVLAIVAGSDTTAVTLSNIFYYLISHPDTYRRLQEEVDKYY
      PPGEDALNPKHYVKMSYLDAVL (2)
55502 NEAMRLYPALPSGSMRTPAKGSGGQVVGQR (2) 55585
55653 FIPEGTQVRVHPYTIQRDPRNFSYPNRFWAERWMIASGNQSHHEKIAHNPDALIPFS 55823
55824 TGPRNCVGKNLALLEMKMVTCHVTQRLSLCFADGWDPSRWWDDLEDVFVSRMGQLPVIVRSR* 56012

>Scaffold_15c gene model complete all boundaries checked
162800 MPLLLVDIAALVAGLVLLFMLDSWRRKGQHLPPGPPGLPFLGNILQIPRKKEFIVFRDLGNIY (1) 162633 ex1
162550 GDIVTLRVPGQIFVILNSRKAVADLLDARSQIYSDRPRTIMCKDL (2) ex2
162324 FRDCRKLLRKGLGPSAVQSFIPFLNRQSAFYLENLQKRPEAFVDIFK (2) ex3
       RNAAAISMKIAYGYDGIQDDEELYGIGAMANHYFAETAVVGVWPVDMLPI (1) ex4
161929 LRHVPQWFPFAYFKKYAAQAKPIVLESVNRPFEETKRHM (0) 161813 ex5
       KRGTAGGSFTSMLLEDAKGDPETEDCIKWSGTGIFLGQMDT (0) ex6
161576 TTSALSWFFLSMVLHPEVQAKAQAEIDKVVGNERLPRFEDKESLPYVSAVMQEVFRWHPVVPM (1) 161394 ex7
161342 IPHALSKDDEYRGYFIPAKTSLIGNIW (2) 161262 ex9
161201 AIMHDESLYPDAEDFRPERFTEDGAPDCLNVAFGFGRR (2) ex10
       VCPGILIAQAHVFVSIATTLATFNITKARDAQGNIIEPVVEDTPGAI (2) 160893 ex11
160833 NFPQPFKVSLEPRSAAAADLIRRSAEHSKTLPERLEIFSLDA*  ex12

>Scaffold_15d gene model complete all boundaries checked
170601 MLLQVLAAIAALFVLSGLLNSRRRNMHVPPGPKALPLLGNVLDIPKKDVHVTFRDWANIY (1) 170771 exon 1
       GKDLMKVEMPGETLYVISNKKVMVDLFEARSAIYSSKPTMTMAD (2)
       SSGFKNSIPLLPYNARLKTSRRLLKQGLSPAAVRSYFPYINNRTALFLEALLKDPDDFVRHFT (2) 171205 ex3
171268 RTAAHTALKIAYGYEGVTEDHHLLHTAIETMEIFATVVNPGRWLVDTLPI (1) 171435 ex4
       LDRIPVSFPFANFKRVQEESRPVVFETVSKPFEEVKKHL (0)
       AEGTADGSFSSYLLQSEKPDPETEDCIRWAATSIFLGQFDT (0)
171825 TTATLSWFTHAMVKFPEVQKKAQEEIDRVIGNDRLPEIQDRDSLPYVNAIMKEIFRWQPIISM (1) 172007 ex7
172057 LPRSVVQDDEYNGYFVPAGTYLLANIW (2) 172137 ex9
172184 AVLHDPEVYPEPEKFMPERHLKEGVPNPLDVTFGFGRR (2) 172297 ex10 
172344 VCPGMQVAQSQTFGTMAAMLATLHLKPQKDEHGRDIIPETRTVDGLI (2) 172490 ex10
172544 RFPVPFKCAFVPRSEAALKLIERGAEHARSVPDRLERWSD*  ex11

>Scaffold_15e gene model complete all boundaries checked
       MVQASDTLLSV
173099 VVCAALITLTSFLLSGYRKRNAHLPPGPKPLPIIGNLHQLPDLKADRAVAFRDMSLAY (1) ex1
173328 GSDILCVKVPGMLMYILNSKESMFDILVTRSAKSSSKPPQVMAD (2) ex2
173522 LSGWKYTVPSLPYGQRIKTSRRLLHKGLGPSAVQSYIPYLERESAFFLEKLLDQQDAYKKHVT (2) 173701 ex3
173777 HTAARIALKIAYGYEGVTDDAHLIDTAVKAMNIFCVTATPGIWLVDSLPF (1) ex4
173974 LQHMPSWFPGTGFKKQASQWSQTVLYAINHPFEELKRQM (0) 174090 ex5
       AAGTAGASFAGRLLEVEDLSDPEVEDCIKHCSTGIFAGQFDT (0) ex6
174324 TTAVMSWFAVVMAFYPEIQKKAQDEINKVVGHERMPVVADRDSLPYVNAILKELLRWRPVLPL (1) 174506 ex7
174556 IAHSVNEEDEYKGYYVPKDTVILANVW (2) 174642 ex9
174692 AVLHDESNYDEPEKYKPERFLRDGILDPSVLDPATLAFGFGRR (2) 174820 ex10 
174885 ICPGMHIGQTLLFILMSRTLQNFDIAPAKDAHGREIAIDTSAVPGLI (2) 175025
       GFPKPFKVSLVPRSNAHATHIRHAAEHARSLPDKLAIFEL* 

>Scaffold_15f gene model complete all boundaries checked
       MLDVGATAAAGLLLVFLLGLGLMKTQH
178217 LPPGPRGLPLLGNVLQIPRRLPHVAFRDMGHKYG (1) ex1
178374 GDIVTLRVPGYNLLVLNSRQAIYDLLDSRSAVYSDRPQGT (2) 178499  ex2
178602 IYRKLLRKGLGASAVQSFIPFLNRQSALYLENLQSRPEAFVEITK (2) 178730 ex3
178796 RNAAAISMKIAYGYDGIADDEELYRLAHQTTIYFAETAVLGAWPVDMFPI (1) 178954
178997 LRFIPSWFPLAYFRRYAARARPVVVECINKPFEETKRHM (0) 179113 ex5
       RLGSAGASFTSMLLGDANGDPDTEDYIKWSSAAIFLGQMDT (0)
179343 TTAVLSWFYLAMALHPEVQAKAQAEIDQVVGNERLPHIEDRDSLPYVCAVMREVFRWHPVANL (1) 179525 ex7
179577 VPHATDKDDHYRDYFVPAQTVAIANVW (2) 179657 ex9
179709 AVLHDEDVYHDADKFIPERFSEEGAPDSLEIAFGFGRR (2) 179822 ex10
       ACPGKVVGQAHVFASIATVLATFNITKARDAQGNVIEPEVMDTPGAV (2) 180010 ex10
180073 NTPQPFKVNIEPRSEAAVDLIRRSAEHSRTLPERLEIFSLDA*  ex11

>Scaffold_33c ex1 joint questionable gene model complete all boundaries checked 
53267 MSDLITAHVLLPSL (0)
IILIILATISYRLSPLHPLARYPGPILDKSTSLRLAYLAFIGQRAQYVTELHERYGKIVRI (1)
GPNKLSINSLDVVHPIYGSSQAYDKSESYRPGLSAEGSIFFARKK (phase 0? boundary = GNNNNNNN)
(missing exon 4 in a run of NNNNNNN)
ELMRDGDPEGVVESGHKAILMFETY (0)
CDSFGEVPALFDILSVLPTGEAYQLVEKRAATHLKDRIKVHPHDGWDMCSFF (0)
LAQREGHNYPPMNEVDLNANTVVAFEA (1)
GGDTTAGFIIITMFHLLRYRQAYDKLKEELDGAFPTGSVSVEEYSH
51364 LAELPYLGAVINEGLRLGAAFPSFPRVVPKGGAMLAGEFIPEGTMVGVPIYTQHYSPDNF 51185
51184 WPEPREFRPERWFEDGLGPGTITRQAAFMPFQFG (1)
      PFGCPGKALGLRLMSVVISNL (frameshift) 
50965 LVLSYDLSFPPDFDPEAFLNGWINTRTNIFRIPLRVEAKRRPW* 50834

>Scaffold_33b ex1 joint questionable cannot join ex2 and 3 GT boundary missing 
see scaffold 3 for this joint (similar seq)
gene model complete all boundaries checked
50259 MFNSFGPAHVLLPPL (0) 
ALSVIIAVAAYRLSPLHPLAHFPGSWVDKVTSLRVAYFALTGHRAEHVTSLHDKYGVVVRI (1?)
GPNRVSINSSDVIYPIYASPQAFDRAASYRPGLIHDGSLLFSRKR (0)
HWDGALKDRVDQLIDCIARRQDLRGVVDLG (0)
EFMRNGDPHNICRSAKDSIVLFEVY (0)
SSSLGEIPALFDIASVLPVTAEYRKVERHFQKHINERMQIKSHSDWDFCSFF (0)
MAQREDAQYPPLSKPDLNADAMVAFEA (1)
48741 GGDTLAGFLSIIIFYILKHQPVYQKLRAELEQAFPLGEIAQDQYASLTEIPYLVAVINEGL 48565
48564 RLGANFAGFQRVVPQGGAVLAGQFIPAGTVVGVPAHLQHIHPDNFWPTPLEFRPERWFKDGL 48379
      GPGTITRQSAFMAFQFG (1)
      PFGCVGKTFAYRQLNVVLSRLLLAYDLTFALDFDSKAFVEGWLN
48139 IRTTIFNYPLKVQASRRQW* 48080

>Scaffold_33a pseudogene fragment exons 3 to 6 91% identical to scaffold 112b
gene model complete all boundaries checked
VAAFIGSNTNFYVADADIIK (0) ex3
EITTHRSRLPKPIEQYKVLTFFGGNIVASVGEHWKRYRKIAAPTFSE (0) ex4
RNNKLVWDETRLTMQDLFTNVWGRHAKIHVDHAVDITLP (0) ex5
IALFVMS (frameshift) VAGFGRRIPWQDEDVVPAGHTMTFK (0) ex6 

>Scaffold_388a very similar to 77 417 112 129
gene model complete all boundaries checked
3583 MISDTFALAISSGLSLFLCLKAFIDYRAGLRSI (2) 3684 ex1
3732 NHSYLPGFRALISSFGILGLFFKEPKRGLWGGRRRFWLRKHLDFEEAGVDIISH (0) 3893 ex2
3954 IAFLPSVSTYLLLADAAAIK (0) 4013 ex3
4069 EVTGHRARFPKPTYKTLRIFGGNVLASEGEEWKRHRKVVGPAFSE (0) 4203 c-helix ex4
4255 HNNRLVWNETVKIVNDLFANVWGSQSEVYVDNVVQSVTLP (0) 4374 ex5
4423 MALYVISIAGFGKRALWQADGNLPPGHKLSFQ (0) 4521 ex6
4576 DALHILGTDLWIKAATPTLLMNWAPTTRIANVKLAFDEVK (0) 4692 ex7
4747 QYMLELIQERRNSEKRDERYDLFSSLLDANDLNEDGNGNVTLTNDELL (1) 4890 ex9
     GNIFIFMLA (1) 4973 ex9 split
     GHE (0) ex9 split
5087 TTAHTLAFTFGLLALHPDYQETVYQQIKSIVPDNRPP (0) 5197 ex10
     MYEEMNSLTECMA (2) ex11
5351 YETLRLFPP (0) 5380 ex12
5436 TATIPKIAAEDTYLVTIDRAGNRVVVPVPCGTALHLNVIALHHN (1) 5564 ex13
5614 PRYWDNPSAFKPERFRGDWPRDAFIPFSTGSRSCIGRR (2) 5730 ex14
5780 FFETESIAILTMILSRYKIELRNDPRFADETYEERWQRVLRVKDGLTPA* 5932 ex15

>Scaffold_388b very similar to 77b 417 112a 112b 129 
large intron between ex5 and ex6
There are no AG GT boundaries on exon 6 so this might be a pseudogene.
gene model complete all boundaries checked
      MGTLAWVVLSFCLFYCVQKYLEFRAVVRSIH (2) ex1
      DHPGFRTLLPPYGIFGFLFKRPIPGITRGGMSQWRGKYRDFEAFGMDIISA (0) 17296 ex2
      TSVIPTARNAFLVADPAAIK (0) ex3 
17133 EITSSRTRFPKPVAQYRVLTFFGANIVTAEGDEWKRFRKITAPAFSE 16993 ex4,5 fused
16992 RNNRLVWDETVKIMLDLFENEWAGKDTVVVDHAVEVTLP (0) 16876 ex4,5 fused
14857 WIALFVIGVAGFGRKMTWQEDSKLPPGHQLSFK 14759 (no AG boundary at WIA no GT at SFK) ex6
14700 EALHYVSTAVFVKLATPAWLLTWAPTERMRRTNLAFKELE (0) 14584 ex7
14518 QYMLEMIQTRRNSEKKEERYDLFSNLLDASEDGSDGHARLADEELL (1) 14381 ex8
      GNIFIFLLAGHE (0) 14307 ex9
14247 TTAHTLAFTFGLLALYPEQQDKLYKHIKHVIPDGRIP (0) 14137 ex10
      AYEEMNLLHESIA (2) ex11
13982 VFYETLRLFPP (0) 13953 ex12
13895 VTGIPKVAAEDTTLVTTDHSGNKVVVPVTKGTGISLHVPGLHYN (1) 13770 ex13
13710 PRYWDDPYEFKPERFHGDWPRDAFLPFSSGARSCLGRR (2) 13594 ex14
13549 FFETEGIAILTMLVSRYKIEVKEEPEFAGETFEQRKERILAAR 13418 ex15
      GGLTLTYVCSPPHLRNLLNLPLR* ex15

>Scaffold_129 very similar to 77b 388b 417 112a 112b
gene model complete all boundaries checked
23646 MFSNTFALAITSGLLLSCLKAYMDYRAALRSIN (2) 23747 ex1
23789 YHPGSCALIPSFGMLGLLFKEPRRGLWGGWRRFWRRKYLDFQEAGVDIISH (0) 23950 ex2
24011 IAFVPSVTTYLVLADAAAIK (0) 24070 ex3
24124 EVTGHRARFPKPSYEFFRIFGGNIIASEGDEWKRHRKIAAPAFSE (0) 24258 c-helix ex4
24306 HNNRLVWNETVKIVCGFFENVWGSQAEVYVDDVVQSLTLP (0) 24425 ex5
24479 MALHVISIAGFGKQTVWRADGTLPPKHKLSFQ (0) 24574
      DALHVVSTDLWIKFVMPTMLLDLAPTKRIAKVKLAFEEVE (0)24750
24806 QYMLELIQERRDAEKRDERHDLFSNLLDANDSDENGDGSVKLTDEELL (1) 24949
      GNIFIFMLA (1) ex9 split
      GHE (0) ex9 split
25150 TTAHTLAFTFGLLALHSDYQEKVHQQIKSIMPDNRLP (0) 25260 ex10
      TYEEMHLFTECTA (2) ex11
25420 VFYETLRLFPP (0) 25446 ex12
25509 VTTIPKISAEDTSLVTTDRAGNRVVVPVPCGTSLHLSVVALHYN (1) 25643 ex13
25690 PRYWDDPYAFKPERFHGDWPREAFIPFSAGARSCLGRR (2) 25803 ex14
25869 FFETEGIAILTMILSRYKIELKDDPRYAHETYEERWQRVLDVKDGLTTT* 26018 ex15

>Scaffold_77a most like 52b frameshift in exon 2
gene model complete all boundaries checked
1298 MDPATVAVAVVCALAVMHVLTRRARTRLPYPPGPPEDPIIGHLRQMPNNDEAAEVWYRWAKQYGDVMSLNV 
frameshift
1512 LGKRLVILSSEEAATELLEKRSSKYADRPRFPIFER (2) 1619 ex 1,2 fused with frameshift
1672 IGWKDMVLLMPYGPYHKTLRKMIQVPFEKDKAFQFRDIQERATSIMLHNFLADPKGIEHHTHC (2) 1857 ex3
1920 RYVVSIIVEIVFGHRILSEDDEHLKIADVFVKIQHEASQPSLLDVSPL (1) 2063 ex4 
2122 FAKLPSWFPGAWFVKYIE (1) ex5
     DTKAILSHAIHHPVSIVQEQL (0) ex6
     ASGIAKPSFVADELERLIKAGQLTPQNKYDVSIAAHMIFG (1) 2467 ex7
     GGTET (0) ex8
2590 TWNTLTTFIACMLLNPEAQRKAQEEIDKVVGHGRLPDFTDRDSLPYVECVVKETMR (2) 2751 ex9
2810 WHPVAPVAVPHKATEDDVYRGMYIPKGAIVIANAR (GT boundary missing AGGT = AGGC) 2914 ex 
10,11 fused
2980 SITWDERRFHDPHAFKPERFLPRPLGAGEDFVQGAVYGWGRR (2) 3102 ex12
3155 ICPGRHLAGDMVWIAIARVLAVFDIQKARDADGNAIEPNIEFTTAV (2) 3292 ex13
3362 HPKPFPCELRPRSEKAASLIKESYELHSID* 3457 ex14

>Scaffold_77b very similar to 388 417 112 129
gene model complete all boundaries checked
81731 MNSVLVILLSTILLLCLKTYVDLRTALRAV (2)
81876 NYHPGFKSFISCFGVFGFAFKEPRRGLIGGSLRFWHRKHLDFDEAGVDVIHH (0) 82031
82080 VSFFPRVSTCLILADPAVIK (0) 82139
82189 EVTSHRALFPKPLYHELRLWGGNIIASEGDEWKRHRKVGAPAFSE (0) 82323 c-helix
82380 PNNRLVWNETVKIMVDLFDNVWGSQDTIIVDHVVDAFTLP (0) 82496
82549 VALFVISVAGFGKNASWQSDLLPPSGHKLSFK (0) 82650
82697 DAIHVVSVDMFIQVVTPTFLWKLAPTKRIADVKLGFEELE (0) 82813
82869 KYMLEMVEERRNAPKKEERYDLFSSLLDASDSDADGGARLTDRELL (1) 83006
      GNIFIFLLA (1) 83081
      GHE (0)
83197 TTAHSLAFTFGLLAMHQDYQEKLYQHVKSVIPDGRLP (0) 83307
      TYEEMNKLTECMA (2) 
83459 VFYETLRLFPP (0) 83488
83553 VVGVPKVVAENTTLVATDFTGKRRAIPVAAGSDIHISILALHYN (2) 83678
83730 PRCWDEPHAFKPERFHGNWPRDAFLPFMAGPRACLGRR (2) 83840
83903 FFETEGIAILTMLVSRYKIELKDEPAFAHETYEERWDRLFTVKQGITLA* 84052

>Scaffold_417 gene model complete all boundaries checked
      MQQHLLFAAGLICLFLVKRCIEYRRAIRAI (2) 
14022 HNYPGVRAVLSNSSGLGYLCKRSIPGLAVGGARLWVKRYSDFCRYGADIVSC (0) 14177
      VAVLPRTEILLFVADPAAIK (0)
14341 EISSDKTRFSKPTELYELVNIFGRNIVTTEGDEWKRHRKIVAPAFSE (0) 14481 c-helix
14546 RNCELVWEETLHVMIGLFNDVWGSDSIITLDNAFDITMP (0) 14662
14715 ISLFVVAASAFGRRIPWTEGGLAPPGHHMSFK (0) 14813
14874 EALHIVSTGTVIKAVLPKWLLNLGPSQYIREVRDAFREME (0) 14990
15048 AYMREMVTENMLDDTKSRRDLFSSLVHAGQDSPGQEALLTDAELL (1)
      GNVFMFLLA (1) 
      GHE (0)
15382 TAASTLCFALGLLALHKDEQDKLYDHIRFTLGEKDVP (0) 15492
      AYSDLTSLSYCSA (2)
15635 VLYETLRLFPP (0)  15664
15726 VIGIPKKATEDTVLSTVDRDGNHIAVPVPVGSSVAIHVPGVHYN (1) 15851 intron shifted one base
15905 PRYWKDPAAFRPSRFFGNWPRDAFLPFGAGSRACIGRR (2) 16015
16069 FFETEAITALTMLVVRYEISVTDEPQFRDETAEQRRERVLSATQELTLT* 

>Scaffold_112a 3 different P450s on this sequence 42% to scaffold 154
very similar to 77 388 417 112 129 gene model complete all boundaries checked
      MLLILWALLAAVVYHAAARLVRLRRLLVKIR (2) ex1
      FHPGQRAATSIYGAATFLFPWRIPNLTPGANLLFDEKHALLARHGLDVVTS (0) ex2
      VSTHPMRAVFVVADPAVLR (0) ex3
35143 DMAAARSRYPKPVELYGSLSLYGPNIVASENDAWKRYRRICSPSFSE (0) 35003 c-helix ex4
34950 RNNKLVWEETVRVVTELFDTWEGRQEIDMEDALTMTLS (0) 34837 ex5
34788 ITLFVISSAGFGKPITWKGGDERPEGYAMSFK (0) 34687 ex6
      DVIYHMSTGVFIKIATPQWLLNLGLTEKMRNTNVAFKELG (0) ex7
34458 MYMSDMIRERRESQQREDRGDLFNGLLDAGEEDEKLKLTDEELM (1) 34297 ex8
34281 GNIFIFLIA (1) 34252 ex9 split
      GHE (0) ex9 split
34143 TTGHTLCYALALLALYPDEQEKLYQHIRTLCPAGELPVYDDLRNYTYALA (2) 34033 ex10,11 fused 
      VLYETLRMFPSVVGIPKVASEDTCVQTMNDAGQLVEVFIPEGSDIVFDTPGLHYN (2) 33775 ex12,13 fused
33720 PKYWTDPYTFSPSRFMAPDWPRDAFLPFSGGPRACLGRRFA 33598 ex14,15 fused
33606 RFAEIESIAVLVLFVSQYTIHLKEDPKYAGETEQQRRERVLKSVPGLTLT 33457 ex14,15 fused

>Scaffold_112b 3 different P450s on this sequence 65% to 112a
very similar to 77 388 417 112 129
gene model complete all boundaries checked
      MASRLLVLLAALVLFALRAFARFRRAVHAVSYVSSALRSV (expected phase 2 GT missing) ex1
38510 NHPGYRTLLNTLGPIENFFPRIPGVAPGAFHMWKRKHRDFEEHGWDVITY (0) 38361 ex2
      VAAFIGSSTNFYVADADVIK (0) ex3
38197 EITTHRSRFPKPIEQYKVLTFFGGNIVASEGEHWKRYRKIAAPAFSE (0) 38057 ex4 c helix
38000 RNNKLVWDETRLIMQDLFTNVWGERAEIYVDHAVDITLP (0) 37884 ex5
37726 IALFVIGVAGFGRRIPWQDEDVVPAGHTMTFK (expected GT missing) 37631 ex6
37559 TALHTVSENVFTRLLIPDWLLRAAPTARLARIRDAFAELE 37440 ex7,8 fused
37436 QYMREMIRARRERPAREERHDLFSSLLDASKDADVRLQDSELI (1) ex7,8 fused
      GNMFIFMLA (1) 37278 ex9 split
      GHE (0) ex 9 split
37116 TTAHTLCYMLAMLAMHPEVQDKMYESIRGVTQNGRLPEYEDMRSLSYCEA (2) ex10,11 fused
36913 VLYETLRMFPPVNSIPKSVAEDTAITITNADGERTTVPMPKGSSISIHTPGLHYN (2) 36749 ex12,13 fused
36696 PRYWPDPHTFRPERFLAADWPRDAFLPFSAGPRACLGRR 36574 ex14,15 fused
36576 RFSETESVAAAAMLVLRYRIAVADEPRFAGEGARARFERVTASRPGVTMT ex14,15 fused
      CVFCAPLWVVVGTDELCCRPTRVPLVFRRR*

>Scaffold_57 Length = 127761 N-terminal exon not certain
gene model complete all boundaries checked
       MDALDPRIAIP (0)
127279 IVYFIYKKYEPSSPRSAFFLLLALPGVLAVALRVCERFNSYATAVP
127147 TVYLAYWSLLSTFVVAYRISPFHPLARYPGPLLCKISKGWLAYVAG
       KGGKAHLYVQDLHMRYGEVVRI (1) 126941
126894 GPNELSITHQDFTRVVLGAKGLPRGP (1) 126817
       YYDSRQHEAGMSLDGMRDQALHAIRRRPWARGMNTAAMKYYEELIRNTLSDLIAG 126604
126603 LKQRTNRPVDISEWTNYFGFDFMGQMA (2) 126523
126474 FTRDYGMLKNGYDKEGLLDLIEHAMQ (2) 126394
126341 DSAWISHITWSIPFLRYVPGASKYWDQMKAVGERAVADRVALGSNHRDLFHYLMDEDGH 126162
126161 EAVRPTKALVAVDGQLAIIAGGDTTATTLSHIVYFLLRYPIYLDRLRKEIDETFPDGADS 125982
125981 TLDFTKQTNMPFLNACI (2) 125931
125877 NEALRLYPPVLAGLQRRVEPGTGGKMIGP (2) 125791
125734 YFVPEETQVSLFAYSIHRDPQHFSPLTNTFWPDRWLSQEKYTLPSGDVISADEVVTNRDVF 125552
125551 IPFSQGPMVCAGKNVALTEMRSVMCALLQHFDLKIADQSFLDSW 125420
       EDKIEETFTTKRGTLPVILSLRA*

>Scaffold_284 run of NNNNNN upstream of N-term 21900 and higher
missing exon 1 in run of NNNNNNNNN gene model complete all boundaries checked
      TVYVSYWALLVTYTIAYRLSPFHPLARYPGPLLCRISKAWLAYIVATSGKMHLYIQNLHMRYGDVVRI (1) 21607
21557 GPNEVSVTHRDFIGVIGPKGLPKGP (1) 21483
      YYETRAHKAGTSLNAIRDQALHSVRRRPWARGMNSAAMKYYEELVEETVG
      DLVASLKRRTTKAIDFSEWMTYFGFDFMGHMA (2)
      FTHDYGLLKNGYDKEGLTPLIEHAMQ 21054 (2)
      DVAWVSHVPWSIDYLRHIPGVYKHWLRIKALGVQTVRKRIALGSTRRDLFYHLM 20842
20841 DEDNRERVKPDINVVAIDGQLAIIAGGDTTATALSHLFYCLLRHPQYLERLRKEIDDAVPIACGSF 20644
20643 KLDFSKLPAMPFLNAFI (2) 20593
20540 NETLRLYPPVLSGLQRRVEAGTGGRFIGP (2) 20454
20396 HFIPEQTQVSFSAYTIHRDPRYFSPLTDTFWPDRWLVQEQYVLPSGGVIPAAEVVTDRDVF 20214
20213 FPFSQGPTVCAGKTLALTEIRSVACALLQTFDISNADEASFDAWEDNLEEMFTTKRSTLPVFLSLRT* 20010

>Scaffold_154 35% to 164a gene model complete all boundaries checked
26877 MARCNQACYLIYKHSEPNNIPAHAALLLGVPALLVHQLGTHWSILQQGGAFVA
      YWALILAFTGLYRLSPIHPLARYPGPTLGKLSKIYLSYLSARGDIYRVIKGWHDKYGDVVRI (1)
      GPNELSFRHVDALQPIMGTKYTVKGP (1) 26404
26348 YYDTRTTPEQITQMDGIRDYSVHGQRRKPWLRAMSSAGLKGFEPIVKMKALELVEELSKK 26169
26168 VGEIIDMSEWMNLF (2) 
      GFDFMGHLAFGREFGLLKSGNDHDDMIRTVEDGVY (2)
25901 GAGVISHIPWILPFLVHFPPAMKGLRAMQQMAATFARERTQKGSTTKDIYYFLV (2) 25752
25710 NEGAAQSGATHDEVIADGMLALIAGSDTTSIALSHVCYFLLRHPACAARLRAEVD
      RAFPPGEDVLDFARHADMPYLNACI (2) 25459
25376 NEALRLLPPGLGGLQRMVRRGTGGAMIGP (2) 25290          
      HFVPEDTKLSVHLFSLMRDAREFAPLPDAFWPERWLAQDTYVLPTGD 25082
25081 AVSKEHVTTNRAAFIPFSVGPQNCAGKALALVELRAVTCALVSKFELH 24938
      KPKDYDLDQWEGDLLDLYISIRGKLPVILQARQGR* 24839

>Scaffold_78 N-terminal exon is a best guess
gene model complete all boundaries checked
      MSAIFAASS (0)
61873 TTYIIFKRFEYSKPVPALVLLIGVPMT
61957 LASVLRDHFAGLATAMCATAAVHWVLLTLFVAAYRISPFHPLARYPGPLPCKLSKCWMAY 62136
62137 LAGSGGKTHVYIDRLHRLYGDVVRI (1) 62253
      GPNELSVRHKDACTTVLGAKGLPRGP (1)
62387 YYDTREHDNGVSLDGIRDPALHAVRRRPWARAMNSASTQYFEELIQHTVSDLTGGLK 62566
62567 ERAGESIDLTEWMSFF (2)
62742 FSYDYNMLKEGRDTQGLRRMIDQSLV (2) 62819
62870 DLRWISHIPWSIPYLKMIPGASKNWDDMKAAGDKVARHRVSLGSSRPDLFHHL (0)  63034
      RDEEGHEAVRPQLEVVSVDGALAII (0) 63159
63210 AGADTAATTLAHFWMFMLRHPACFERLRKEVDATFARDDGPDFVKQARMPYLNACL (2) 63371 
63431 NETLRLFPPVLAGLQRRVGRGTGGRMIGT (2) 63514
63571 HFIPEDTQVSLVAYTVHRNPDCFSPFPDTFWPDRWLTQETYTLPTGEVIPSSDVLTRRDA 63750
63751 FMAFSQGPMACAGKNVALAEMRAAVCAVVQRFDLVLAYERALDEWEEVLQECFVSKLGK 63927
63928 LPVQVVPRN* 63951

>Scaffold_249a 59% to 247 exon 7 GT boundary missing 
gene model complete all boundaries checked
      MAGDLSTRDALGIIVVSAL (0) ex1
14922 GTHAIFKRWEIKHILVVSTLLLFLPAALSTLLIPHLGSFKGIAAGFSVYFITLLSSI 14743 ex2
14742 TLYRISPFHPLAHYPGPLLPKISKIYHIAKVSSGKQHLYLQELHNQYGDIVRF (1) 14566 ex2
14527 GPNEVSIRDASCIMPVLGAQGMPKGP (1) ex3
      MWQGRHFWTEVHTLIG
14347 FRDPKAHQRRRRPWNRAFNTAAMKEYTPLMQNRVRELGDALVARQGQVVDLAEWIGFFT (2) ex4
      YGFMGDVYV (2) ex5
      FGGWTNMVREGGDRERLWEVVKSGLK (2) 13973 ex6
13932 IEFIYDNIPWLSYYTRNIPGAGNAELRAMAIGQTEKRYSRTSTSKDLFYYL (GT phase 0 missing GTA = 
GCA) ex7
13699 GNEDGAEKEDPPKHTVVVDGGLALVAGSDTTSSVLSSIFYCLLRHPDTYDRLQAEVDKFYP 13520
13519 PGEDSLDPSHLSDMNYLEA (0) ex8
13409 GLRLFPAVPSGSQRAPEIGTGGKLVGP (2) 13323 ex9
      YYIPEGTQTRIHFWSVHRDPRYFSRPEAFWPDRWLIA 13160
13159 EGLQAHAAGDEPFVHNPNAWTPFSFGPSNCVGKNLALQEMRMVLVHLMHRLIVRLADGWD 12980
12979 PAQYEREMEDRFVFSIGRLPVVVERRD* 12896 ex10

>Scaffold_249b gene model complete all boundaries checked
      MAAREAILIIALFAVVST (0)
18453 ISHVIFRQWEVMHCSVVLGLLVVIPAVLSTPLVSDFGIPCGLALGFTTYFAVLLLSITL 18277
18276 YRISPFHPIARYPGPLLAKISKIYHVSKIWSGKQHLYLQRLHEKYGDIVRI (1) 18121
18073 GPNELSIRDVSCITPALGAQGMPKGP (1) 
17933 MFNGRHLWPETHSLIGFRDPKEHQRRRRPWNRAFNTASVKEFNPIIQARVQELGDAFAAREGQ 17754
17753 VVDLAEWIGFFT (2) 17718
      YDFMGDMV (2)
17595 FGGWTHMVREGADHNGLWQLIKSGMK (2) 17521
17470 VSFVYEHIPWLSYYVKKLPGAGSDLKMMRAMAFGQTEKRYATTTTTRDLFYYL (0)
17247 TNEDGSEKVDPPKAVVISDGALALIAGSDTTSTVLTSTFYCLLRNPETYKRLQEEVDMFY 17071
17070 PAGEGSLDPKHLPEMHYLEA (0)
16953 GLRLFPAVPSGTQRAPEVGKGGKAIGP (2) 16864
16807 YYIPEGTQTRLHFWSIHRDPRNFSHPEMFWPDRWLIAEGLQECVGEKLVHNPNAWLPFS 16631
16630 FGPSNCVGKNLAMQEMRMLVCHLVQRFNFRFADGYDPAQYERDWQDRFVVMIGQLPVTIERRA* 16439

>Scaffold_141 73% to scaffold 249 gene model complete all boundaries checked
      MPSGILGQLQSLPAKLTAQDATL (0)
12018 VAHVIFKIWEPMQARIVSLLVIIAPLLLSTLFIPHYGT
12126 VSGVFRSFAIYLTTLVSSIVVYRLSPWHPLARYPGPLLAKVTKLYHALMVSKGKQHVYIK 12305
12306 ALHDQYGDIVRI
      GPNEVSIRDAACIQPLMGAQGLAKGP (1) fused
12494 SWSGRSMFPPISPLIGIRDPAEHARRRRPWNRAFNTNGIKEFMPTIQTRVQQLAEHLGERH 12673
12674 GQALDLAEWFSFFTYDFMGDMI (2)
      FGGWTEMMRDGGDLQGLWTRVKAGLQ (2) 12868
12942 HAGMVPEHVPWVAYYAKKIPSVVRKVSEMRGMGISRAKMRYQQGSTSKDLFYYL (0) 13085
13142 SNEDGSEKVTPPPEVVTSDGALALVAGSDTTSSVLSNLFYCLLRDPVSYKRLQEEVDKFYP 13321
13322 PGENSLDPRHINNMPFLEAVI (2) 13384
      NEAMRLYPVVPSGSQRSPEIGKGGRAVGP (2) 13528
13583 YYIPEGNQARVHFWSVFRDSRNFSHPETFWPDRWLIAEGLQESPEKITHNANAFVPFS 13756
13757 FGPANCVGKNLAIQEMRLAVTHLMHKLNFRFADGFNPDEWDSQIQDVTVMQLGKLMVVVERRD* 13942

>Scaffold_55 61% to scaffold 141 top of gene missing in run of NNNNNNNs
gene model complete all boundaries checked
      AEWIAFFA (2)
      YDFMGDMA (2)
      FGGWTEMMRDGVDKEGFWDMIHMTLK (2)
89160 AGAVFEQVPWLAYYAKMLPAISQRILKMRKLTVRHATRRYNSGSFSRDLFHYL (0)
      SGEDLPEGSARPPQHIVAADGLLAVVAGSDTTASALSNLFYCIMRHRDVYKRLQQE 89519
89520 VDQFSPLGDDSLDPQHLNNMPYLNAVI (2) 89600
89652 NETLRYLPSVLSGSQRAPLIGGGGVSVGP (2) 89738
89797 YYVPEGNQVRVHFYSVHRDPRYFSDPDRFWPERWLIADDRQPSSEKIVHDDRAFIPFS 89970
89971 YGPSNCVGKGLALQQMKSTVCHVMAKLEMRFADGYDPDTWEEQVQDEGVMIVGSLPVVIKRRL* 90159

>Scaffold_3 gene model complete all boundaries checked
       MALLQLAQDVFRRSHPAS (0)
       ACYALYHKYLNKPVHPLYHFCLLLVVPAALLALLQAIHRISVAQECGYALF
       YWLVMASATVVYRISPFHPLANYPGPLAAKISKLYLAYLTAKGRAHEDVRALHSKYGDVVRI (1)
       GPNELSFNRSDAIQTIYADKTMPKGP (1)
264083 YYVARTNLAGVVQLDGVRDFKEHARRRRPWNKAMNSAAIKSYEPIVSSTASQLLGQL 264259
264260 SKRIHNDVNISDWMSFYG (2) 
       FDFMGRMV (2) 264385
       FGREWGMLEEGRDVNDYWHTMDKCLT (2)
264569 IVSWSSQIPWSVPIIRLMKPPPEVLKMQKISDDSAMARLTSEGSGVKDLYYYL (0) 264727
264786 LNEDDSSKSELTRDECISEGVLAIVAGSDTAATALTHLCYYLLTHPDSLQRLRQEIEEAYP 264965
       TLGSELDDLSRQAEMPYLNACI (2) 265031
265081 NETLRLLPPVLTGLQRSVTAGSGAIIAG (2) 265164
       YFVPEGVDVSVHHYSVHRNLQDFSPIPDTFWPDRWL 265325
265326 EQDAYVLPDGDVIGKGEVRTNRGAFMPFSVGPQQCAGKNLAMVELRAVACGLFRRFDLS 265502
265503 LSERMNICDYEKGLRDAYTTVRGPLYVKLKPRKE* 265601

>Scaffold_9 73% to scaffold 144 gene model complete all boundaries checked
      MADTSLLSRRLKSFFDPQGSPTLLSLPDSF (0)
56886 VVHLIFKRWEPMKLPIVAFLLFLVPACLSLLFASHLSLTKGLATAFATFYTVLVSSIVI 57062
57063 YRISPFHPLARYPGPLAAKITKWWHAYHVHTGKQHLYVRRLHDQYGDIVRI (1)
      GPNDVSIRDASCISSGLGSQGLPKGP (1) 57353
57409 MWDGRFMYSPIPAMVGARDHAYHMQRRRPWNRAFSATALKEYEPLIYGRVHQLVSALADRQGQ 57588
      VVDIAKWIGYFT (2)
      YDFMGDMV (2)
      YGGWTEMLRDGKDEDGLWDVVHRGLE (2)
57908 DVSAVYGEVPWVSYYASMLPNVGKDLKRMRKMAFDRAKQRYDSGSKARDLFYYL (0) 58057
58102 SNEDGAEKVTPPRPIVVSDGVLALIAGSDTTAIVTATILYSLLCNPTTYHRLQQEVDKFYPRGEDPLNP 58308
58309 KHYKDMHYLEATI (2) 58341
58398 NEGLRLFPATPSGTQRAPAPGKGDRLIGK (2) 58487
58541 YYIPEGTATKFHFWSIQRDPRNFSHPDTFWPERWLVAEGLEHADEPLTHNANAFVPFSFGPYNCV 58735
58736 GKNVAMQEMRMLLCHLMHTLDLRFPEGYVPRAFEDALEDQFGFKVGELPVIVQRRE* 58900 

>Scaffold_271 stop codon in middle of last exon (seq. after stop matches 247, 144) 
gene model complete all boundaries checked
28395 MGAGYVPQLPRSYALTSFTGTSQTHALTPVIGAAL (0) 28288
28229 ITHLNFKRWEPLNLPIVIFLPLVAPLGLSALFAPGPSYGSLVAPFITLFLYHAILLASIA 28053
28052 LYRISPWHDLYHYPGPLPAKPSKWWMVWKERHGKQHLYVKALHDRYGDVVRT 
      GPNEISIRDVAAVVPLMGTKGLPKGT (2) 27822 (fused exons)
27756 APWGEPIVPSVVPLIGIRDSVEHARLRRSWARAFTAGALKGYEPVLTARITQLIAKLGSQTGE 27577
27576 XIDLALVLSYFSYDFMGDML (2)
27475 YYGGGSELLAEGDNDGVWAL (2) 27407
27356 GQMTCHHLPWLAKYKDLLPASPGLQKMRSVALQRTMARYKNGGLGKDLFYHL (0)
      SNEDSAEKTSPPTEQLVSDGVLAVFTASDTIATVLSNVFWSILRFPRYYEQ 26997
26996 LQAEVDKFYPARADAFDTAHYGEMVWLDAIT (2)
26851 NEALRLYPIVPSGSQRAPAPGDGARVVGP (2) 26765
      YVIPAGTNARVHTWSLQRDPRCFSRPDAFWPERWL
      AAAGLGDSEATCEGPEGAAGAAEDFVHDARAFEPYFVGPLDCIGRALA
26456 QLELRMVLCALLQRLAFAPARG*DPLERERTLQDQFVVMMRGPVMVSVSWRA* 26304

>Scaffold_144 84% to scaffold 247 gene model complete all boundaries checked
most similar to 247a
35619 MGSEVAMQLLRANISKPFPRLDQNDALAVVVGAALV (0) 35509
35460 VCHLIFKHLEPTYIPAVLFLLVLVPLYLSALLLPHFGPLLAPVIAFTTYHTSLLTSIGLY
RISPWHPLAKYPGPLPAKLSKWWMVWKERDCKQHFYLEDLHKRYGDVVRIGPNELSICNV
DAVLPLMGPDGLTKGPC (1)
STIGQGLEQPIPSLVSIRDPAEHARRRRPWTRAFSTA
ALKEYEPILAKRISELCEQLAQQKGSLNLATWISWFTYDVMGDL (2)
VFGGGNEMLATGDQDGIWAMFEKSGE (2)
GQMVYHHVPWLAHYAKRLPMSPALKKMREFALGRALERYKRGAVTKDLFYYL (0)
SNEDGSEKIPPPPAQVIGDGVLATVAASDTTSTTIANTFWHILRYPHYY
KRVQAEVDKYYPPGESAFDTKHHNKMTFLEAVI (2)
HETLRLYPVLPSGSQRSPVPGKGDRVVGP (2)
YYLPDGTQARVHTWSLHRDPRYFSRPDTFWPERWLIAEGLEPAPAGEPFVHNANAFIPFS
FGPANCVGKNLAYLEMRMVFCHLLQNLDFELDKRWNPAERSRSAEDQFVLYMRCPLPVTVRRRV* 33556

>Scaffold_247a 51% to 154 gene model complete all boundaries checked
17448 MGTEYVLPLLRTNILKLPTNMTRNDALLAVGGAAV (0) 17558
LCHLIFKKWEPTYIPAVVTLLLVVPLGLSALLVPHYGQLLAPLVALATYHTILLTSIALY
RLSPWHPLAQYPGPLPAKLSKWWMVWQERDCKQHLYIKQLHDRYGDIVRIGPNELSIRNV
DAVAPLMGTNGLPKGPS (1)
LRGQGLEPPITGLIAIRDPAEHARRRRPWTRAFSTA
ALKEYEPILVKRISQLCEQLASQKGTLDLATWFSWFTYDFMGDMV (2)
RFGGGSEMLAHGDQDGIWTMFKEGGE (2)
GQMMYHHIPWLAHYAKRLPMSPALKKMRGFALGRTAERYKKGASTKDLFYYL (0)
SNEDGVEKTPPPAAQVISDGVLATIAASDTTSTTLSNAFWNILRHPHYY
KRLQAEVDKFYPVGENAFDTKHHSKMTFLDAVL (2)
NETLRMYPVLPSGSQRAPFPGNGDRVVGP (2)
YYIPDGTQARIHFWSLQRDPRYFSHPDTFWPERWLIAEGLEPAPAGEKFVHNPNAFIPFS
FGPSNCVGKNLAQMEMRMVFCYLLQNLDFELDKSWNPAERENATEDQFVLLMRSPVQVTVRRRV* 19517

>Scaffold_247b gene model complete all boundaries checked
      MMPYILGVTLLLLTVIVLRVLRARASRAAPYPPGPPAYPVIGSVGPFPAHEPHLGLAELAKKYG (1) ex1 
20516 DVMYFEIFGKPLVVLSSLEAASDLLEKRSAIYSSRPRFAVHEM (2) 20620 ex2
20700 IGWTDMVSFLPYGEQFNKQRKFFLHTFSKQGCLVFRSSQVAQTHLLLKNILQCPTRYIEYLR 20885 ex3
      RFSTAVIMEIAYGHKVSSEDDPYVKIAEDTNNVLMAAGHSLALVDFLPW (1) ex4
21133 LRHLPAWFPGNWFARVAQ (1) 21183 ex5 partial
      ESRPVIQRMRNFPFDQVVQQM (0)
21363 ASGTASPSFVSMQIEELERDGGASPENLHILKIAASQMYGAGAET (0)
21561 TWSTIMNVIAFLLLHPTAQRKAQDELDSVLRGERMPDFDDRKSLPYLDALLLEVMRLQPTAPL (1) 21743 ex7
21808 GVPHSSTTDDIYRGMFIPKDSIVLTNTTY (0) 21891 ex9
      ALAMDDRVYRNPTEFRPERFLPPHAEPNPNGIVFGWGRR (2)
22114 ICPGRYLADTSVWIVMASFLTVFEIVPERDRNGQDIIPEIQWCS (1) 22257
22330 APFPCVIRPRSEKEVKLVSRL* 22398

>Scaffold_104 
63182 VLLWVLWKVFRNYVVSSPLDNIPGPPRSSFWS 63283 ex1
63714 GEQHRRQRRVLNPVFSGAHMRHMAPVFYDVAHRV 63815
65118 ILAATDTTSSALARILHILAERQDIQDKVRAELVEAAGEGEDIPYDQLVNLPWLDAIC 65291
65292 RETMRLQVP 
MTAASHRARTDVIMPLSEPVQGRDGTLIHEIAVPKGTLVTISVRGCNRNKAIWGEDALEWKPERWL 65636

>Scaffold_203 
39023 GQQHRKHRRVLNPVFSINHMRNLAPLF 38943 c-helix
38894 TSTGGEVEILGWMGRAALELVGQGGFC 38814
38261 FAATDTTSNAMARILHLLAEHQHVQDKMRLELFEAGMDGEDIPYDRLVELPYLDAVCRETLRL 38073
YPPVLFMNRE (small exon?)
TRQDAVLPLSKPIQGLDGDVLTEIMVPKGTLLMVSIVACNRNKALWGEDVLEWKPERWLSPLPESIREAHVPGVYSHLYVY 
37689

>Scaffold_76 I-helix to EXXR
41033 GNLKEMFNRHGWGFHDTIIRQYGPIATVHSMLG 40935 ex2
40879 LYVYDPKALNHIILKDQYTY 40820 ex3
40647 GAHHRKQRKLLNAIFSIARMRDTAPIFYNVAHR 40549 c-helix
39822 ILGATDTTSNALARTFQLLAEHQDVQDKMRAELADAAPDGEDIPYDQLVHLPLLDAVC 39649
39648 RETLRL 39631 
      NPPIGLLARE
      ARDDIVLPFLQPVHGRDGSLINEVPVPKGSTVFISVRACNRNPL
39369 IWGEDAAEWKPERWLQPTPKSLSEARVPGVYAN 39271
      MTFLGGDRACL

>Scaffold_97 36% to CYP51
53419 AAALVAYLLYLCVVYPLRNPIRQLPGPPSKWFL 53517 ex1
53731 RLFTLDPVTMNHVLQHTAIYEKPWPSRRLISGLIGAGMLSAEGQMHKRQRR 53883 c-helix
53854 EGQMHKRQRRVATPAFSLNEMRALIPLVFSKGT 53952 c-helix
54010 GHVVNVCSWASRATFDVMGSAGFDYEFNAIQNEDNELLRAYVDMFE 54147


54509 NSAVDLPPRLSDQDLLNNINTFMFAGTDTTSLALTWTLYVLALYPHVQDRLRAELLSVAPIAPIDTLTP 54688
54689 EEVQSLYAEIAALPFLENVIRETLRLIPPVHSSIREATRDDVVP 54820
WGETA 54964
55072 GLYQHTLTFSAGPR (0)
55165 ACIGMRMSVIELKSFLFTLVTNFKFAPDPTQKIGKA 55275
55331 SILTRPYVAGKQNEGSALPLIVTPY 55405

>Scaffold_112c 3 different P450s on this sequence very similar to 77 388 417 112 129
59100 GEQHKKQRKMLNPVFSVSNLRELLPVIQPIANK 59002 c-helix 
58886 WLSRGAQEYMSQACFGWTFNALDLNKRNTYSEAARKY 58776
58384 VKANASSNEADRMTDSEMIGQM (?)
58270 STLLFAGFETTTYAISRILWVLASHPDAQARIRSEVKAAKNKYLEDGRSTASTWEDVSLSY 58088
58087 DDLMALPYLDAVIKETLRVYPPSSVHFR 58004
57810 NVWGPDASEWKPERWLNSDDKAVPK 57736

>Scaffold_12a gene model complete all boundaries checked
53199 MNNLTAALILVALALWFACRRFTRTTLRDIPGPKPVSFWL (1) 53321 ex1
53375 GNLEQYFLGQAGEGDFHLQERYGRIARLHGSIG (0) 53473 ex2
53532 GEYLWISDPNALRYIFQTSGYRYAKQPERRALSRLHSGHGLVWAD (1) 53660 ex3
53715 GEVHKRQRKVMLPAFGAPESKALLPHFARAAEA (0) 53819 c-helix
53864 VSVKWKDILTTAPSLSKELNVSTWLSRATMDAIGE (1) 53977
      AAFDYHFGALENTDTDIVRAYNNLM (2)
54149 PIVFGAPTADAIFKRDALRIFRSSRIVEWIYDRQRNPAVEKARECEELTLKIARELVENK 54328
54329 AEALEQGKGSKDIFSLL (1) 54370
54432 VKANMTEDAKSRLSEEEMYAEMR (2) 
54552 TILFAGHETTSTTISWVLLE
54612 LARHLPVQERLREEILAHKRGGELSATDLDGMPFLQAVVREALRLHPVLNQTF 54770
54771 RQAEQNDVLPLAHPLTDRTGTVLTALPISKGTRVILSIAAYNR (2) 54899
54963 DTELWGSDAHAFDPDRWLDGRVKKVQTLGMYGNL (2) 55055
55102 LTFAAGVRGCIGWRFA (2) 
55195 VYEIQTFLVELLANFEFRPTEDLKRLRREPCGVMVPTLEGDRGTVQLPLRVSLLDHKI* 55362

>Scaffold_12b gene model complete all boundaries checked, many fused exons
184563 MDTVLVGLFVALALYAWSRSSKRSALPVPPGPKPVPLLGNIFDLTAKELWLRVTGWSKQY (1) 184384 ex1
184326 DIVYIHLLGQGLVFCNTYEVAQDLLEKKGSIYSDK (GT boundary missing)184222 ex2
       CGCQNMVAFTRYGDFARRQRKLMNTAFGISAVKRYRPLLANESVLLLKRILADPQDYMG
       YIRRYAGGLTLQSVYGYRVETNDDPLLELGTECVDILSNKIASGGGIWPVDIFPF (1) ex3
183744 LQHLPTWFPGAGFKRKAAVWRAKMEEFVDKPYEMVLERM (0) 183628 ex4
       RSGATVPCFVTTLLEEARDEKGGAVDAQRDFDIRWTANSMYSASMDT
       TITVVQLFLLAMILHPEVLRKAQAELDAVVGPARLPTFADRPALPYLDAVMSEVLRWGVPVP
       LGLPHRLMEDDVYRGTHLRAGTLVFANIWNMLRNEAIWAQPDVFRPERFLEPVDEATAK
       RRDPRPYVFGFGRRRCPGLHLIEESLWIVMATLLATTDILAEKDESGKPVMPHVDFTNS (0) ex5 fused
182807 LVVPFSTPAPFKCDIRPRSEQALQLVRLAE* 182736 ex6

>Scaffold_206 
MTSAPLLAFGAALIAIIWTLFQGYLVKSPLDNIPGPERSSFWL (1) 36949 ex1

36488 GEHHRKQRKLLNPVFSINHMRHMAPIFYQTTHR 36390 c-helix
35800 VKANMEASDEDRLPEDELIGQMT
35680 TLVFAATDTTSNALSRILELLAKNQDVQDKMRTELIAASPDGEDIPYDTLVALPYMDA 35507
35506 VCRETLRL 35483
35214 IWGEDADEWKPERWL 35170

>Scaffold_187 
21928 GDHHRKQRKLLNPVFSINHMRHMTPIFYNVVHDVR 22032
22756 (0) TTSNALARIFQLLAEHPDVQDRLRAELTDAAPDGADIPYDALVVLPYLDA 22905
22906 VCRETLRL
23079 ARADAVLPLAEPLRGADGAPITEIAVPRGTPLIIAIRASNR 23201

>Scaffold_173 
3475 PSGDHHRRQRKLLNPVFSIAHLRRVTPVFYEVMNRV 3582 c-helix
4318 TFIFAGTDTTSNALARILHLLCLHPDVQEKLRAEIIEARAQNGGGDLDYDALVALPYLEAVCRETLRL 4521
     HPTHSTRRARSDALLPLSAPLTLRDGSRVSALHVPQGTSVLVAIHSVNR 4782
4786 AALWGADAHVWRPERWLEKLPDAVAEARVPGVYSNL

>Scaffold_88 64% to scaffold 12 gene model complete all boundaries checked
      MHDIFPLAVLLGALLWIVRRILSRSSIRDICGPEPESFWL (1) ex1
44607 GNLKQFFMRQAGEGDFELQERYGRIARLHGSIG (0) 44711 ex2
44761 GEYLWVADPKALQHIYQASGYNYAKQPERRALSRLHSGHGLVWAE (1) ex3
44954 GEVHRRQRKIMLPAFGAPESKALLPHFIHIAES (0) 45058 ex4
45105 LSMRWKDILLASRDFAKELDVTEWLSRATMDAIGE (1) ex5
45258 AAFDCQFGALDNGGSEVLRAYNDLL (2) 45335 ex6
      PMVLGVPTTDGIWKRDAMRIFNSSAIVEWIHDRQTNDVLQRARECEQMVMK
      VAKELVSSKAEALVQGKGSRAYF (probable frameshift here) SLL (1) ex7
45685 VKANAAEDAASRLSDEEMYAEMR (2) 45750 ex9
45809 TSSLAGHETTAMALSWALLELAQHPEVQSRLREEVRGCKRGEELSAAVLDSMPYLQAVLREVLRVHP 46009
46010 PAIHNFRQAVRDDVLPLAHPITTKSGSVLTELPIQKGTRLILSIAAYNR (2) 46156 ex10
46197 DPDLWGSDPHMFDPDRWLDGRVKKGQVVGMYGNL (2) ex11
      LSFSAGVRGCIGWRFA (2) 46400 ex12
      IYEMQAFLVELVSNFEFGPTEDLKRLRREPCGVVAPMLEGEQGVQLPLRVSLANYDV* 46616 ex13

>Scaffold_101 48% to scaffold 7 first exons to C-helix fused 507 amino acids
end of exon 5, exon 6 not well supported. gene model complete all boundaries checked
      MPLLSAVPAAALPLLG
53410 AALYVLWTFLALLVRQARSPLRHLRGPPSPSFL 53508 
      VGNLREMHDQENTALFARWEHRYGSTFVYHGFLG
      GARLLTTDPVAVAHILAHGYDFPKPEFIRDALASMAAGHEGLLVVEGEDHRRQVRA (0) c-helix ex1
      SPAFATPHIKSLSPIIWSKATQ (0) ex2
      LRDVWIDLASSPSLTPAATP (2) ex3
54377 PGTKVDVLAWLARATLDVIGEA (1) 54439 ex4
      GFGYAFNSVRAAACPGDAAEDELARA
      FAVIFSTARKFRLITVLQVWFPFLRRFVSIPPRCFLALP (1) ex5
      LKSSLSSDPSQQLSTNAMLCQIATFLAA (1) ex6
55067 GHETSASALSWALYALARAPACQHTLRRELRALTLPADPSAADLQAVLALPYLDAVVRET 55261
55262 LRVHAPVTSTMRVAAHDAAVPVGTPFRDAHGAQHAAIRLRAGDIVTLPLQAMNK 55423
55436 WGADAACFRPERWLAHGDAPREPRGLWGGVMTFGTGVVANGNRSCIGYRFAVND (2) 55597
      VVTRPCVKSEPHLGNQMPLRLRRVAVEETVGDSSGDGAPRTVS*

>Scaffold_7 47% to scaffold 97 sequence is short exon 5 not well supported
only 481 amino acids. gene model complete all boundaries checked
74171 MGYPLAVYAVGALVALIVYSVGPTVWHVLTSPLRHLPGPPNDSLLW  
74033 GNMAAIQNEEISVPQARWVKQYGHTISYRGVFG (0) 73935 ex1
73876 MWRLWTVDTRALNHILTHHLIYQRPLPSRYQLSRLVGPGVLVTE (1) 73748 ex2
      EERHKHQ (0) ex3 part of c-helix
73635 RRVMNPAFGPAQVRELTEIFTEKANEMRDVWYNEITKAGGASAQ 73549 ex4 part of c-helix
73497 VDALSWLSRATLDIIGRA  73438 ex4
73437 GFGYDFEALTGASNELNQAFSTLFARPIARHRFFA (2) ex4  
      RIGMQLIEQRKAAILAEKGKDVERKDLTGRDLLTLLIRANMATDIPEDQRLSDEEVLAQ (1) ex5
      VPTFIVAGHETTSTATTWALFSLAQMPEIQRKLRNEMLTIDTDTPSMDQLNSLPYLDAVIR
      ETLRFHSPVPVTTREAMADDVIPLGTPTVDRYGRTIDHINIKKGDLVFVPILAINRSKEIWGEDVDD (2) ex6 72585
72529 RPERFENVPEAASTVPGVWGNVLSFLGGPRACIGYRFSLVD (2) 72404 ex7
      IVTRPVMTGPDGKTRGALPLIIRPYRP* ex8

this EST supports first half of exon 5
>gi|6433584|emb|AJ274211.1|AJ274211 AJ274211 Metarhizium anisopliae ARSEF 2575 Metarhizium anisopliae

Query: 16  SRIGMQLIEQRKAAILAEKGKDVERKDLTG 45
           +R+G  L+  R+AA+  E G D  R D+TG
Sbjct: 442 NRVGSTLVPGRRAALAHEVGDDGIRVDITG 353

>Scaffold_311a gene model complete all boundaries checked
MSSLLVLVAISLALSQLIRFYRWLFHHSISYLRGPVADSFIL (1) ex1
GNVREFTYQESVGDLDFRYMNEYGTAWRMKSILG (0)
1636 SDVLMICDPKALQHVLHKSGYHYPKNTEARIGSFNVTGRSILWAP (1) ex2
NGDIHSRHRKIMNPAFTAQQLRSFLPLFRRGSNK (0) C-helix
MCQLWKDEVLAQAPTGMTIAVNQWLARTTLDVIGE (1)
AAFDFSFGALDDADNEVSKAYHNML (2)
FADSLLYPSAWSTIFRGLWRFIPDQLLSYVRYLPTREYTRFRYTLNIINKVSKSLIDQKS
EDLLSGDKSSKDVMSVL (1)
VRANSSENPRSQLSEEEMVSQMATLTLAGHETTANTITW
LLYELAKHPEYQQKMREEIAVKRAEINARGDADFTMDDLESMQYLHAALK (0)
ETLRYHPIVYHLAREASKDDVIPLAYPVTTIKGETVSEIPIAAGQIIMPNIAAYNR (2)
LPQVWGDDAHEWNPLRFIDDSPEVQVRLGMFGNL (2)
MSF (1)
FAGVRGCIG (2)
WRFS (2)
LIEMQAIVADLVENFQFSIPPEKPEIIRVPAGIMGPMVKGKMHEGLQMPLHVTPL*

>gi|6934623|dbj|AT002896.1|AT002896 AT002896 POSLM01 Pleurotus ostreatus cDNA clone 
355LM.
          Length = 615

This EST from another basidiomycete supports the small exons in this gene

Query: 1   LPQVWGDDAHEWNPLRFIDDSPEVQVRLGMFGNLMSFFAGVRGCIGWRFSLIEMQAIVAD 60
           L  +WG+DA E+ P R+        V  G++ N+M+F  G R CIGWRFS++EM+A++  
Sbjct: 177 LVSIWGEDAFEFKPERWQSPPEAASVVPGIWSNMMTFLGGPRACIGWRFSIVEMKALLFT 356

>Scaffold_311b gene model complete all boundaries checked
     MAAAALLIICWLVVNLRRLLTHNSIRHLRGPPSASTLF (1) 7990 ex1 
7939 GNVTDTLYQASVGDVEFRWLKEYGGAWRLRGLLG (0) 7838
7785 ANILALADPK (0)
7716 ALQHVLQKSGYNYPKTRQLSVTLFNLTGRSILWAP (1) 7594 ex3
     TGEIHARHRKVMNPAFSVPQLRSFIPLFRQSAKK (0) 7436 c-helix
7388 LTQIWKDQVNAGHPDGVTLPVDRWLARATLDIIGE (1) 7278
     AAFDFDFGALDNTENEVSKAYHRML (2) 7150 ex
7097 FADSQLYPSVWNLLFQATWSLLPEPLLYYIRYLPTREYKTYRSTLSVMDKIAAQLIEERT 6918
6917 REFGAGDPDKSRKDVMSVL (1) 6858
6810 VRANMSENPSTRLSDEEMRSQMFAMTLAGHETTANTVT 6697 frame shift
6694 MLWELAKHPDIQEQLRQEIAEKRVEVTANGSYDFALDDLETMPLLQAVIK 6545 (0)
6487 ETLRYHPISSFLWRVAAKDDVIPLEKPIVTTTGETITEIPVAAGQVIMPSLCSYNR (2) 6317
6262 LAHVWGEDAHDWNPMRFLEGDTEKQTKVGMLSN (2) 6161
     ITF (1)
     SAGVRSCIG (2)
     WRFS (2)
5885 VLEMQAIVVELVENFRFSLPDNKPEIIRAPTMTMGPMVKGKLHEGFQMPLRVVPV* 5715

>Scaffold_51 gene model complete all boundaries checked
      MFHGYLSATFQAQRRP (1)
59426 GNIKDFTYQQNVGDLDFQWVKQFGRVWRMQSPFG (0) 59313
59268 TDILALADPK (0) ex2
      AMQHCFHKADDQYNKRVESTVGSRMMMGKGLVWAS (1) 59080 ex3
      GTTHERQRKIMSPAFTTAQIRSFLPFFRAGAAK (0) 58924 c-helix
      KWRDELFNHSTDGAAVPVNKWFSRATLDILGE (1) 58772
58730 TAFDFNFGAVDDKDNEVTLAFHTML (2) 58647 ex4
58600 FANSCLRPPKWDLLFKRIWYFLPNPLLELVQYVPTKEQNRFRRCRLVVEKVSQQLIQEKR 58421
58420 EALLAEAKSSRDIFSVL (1)58361
58325 VRANVSENPNSRLSDEELIAQMGTLVLAGHVTTATTLSWMLYELARRQDYQDKM 58161
58160 REEIVAARARLQERGQQDFSMEDLENMHYVSSCLK (0)
      ETLRFHPPVYHLFRQANTDDVIPLEQPVRTTSGKYVTEIPVAAGQQVLFSVCAYQR (2)
      LPEVWGEDAGIWNPMRFIDGNVDKQSKLGLYSNL (2)
      MTFSAGSRGCLG (2)
      WRFT (2) 
57475 IVETLAIIVELLEHFKFEPTEDTAKVIRVPTGIMSAFTAGKEREGPQMLLKVVPIL* 57311 

>Scaffold_4a 
47837 SSPLVLLACTVCVAVLAFRWYSSSTHGSIAHIRGPP 47730 first exon
47659 GNIRDFSYQENVGDLDFAYMKEYGTAWRLKSSLG (0) 47555
47500 KSVLMVADPK (0) ex2
      ALQHIFHKSGYLYPKTTPSTVRSFLVTGKSILWAP 47318 ex3
      DGNTHSRHRKIMNPAFSAPQLRSFLTLFRKSSSK C-helix
47119 LCQLWRDEISPEGSTVLVNKWLARTTLDVIGE (1) 47018
46975 LAAFDFDFGAMQDNQNELSVAYDNML 46898 ex4
46857 YLLSTDATLHTSPWNAIFEALWDYIPDGILKQVQHIPTREYARFKQTLGVFAKYSKRLIA 46678
46677 QKSADLVSDTHSKDVMSVLG
      VRANAAEDAGRKLNDEEMVSQMSALTLAGHETTANTISWLLYELA 46438
46437 KHPDFQEKMHAEIVAKRAEIVARGDEDFTMEDLESLEYLQAAIK (0) 46306
      ETLRYHPIAFHLNRMASQDDVLPLAYPVMTTAGEKVTEIPVRKGQAIMPNLAAYNR 46087
46030 IPEIWGADAHEWNPMRYIENRTDAQVRVGMYANL 45929
45819 PAAGVRGCIG 45790 
45671 SLIEMQAIISDLVENFRFGLPKDRPEVLRVPAAVMAPMIKGRMEEGAKLPLHVT 45510 last exon


>Scaffold_4b 
55457 SGACVLCLAWLAYRWYRWTTRLNISYIRGPPVKSWILG 55344  ex1
55296 GNVRDFAFQENVGDLDFKYVQEYGLVWRMQQPLG 55192
      AQVLMVADPK 55117

GDIHARHRKAMNPAFNNAQLRSYYPCFRRTSSK c-helix
VCQLWKDQILSQGPNGATIRVDRWMARAALDIIGE (1) 54655
AAFDFDFGALDDSANELSAAYHNML 54522 ex4
54464 SADSTLRPSAAQAVFQGLWTHAPLRVLERVRHLPLRDIARFQHAMRVFNTYAARLMARGA 54285
AGAAHGRDVMSVLG 54228
TAHANASADPRTRLSAEEVRAQMCALTFAGHETTANTTTWLLWELARHP 54035 frame shift
54036 PAHQDSVRADTVRRRAHVAARGDADFGVEDLDALPCLEAAIR (0) 53908
ETLRCHCIVFHLNRVASQDDVIPLSRPLTTATGKTVTEIPVAAGQVVMPNIAVYNR 53681
TRTKWDPTRFLDGRVDNPEVRLGVYGN
LRTF
AGGVRGCIG
53275 RHRMIEMQAIVADLIGHFRFSIPDDKPEIVRAPSMLMAPMIKGKEHEGSQMPLHV 53096 last exon

>Scaffold_4c 
74181 IFTAVLAVTVVSLLTRRKNGRHVPPGPKPLPFIGNALQIPPQHEWIKFKEW 74333 exon 1
74622 YGPRLRESRKMLKKGMGPAAVKTYYPYINREVPFFLENMLRKPDSFVEH 74768 ex3
LKIAYGYEGVTEDEKIIRGGVDAMEVFSAVAAPGVWV 74961 ex4
75028 VKYVPSWFPFAKFKKFAERGKKITDEALDTPFYEVKRRV 75144 ex5
75378 TTATLSWFTLAMAKYPEVQKKAQAEIDRVIGKDRLPEVGDRDSLPYVWAIMQETFRWH 75551
75552 PTITMSGY(?) ex7,8
75626 VPHTAIQDDEYRGYFIPSGTTLMANIW 75706 ex9
      RERRSWPISGACPLRLMF 75731
75732 EVIYHVHRG
75759 ILHDEKLYHDADKFIPERFCDEGAPDSLSVAFGFGRR 75869
75913 RRVCPGLVIAQTHVFVTMASMLATFNITKARDSTGAVIEPREDAKSGVI 76059 ex10
76131 PKPFVVSITPRSDEAVTLIRRSV 76199

>Scaffold_4d 
77219 VLALLLASVLTKARRKARNLPPGPKPLPFIGNAHQIPPENEWIKFKEWGDEY 77374 exon 1
77654 PYGQRLRESRKLLKKGTSPAAVKTYHPYINRDLPFFLENMLSTPDKFVEH 77803 ex3
      LKIAYGYEGITEDERIIQGGVKAMEVFSATAVPGVW 77995 ex4
78078 VRHLPSWAPFSSFKGFAERCKRITDEALNTPFYEVKQRL 78194 ex5
78431 TTATLSWFTMAMAKYPDVQEKAQAEIDRVVGRDRLPEVGDRDSLPYTWAILQETMRWH 78604
78605 PTVAL 78619 ex7,8
78678 VPHTAIQDDTYGGYFVPAGTTVIANVW 78758 ex9
78809 AMMHDENVYHDADKFMPERFYEEGAPDSLSVVFGFGRR (?)
      ICPGLVVAQTHMFVTIASILATLNISKARDNAGNVIEPREDAKSGVI 79126 ex10
79190 PKPFQVSITPRSDAAVQLIRRSV 79258 ex11

>Scaffold_4e 39% to CYP61 
199360 LFAGVLLVCLFVSYARKRPRYPPGPKGLPLIRNLLDIPADYPWITYRDLAEKYS 199199 exon 1
199149 SDILHFEVFGSHLVVLNSAEATRQILEKQSSITSDR 199042 exon 2
198893 DRTVTFMEYGESWRRHRKLFQEHFRQQAIPRYHHAQTKGVNRLLKSLLDTPEKFSAHIR 198717 ex3
198422 VRYVPSWFPGASFKRLAGKWKKAVDDMYTIPYNNYK 198315 ex5
198012 TALGIFIMVMAVHPEAQISIHEELDRVLHRDRLPTMEDRKELPRTTALMYETFR 197851 ex7
197726 VPHQTTAAIHYNGYFIPQGANIVANSW 197646 ex9
197594 AILRDEGLYPDPETFKPERWLDADGSLRDDMRFPVEMFGYGRRICV 197457
197456 GRHFAEDIVWLAIASILSVYKIEPPVDENGTVRALEADFTPRL 197328
197267 PKPFKCRFTPRFPGAEGLIRASL 197199

>Scaffold_4f 
202911 VSCASLLILHTRRRPRYPPGPKGLPIVGNLLDVPTHNAWIKYKQLGKKY 202765 exon 1
202710 GSDIIHFEVFGSHIVVLNSTTVARDILEKRSQISSDR 202600 exon 2
202451 ERNFGFMRYGDGWRRQRRLFQQHFRRKAVTQYHAIQSKSVHSLLNALLDRPERFIANLR 202275 ex3
201827 VKHIPSWMPGAGFKRKAAEWKVLVDDMYEVPYN 201729 ex5
201418 VGTLSIFFLAMTIFPSVQVAAQEEIDRVLGRKRLPSIEDRNALPRTTAIVYEVLRY 201251 ex 7
201128 VPHRTIADDEYNGYFIPAGTTIIANAWY 201045 ex9
200996 AMLHDEERYPNLETFIPERFLNKDGSLRSDACIPLEPFGFGRRICPGRYFAEDIVWLAI 200820
200819 ASILSVFRVEPPVDEHGEPLKQTATFGTRFL 200727 ex10

>Scaffold_4g I-helix to heme (others in 4 do not have this intron)
276990 XXGRPFRVASPLRWQYIVSSPELIDELRRAPD 277079 ex3
277376 WHPVVAHDTNVRIVTQTSSRIFVGLPLC 277459 ex5
277508 RDPELLKITMSYTPTVMKTGLLLKVLPRPLQ 277600 (?) ex6
277653 RFVQRGSGSIDALIDRAHRLLLPTIEERRRMMDKYGAEWLDKP 277781 ex7

278020 GFTVALYRLATHPEYVQPLREEVEAVIAQDGWTREAFRKMPKVDSFLKECMRLQGPXX 278166 ex9
278240 VLLQRKAMQDFTFSDGTFVPKGSHVATSIVATHCDSAYYSDPLTFNPWRFVGAEDDAQDS 278419 ex10
278420 KHRFATTSPEYLLFGYGRHA (2) 278479 ex10
278542 CXGRFFAEIQLEMMMAYVVTTYDVRMEKPGVLPEPIEFGSMSLPSMTAKVCFRKR 278700 ex11

>Scaffold_10a intron in heme CYS (10b does not have this intron)
85346 LQDIPTVGGPNLPFFSYFGAIHFLVRANKIISDGYSK 85236 ex2
85184 YKGGSFKIAQVNRWLVFVTDPALNEELRKAPEDQMSXXXXXXX 85077 ex3
84951 YIEVLRDQLLRHVNPSPAMLYDEMQASFQDFIPXXXXX 84853 ex4
84790 WTPIPALSTSLKLFLRMSNRAFVGTPLC 84707 ex5

84265 SFTSVLFLLASRPAWQAELRAEAAAALAHGYTRDALARLRKLDSFVQESLRFNXXXX 84107 ex9
84029 XXXXKLALTDFALSN 83997 ex10
83996 GTVIPKGTLVSAPLRALHLDDEVYPDGASFQPWRFVRAGGEAAPRQSLASTSPTYLPFGHGKSA 83805 ex10
83742 CPGRFFAALELKMVTAYLVLNYDLKLE 83662 ex11
83661 GDATEVPPVSWFITARVPNYKANVLVRRR 83575 ex11

>Scaffold_10b 30% to CYP51 
123796 SAVVAVWVMYELASRPTYIPAIREELLAVAELQADGSHYLSYDSLRNARLLDSFIREVMR 123975
123976 LKGDTLGVCRQTVQDTPMGQYVIPK 124050
124170 EVFDGFRWVERNLPAVMVGPTYFPFGMNRWACPGRVLAVS 124289

>Scaffold_151a 
17010 LPPGPRPLPLIGNLLDAPSAYHWETFAEWN 17099 exon 1
17166 DVSSITILGQRMVILNSLDAAIDLLEKKSSIYSDR 17270 exon 2
17564 AGAIILNMGYGYQVKEGHDPLVDLVDRAVNGFVAASTPGSFL 17689 ex4
17759 VRWVPAWFPGAGWKRKALTWRADTRATCDVPFEFAKQ 17869 ex5
18105 VSAITTFFLAMTLYPEVQKRAQQELDAVLGAGRLPTLDDREQLPYTRALVSEVFRWNPIGPL 18290 ex7,8
18343 VPHVSTEDDEYRGYFLPKGSIFIANIWY 18426 ex9
18895 HPQPFKCSIKPRSQRAEELIR 18957 ex11

>Scaffold_151b 
19497 DVVFALLALYLIVRFLQKDRTLPFPPGPKPLPLIGNLLDMPSTYQWVTFADW 19652 exon 1
19727 DISSVTVLGQRIVILNSLDAAVELLEKRSAIYSSR 19831 exon 2
19898 GELFRDIRRFLHRYIGSRGQLERVAPFYELIETSTQDFLQRTLADPVRFVEHIR 20059 ex3
20119 AGAIILNMTYGYKVQEGYDPLVDLVDRAVDGFVAASTPGSY 20241 ex4
20326 VQWIPSWFPGAGWKRRAEAWRADTQAMCDVPFEFAKQ 20436 ex5
20677 VSAITTFFLAMTLYPEVQKRAQEELDAVIGTDRLPTLDDRERLPYTRALVSEVLRWNPIGPL 20862 ex7,8
20931 VPHVSTEDDVYRGYFLPKGSMFIANIW 21011 ex9
21089 ILRNPDTYSEPLRFKPERYLGEQPEMDPRCAVFGFGRRICPG 21214 ex10
21447 HPQPFKCSIKPRSKKAEELIR 21509 ex11

>Scaffold_23 
40506 VENPMVVLDTAGTVNDLFEKRGTSYSSR 40423 exon 2
40323 FTTMQYTT*WRKHRHLFHQHFNTSAMHVSRPVVLREAHTFLHNVSRTP 40180 ex3
39883 VKHVPAWFPGAAFKKQALQWREANRMMLNVPLEKVQQ 39773 ex5

>Scaffold_69a 73% to scaffold 247
6369 GAHLVFKRWEPKKLRVVTFLLFLVPACLSTLLLPHFGTALG 
6246 LTVGFLTYWTALTLSIVFYRVGPLHPLYQYPGPLPAKISKWWHVWHVQQGKQHLYLQQ 6073
6072 LHDKYGDIVRIGAS 6031
5984 GPNEVSIRDPACITPVLGAQGMPK 5913 
5841 GRNMWPETAPLIGYRDPAEHMKRRKPWNRAFSSASVKEFEPIIQHRVHQLVEALSDRQGQVVD 5653
LAEWISFFTY (?)
DFMGDM (?)
5311 XXXXXXXVPWVSYYAKKLPWTAQDNKAMRVMAFSRTEQRYASGSASKDLFYYLV 5171
5117 SNEDGSEKVSPPRNIVIGDGLLALVAGSDTTATVVANTMYELLRHPAAYRRLQEEVDKFY 4938
4937 PRGEDSLDPKHIKDMHYLEAVM
     SNEGLRMYPAVPSGSVRAPEVGKGGKIAGP 4716
4663 SYIPEGTQTRIHFWSVQRDARNFSFPETFWPERWLIAEGIEPAPAGEKLVHNPNAFTPFS 4484
4483 FGPYNCVGKNIALAEMKQLLCHLVHKLDVRFADGVDPDAFDRASEDRFIYVVGELPVVV 4307
4306 ERR 4298

>Scaffold_69b 
9838 MQAAHLVFNRWEPTNIAVVAALLLGVPCAAASLLFSGRGFVPRLALTAALYYACLGTSVV 9659
9658 LYRLSPWHPLARYPGPWLLKTSKLWMVRRVKRGGQWRYIRELHQRFGDVVRIG
9447 GPNELSFCDAAMVVPVLGTQGLPKGPG 9367
     LIALRDPLEHQRRRRTWNRAFKPAALQEYLPLIQKRTAQLLDALSKCEEQDV 9119
9118 VDLGRWIRFCKY 9083
8817 AHMPWLAQFTKHIPRVAAKLKELRAAARSRAAARYKAGANRKDLFYYLVGD 8665
8623 SNEDGGEKEQPTEDVILSDALLAIIAGSDTTSTILTSAVYCLLTHPDVHKRLVEEVDKFY 8444
8443 PPGADWCNTEHHADMHYLNA 8384
8325 NETLRLFPVLRDGSLRAPWVGHGDRALGP (?)
     SSFIPEGTQVRVHTY 8146
8145 SLQRDPRCFSQPDTFWPERWLVAGGLQHAEPGFVHEPGAFLPFSRGPSDCVGKGLALQ 7972
7971 DMRIVLCALLQHLELAPPRNRPFDEWKAEVDRRFADSSAVLPVSVRVRRRV 7819

>Scaffold_90 
91112 XXTTHGSRFPKSIEQYKILTFFGGNIVASEGEHWKRSRKIAAPAFSE (0) 91246 c-helix
91305 XNNKLVWDETRLILQDLFTHVWGKRAEIHVDYAVDITLLX (0) 91418
91505 KIALFVVGVTCFGRRIPWQNEDVVPAGHTMTXXX 91597

>Scaffold_99a 46% to 164a
4124 LLSLYDTLDRSTTPLSVLLPWLPSPSMLAKLRASKQVYDIVDGAIRARVASGVSRDDTLQIL 4309

4782 IPSGAYVVYPFSDIHLDPRLYPDPWRFDPSRPESKSNIGYVGWGGGE*SFVACPSIDTFL 4961
4962 THFLLPKGRTVCLGQRIAKLQIKLVLSMFLLHYDFDL 5072

>Scaffold_99b similar to 313
14609 FGFGMRACIGRPFAWQEAIIALAVLLQKFDFVLDDPSYELE 14487 ex10

>Scaffold_95 73% to scaffold 249
67473 KSVHLIFKRYEPMHILVVSTLLLLLPAILTVPLIDQLGIAKGFLVAFATYFATLLSSITLYRI 67285
67284 SPFHPLARYPGPIIAKVSKIYHVAQVWSGKQHLYLQRLHDRYGDIVRFGGFSTCSLR 67114
67090 GPNEVSIRDVSCIAPMLGTQGMPKGP (?)
      GKHCWPEIHTLI 66911
66910 GCSDIKEHQRRRRPWNRAFSTAAMKEYNPIIQKRLQELGDALAARQGEVVNLADWISFFT 66731
66456 HVPWLSYYTRNIPGATNDEFRGMVFGQTVKRYACTGTTKDLFYYL 66322
66260 NEDGAEKEDPPKPIVVVDGAVALIAGSDTTSTVLASTFYCLLRNADTYKRLQAEVDRFYP 66081
66080 PGADSLAPDHLPEMHYLEA
65962 EALRLFPAVPSGSQRTPERGSGGKTIGP 65879
      SYIPEGTQTRIHFWSVHRDPRNFSRPETFWPDRWLIADGLQKDEGVE 65688
65687 FVHNPNAWIPFSLGPANCVGKNLALQEMRMVLVHLLHRFSFRFAGDYNP
65540 EQYEWDIEDRFVVAVGRLPVIVERR 65466

>Scaffold_204 
4685 DLGHLPYGDEWKLARKFFTQHVR 4753 exon 3 partial
4930 SVKYGIDVLSADDPYIVNARQALNAINAAGNVGSYL 5037 ex4
5877 ALPHDRARYPAPDTFCAERSLTADGALDPAMPEPVAGHRFGRHAHGAGHALD 6032 ex10
6001 GMHMAQDTLWIVAASLQRAFRMERAVDVSGAPVPVTGEHTVGVV 6132 ex10

>Scaffold_59 56% to 205b
8666 IVLAVIVACSIALLLFQRRPHLPLPPGPKRWPVVGNAFRFPKEREWLTFMRWSREF 8499 exon 1
8433 GSDLLYYEMWGRPFVVINSHRAAVELFERKSALYADR 8323 exon 2
8162 DLAFMPYDETWKLARKLFTQHFRAGAAGRYRDEETRCARELLADILRDDTQLFEHAR 7992 ex3
7932 GKLIMSVTYGIDVRSADDKYITNAQKALYAITATGNVGTYL 7810 ex4
7733 VKYIPEWFPGAKFQREAREWREAAEAMSQRPVEDVKIAM 7617 ex5
7329 SATLTVVLAMLLFPEIQERAHAELDRVVGMDRFPVFEDQPSLPYITAICKE 7177 ex 7
7043 AVMHRVTQDDVYNGCHIPGGATVVLNSWY 6957 ex9
6910 AILFDPDQYPNPEPFAPERFLAPSGELAPDVPEPTAAFGYGRRACAGTAMALDTLWIVV 6734
6733 ASLLWAFDIRRAVDEMGNEIDVAGEYTFGVV 6641 ex10

>Scaffold_82a 
66881 AVVKESLRMVIGVVHPMTRIVPPQGAVLCDMFIPGG
66953 GAVLCDMFIPGGVCTLLHL (?)
      YFLHHNEDVFPQPRTFKPERWLARE 67132
67133 SDKEHMLVSFSRGPHSCLGVKCVSPFPNMANTDPKSSMAYCELYLAFAYFFRRYDVELN 67309

>Scaffold_82b 58% to 144
94829 QATHLVFNRFEPTELPVVAAALVGLPAVLSALLVGHFGLLAGAALAFATFHATLAASIVLYR 94644
94643 LSPFHPLARYPGPLPARITRWYWARVACGGRQHLELKRLHDVYGDIVRIGE 94491
      IVGPNELSFRDISVVQPMMGAQGMPKGP 94077
      RTFKPPILPLVGMRDVADHTRRRRPWIRAFTPA 93919
93918 ALKEYEPVVAKRGAQLIEILAQKKHTDFVHWIHLFT 93811
93580 HIPWLGYWMRHFPQLATATKQYRAMCFQRGMQRYQDGSSQKDLFYYL 93440
93389 SNEDGAEKQTPDKATVIADSALAIIAGSDTTASVFSNMVYCLLKNPHAYKRLRAEVDEFY 93210
93209 PPEENSLDPKHHSKMPYLEAVM
93093 NETLRLYPVVPSGSQRAPELGTGGTLMG 93010
92950 SYIPENTSVRVHFWSVHRDPRNFSQPESFLPERWLAAEGLEA
92770 GTFVHNANAYMPFSFGPWNCVGKALALLELRCVATHMMQRLDVRFADGWDPAEWDAAMED 92591
92590 KFVIKTGRLPVVVERR 92543

>Scaffold_311c 50% to 205b gene model complete all boundaries checked
16862 MDTLLLAGLVAVAVVAAGCLAHSRRQRFPPGPKGLPLLQNLLDVPRHRPQWEAYRDWGLKY (1) 17032 exon 1
17095 NSDIVHLRLFGVSFVIVNTADAVTELFSRRSSVYSD (2) 17202 exon 2
17336 SIGWEKAIVMKNYGEDWREHSRLFHQSFQPKVIQEYYPRLYEEARKLLPRLLKGDDFVASLRV (2) ex3
17573 MTASAILGVTFGMEINDSNDPYVTIADRAIQSLVEAGMPGSYM (1) 17701 ex4
17825 VRYIPSWAPGGKFKRDAAEWRTLVSDMFTKPFEHIKSAI (0) 17932 ex5
17998 RHGVARPSIATSLLMGLDDKQDNARREHVIRNVTGTAYV (1) 18111
      GAADT (0)
18236 TVAALRTFILAMVMHPAIQKAAQAELDRVVGRDCLPTFADREHLPYLTAIQYEVLR (2) 18400 ex7
18546 RANADDEYHGYHIPKDAIVLGNIW (2) 18623 ex9
18683 AILHDPARYRDPAAFDPARWLTPDGALRADAGDAMLAFGFGRRICPGRHYAVANMWINM  18859
18860 AYMLAAFDIAPPRDAAGRAVPPAGEHTTGLLT (2) 18955 ex10
19024 YPKPFGAVFTPRSAAALRLIVADADD* 19104 ex11

>Scaffold_490 MOST LIKE 311C gene model complete all boundaries checked
4818 MGVLILCAIAILAALLCYHHFRARRFRLPPGPKGLPIVGNVLDVPKDGPGWLTYERWSHEY (1) 4636 ex1
4582 GSDVIYLNLLGSSIVILNSSKATTDLLDKRSPIYSD (2) 4472 exon 2
4334 SVKGDRAFAFLGYGDEWRQHRGIFHKYFHGQAVHNFRPKMLEEARKVLVRLQSTDDYDRCFRV (2) 4179 exon 3
4102 MSAASILGVTFGMDIEDINDPYVVLAEEAINYVLSAAIPGSFV (1) 3971 ex4
3850 VKYLPAWAPGAGFKCKGAEWHDLVSRMILTPFETLKQKM (0) 3734 ex 5
3680 AEGTAKPCIATAIVQKLEESKGGDAQRETQIAQYVTGTAYT (1)  3555
     AAADT (0)
3428 TVSSLCTFILAMVLNPEVQALAQEEIDRVIGTTSLPDYTYRDSLPYVSAIMYEVLRWRPVAPL (1) 3243 ex7
3185 GVPHRLMEDDEYEGYHIPGGSLVVGNIW (2) 3102 ex9
3049 AITHDPVRYLNPDAFDPTRWLTTDGQLGDVTDALVAFGFGRRVCPGRHYALEALWITL 2876
2875 VHVLAAYRIEPPVDAHGRARPPSGEYLPGFIA (2) 2780 ex10
2712 FPAPFKAVFKPRSPVALGLIQTALG* 2638 ex11

>Scaffold_453
3219 VQWGDMWRETRRVYANQLRECMIP 3148 exon 3 partial

>Scaffold_32 
67132 WGRMWEETRTVYAQRLDEC 67076

>Scaffold_117 perf-heme 
8472 IWGADAEVFNPLRHQQRTPTQEKALLGFGAGRVMCVASRWAPHAAGIIVASISE 8311

>Scaffold_431 50% to scaffold 205b
791 LVIILLVRWAARQRQDRKQGPHPPGPPGLPLLGNLLDMPDNPSWMTYIRWSEKY 952 exon 1
1008 SDILRLNVLGSNIIIVNSLDAANDLLDKRSAIYSDR 1115 exon 2
1254 GWNVAFRRYDDTWRNGRRVFQHELGPQVVKRFRALEEHATHQLLRNLL ex3
1479 SMSAFEILRIAYGIEVTGREDPYVDTAEHAVGAVVATCSPGSYL 1610 ex4
1679 VKHIPEWVPGAKFKQDAKVWRRYVTELRDKPFSVVKERI 1795 ex5
2096 VSALGSFILGTVLDPAIQARAHADLDRVCPGRLPTFDDQPELPYIDAIVKEALRWNPVLPI 2278 ex 7,8
2330 VAHCSIADDVYRGYFIPKGSLVLANSW 2410 ex9
2411 AILHDEAAYADPLRFHPDRFMAGDALDGRVREPDAAFGFGRRICPGRYMAYDAIWIAV 2584
2585 ACMLAVFRIDKAKDAQGREITPSGEYNVG 2671 ex10
2742 YPKPFPCDIRPRSSAHEALIR 2804 ex11

>Scaffold_400a 
12645 SDVVTFDVLGTTVVILNSLKAATELLEARSAIYSDR 12538 ex2
12169 SLAGRQILHIAYGLEIRDRADPWITAAEHGVEIAVKCIIPGSYL 12038 ex4
11971 VKYVPEWFPGAGFKRQARIWKKEVTSIADAP 11879 ex5
11561 STLATFFHALSRHPAVLYEAQRAVDRVCAGRLPTFADYDALPYIHALLRECLRWRPVVPL 11382 ex7,8
11312 HRASKEDVYEGYRIPAGALVLANNWY 11235 ex9
11175 AIMHDPAAYTDPEDFNPRRFLRARAGAGANGSGADDSLELDPGVRDPGVAAFGFGRRACP 10996
10995 GRYMAYESLWIVMASVLTVFDVLPAEGDEGEVEYTDGFLS 10876 ex10

>Scaffold_400b 
14939 PAGATFGFGRRIRSASAFSHVRIASVLDTFTI 14844 ex10

>Scaffold_219 
14119 KSPSSVPGSHMAPPETHEIHTAGSAWRARDYRY 14021

>Scaffold_60 
7597 REIHHPLPLPSRSYVPPSPRALLA 7668

>Scaffold_45a most like 205e
gene model complete all boundaries checked  
107776 MLDTTPFTLALLTVGAVCLLGLIKGASRRRRLPPGPKGVPLLGNIFDAPKEHEWRTFKEWGRTY (1) 107585 ex1
107530 ESDVVHFGILGTHYVVLNSAWAALDLMDKRSHNYSD (2) 107423 ex2
107260 KTGWDRNWGFMKYGDYWRAHRRMFHQHFRPNAVSAYHSTSQQAVRELLRLLYAKPEHFKEHIQ (2) 107078 ex3
       HMTGYNIIKLMFGVAVSPEDDPILARMENALRILGKIANPGVYL (1)
106755 VRFIPSWVPGAKFKRDAEAWKPVIDKTYTQVYEEIKTSY (0) ex5
106582 ANGSPVPCLVTEMLEDVLKVDNEAYRDMLEDVIINGGGTAYV (1) 106460 ex6
       AAYDT (0) ex7
106326 SSSVLSTFVLAMLLYPDVQRTAQEELDQIVGPDRLPTMEDQPSLPYVTALATEVLR (2)106165 ex8
       WRPALPI (1) ex9
106037 GVAHKSVVDDEYRGYHIPGGSVIIPNVQ (2) 105954 ex10
105903 AILHDEGSFPDPDTFNPRRFLDSEGQQLEELTGIVSAAFGFGRRICPGRYFAKDVVWLTI 105724 ex11
105723 ASVLSTFNIEKHFNEAGNAVEPSGEYTPGIIS (2) 105628 ex11
105574 YPAPFKAAFKPRSESAVELVR* 105509 ex12

>Scaffold_45b pseudogene of 45a N-term missing, beginning of exon 2 missing
end of exon 5 missing gene model complete all boundaries checked
110266 PGPQGLPILRSLFHAPAQFQQLAFQDWGHRY (1) 110174 exon 1
110084 IVLNCAQPASDLSDNRSTVYSD (2) 110016 exon 2
109872 KGGW (frameshift) DRNMGPLAHSAYWREHRRL (deletion) APHHFKDHVR (2) ex3
109459 VRHIPAWLPGAQFKRAAARWRSIVEEVF 109376 ex5 (AG boundary missing, GT end missing)
       (0) DSGNPEPCL (frameshift) AACLPTSHRDREDTLMLENVVINTSGTAYA (1) ex6    
       AASGT (GT boundary missing) ex7
109046 (0) TTTTLLAFILTTMLYPDVQKAVRQELDSVVGQGRLPEMADRNALSSIPALMKECLR (2) 108885 ex 8
       WRPPLPL (GT boundary missing) ex9
108739 (1) GVPHRSTAEDE*RGRRIQVPAGSTAIGNAW (GT boundary missing) 108653 ex10
108464 XXXXXXXXYSDPEAVKPWRFFDAAG (frameshift) ex11 AG end missing 
       FGYGRRVCPGRHCLLDFVWLATANVLVVCSIEEP 108363 ex11    
       (frameshift) FDGQWDTVEPSEQHTTGTII (2) 108305 ex11
       FLAPFEAVFKXXXXAHVECVR (stop codon missing) ex12

>Scaffold_313 I-helix to EXXR similar to 99b
3814 SAGMLTFILYYLLKNPEAMRKLREEVDTMIGSRTMTVDDVHKLPYLIGGKTPFLSS*RRG 3635
3634 ADFSPAVMRETLRLGPPAPARGTAPFEDTLLKGKYPVAKDGRIYCGIYMVHRDPKVW 3464
3463 GE 3458

>Scaffold_603 PKG to PERF
681 YALPPGTIVATQAWSMHRDEDVFPSAETFLPERWL 785
898 VPFGVGTRQCGGQNLAHLMIRIVVAVVVRNCEVRADVRETNERSMSMRDAFV 1053

>Scaffold_258a PERF
21435 TSRILRLLCSLWGPNIFAANGEEWRKHRRIINPAFS 21328 c-helix
20563 (0) TVAHTLDAAFALLALHQDFQEEVYQELLEVMPXXXXX 20468
20098 HNPRIFPDPEAFKPERWYNAHENDMSMFSFGARAC 19994

>Scaffold_258b PERF
25641 IFAANGGEWKKHRRVINPAFS 25703 part of c-helix
26448 (0) XXXXXXXXXXXMLALHPDFQEECYREILKVMHTNXXX 26516
26879 HNPKLYSDPEKFLPERWYNTHENDRTMFSIGAQAC 26983

>Scaffold_242a EXXR to PKG
Sbjct: 18658 DSIDLTSAVMREALRLGPPAPMRGAASFEDTLLKGKYPVAKDVPIYCGVYMVHRDPK 18828
Sbjct: 18829 VWGE 18840

>Scaffold_242b EXXR to PKG
28756 AVMRETLRLSPSAPARIVQAMEATTLGGGKYAIAKDDTLLIATYVSQRDP 28607

>Scaffold_242c EXXR to PKG
Sbjct: 33958 AVMREALRLGPPASARGASPYEDTTIGGGRFAVPKDTFIMCSLYNIHRDTKVWGE 33794

>Scaffold_361a 
Sbjct: 8693 AVMRESLRLGPSVPGRMIESLKDQTLKNGKYAVAKGEILVVCNFIAQRDSKVFGD 8857

>Scaffold_361b 
Sbjct: 13979 AVMRETLRLTPVAPGRVIEAIEATTLKGGQYAIDKGQDILVAVHSSHRDPKVWGD 14143

>Scaffold_356 similar to 193
HPLAKFPGPKLAAATHWYSAYYEVWRDGALVEHLQELHKQYG 7683
QAVVGMGATFMHYNPEVFPQPYTFDPDRWLQPDDFRRGLG 9040

The following P450s all have in common a phase 2 intron in the heme CYS

>Scaffold_152 intron in heme CYS
55928 YKGRPFKIAQFDRWLVVLTTPHHIEELRKAPETGLSSRDAXXX 55809 ex3

54871 XXTFAIFHAAADPGVADALRAEVASVVAEHGWTPTALTKMQRLDSFVREVQRMHXXXX 54716 ex9
54642 ALVMKIARTDYAFADGHVVPRGALVTAPATTVHRDDEHYPDAHTFRPWRF 54483 ex10 
54482 VGTPDESEADSARRKATSTSPTFLAWGHGKHS (2) 54399 ex10 
54344 CPGRFFAVRELKMLLGSVLLRYDVRLK 54264 ex11 
54263 TPGVLPQDQWYLTFRVPDPTACVLLKRRTTA 54171 ex11

>Scaffold_21 Length = 172089
       MISIDSISLISGLISFAFIAYYLRQDKLQ (0) ex1
       HIPSPGPTGPISSWYAAYKYIRGDAPQIIEEGYRK (0) ex2 
154290 YKGRIFRIADLNRWTVVVTSPSLVEELRKAPEDVLSFHEGIRY (0) 154400 ex3
154482 SLQLDYTFGREAVEHEYHIPVIRTQLTRHLTPLFADIHDEIVQSFTDLVPPSDT ex4
154629 WTSVRVVPTVMQVVSRTSNRVFVGLPYC 154712 ex4 
154713 RDPAFCALAVRFATDVVKTGVALHLTPRALKP (2) ex4 fused
       LGVRLVSPVSKRVEEGKGDHRQAGGRPAPRQPGGRPARAAQGACGNWPDKP (0) ex5
155085 EDMIQWLIEEANEDERTVEGLVLRILIVNFAAIHTSSM (0) 155192 ex6
155247 SFTHAVNMLAAHPECIAPLREEIEEVVREEGWTKAAVQRMRKLDSFMKECQRLHGLGA (1) 155408 ex7
155477 VTMSRVALQDYTFSD 155521 ex8
155522 GTRIPRGTLVMAASRPIHHDAALYVPDADAFDPWRFARLRAADADASIKHQMVHTSAEYL ex9 
155702 AFGHGKHA (2) 155725 ex10
155785 CPGRFFAVNELKLMMAHVLHTYDIR 155859 ex11
155860 PQTSVPPGRWIRHSLLANPIATVDLKKRQT* 155949 ex11

>Scaffold_314          Length = 25333 ex 1 not supported by blast match
gene model complete all boundaries checked
     MQSSVGEVFASAPTLAKLLAGAAFVLFLNSLWNIWK (0) ex1
5060 LRHIPTVGGPAIPILCYIGTFRYLQDPQKILQEGYEK (0) 5170 ex2
5243 YKAKPGMFKIAAPDRWLVVVGHPNLIDELQKHSDEQVSFMDAATE (0) 5356 ex3
     FVGTRYALPGTIADDPWHIPPLKQHLTHAIGSFFGDMLEELRVSIEERIPSNEKDD (1) 5569 ex4
     EWVAIPALDTFFWVFTRVIDRIIVGLPI (1)
5799 RDTEFIKLMVEFTMSIGIARFFIGLVPPMLKP (2) 5894 ex6
5948 AMAKLAARGVHKATAEAEKMLAPVIADRVRHLDEFGEKWADKP (0) 6073 ex7
     NDLLQINIEEARAQGRPLDEIVIRTIVSIFVGVSTSAA (0)
6306 SFVHVLYHLAADPELQAALRTEVEGAIARDGWTKAALVGMHRVDSVLRESQRVNGINS (1) 6476 ex9
6530 VSVMRTALQDITLTSAGAPVCLPAGTLCVAPERALHADKEHYPDPDAFVPFRFAELRATA ex10
     DARGGAQHQFVSTSTRYVPFGHGKHA (2) 6787 ex10
6844 CPGRFFAGNEMKAAVAHLVSNYDVRLPDGASTRPPNELFGLAIVPNRSAKVMSRRRQPVV* 7023 ex11

>Scaffold_210 intron in heme CYS () similar to 137 GT boundary missing at ex 7
gene model complete all boundaries checked
      MSDYSSLLAYIFISLATLAYLKRLLWPDRQQ (0) ex1
27371 LEHIPAIGPTAPILSYWGAFRWLSHGTEITQKGYAK (0) 27270 ex2
27199 YKGRPFKVANFNRWLVVVSGPKLIDDIRKAAEHELSFEEAAHE (0) 27071 ex3
26994 NLEVRYTAGPCIAENSYHVPIVRGQLTRNLPFLFNDVRDEVAKAFGDHIPPTD (1) 26860 ex4
26785 DWTPVAAHPVIMQIVARATNRVFVGAPKC (1) 26702 ex5 
      RDPDWLDLSIQFTADLILGAHIITQFPQFLKP (2) ex6
26500 LAARFFTRVPAAIRRGRRHLERTIEHRKACLEQYGADWPDKP (expected phase 0 GT missing) 26372 ex7
26312 NDLISWLLDEAKGEERTIHNLVTRVLTLEFAAIHTTSN (0) 26199 ex8 
26148 SFVHALYQLAAHPEWAEPLRDEIEQVVKREGWSKSSLDKMHRLDSFLKESQRYYALGG (1) 25993 ex9
25909 VTMDRRAMKDFTFSDGT 25871 ex10
25870 VIPEGTFVGVAVLATQHDPQYYDDPDTFNPWRFSDLREESDESGRHLLVST 25718 ex10
25717 GIEYFPFGHGRHA (2) 25679 ex10 
25624 CPGRFFAAIELKLMLAHIVMNYDVKAE 25544 ex11
25543 LDGVVPPILEFGQNLAPNMKAKVLFKNRQRS* 25448 ex11

>Scaffold_297 48% to scaffold 210 intron in heme CYS
27263 XXGSPFRIATRRYWQYIVSSPKLIDELRRAPDDELSFLDAVNE 27385 ex3
27473 YTMGAATANNLYHVPVIRNTLTRNLGNLSSEIYDEISNAFADCIPAXXXX 27610 ex4
27681 WMAVPALQSIMQIVARTSSRIFVGLPLC 27764 ex5

29066 RYEGLGMRTLPLSPFRSIY*PCS

29138 VFLTRKAVKDFTFSDGTFIPKGSYVSTSRAATHG 29239 ex10
29240 QSEYYRDPYVFDPWRFANLRDETGEGVKHQMVNTSIEYLPFGLGKHA (2) 29380 ex10 
29439 CPGRFFAANELKSMMAHLVVTYDVALD 29519 ex11
29520 MPGEVPRSVHFGPINSPNRTAKVLFRKR 29603 ex11 

The following P450s have in common an intron in the heme signature before the CYS

>Scaffold_5 
23027 LVALLLILTLFVLVTRSSSRHYPPGPRPLPLLGNIHNAPAQRQWKTFAAWKSTY 23188 exon 1
23250 DVISLTIFGQRIVVLNSLESAIDLLEKRSAVYSDR 23354 exon 2
23382 LGWAQQLVFAPYGEHFRNMRKILHKYLGARGQLDKIEPYHEIIEAATAKFLVRAL 23546
23847 VKWVPTWCPGTSWKRQAQEWKDLFVRMTEGPYAMAQQQ 23960 ex5
24177 VAIILSFILAMTLHPEAQKKAQQEIDALTNGERLPVIR ex7,8
      DREELPYVRALISEVLRWNPLVPL 24362 ex7,8
24416 VPHCAIADDVYRGYFIPEGSTVVVNMW 24496 ex9
24568 DPEVYSDPEVFKPERFLGPDPERDIRAFVFGFGRR 24672 ex10
24980 YPLPFKCTMKPRSERAETLI 25039 ex11

>Scaffold_24 
149683 DCAAVLLALWVIRKAFSGSSTSRHYPPGPKGLPIVGNLFDVPTSQEWQTYSQWA 149844 exon 1
149912 DLISMNVLGQRIAIISSVKVAFDLFEKRSVIYSDR 150016 exon 2
150484 VRHLPSWVPGTAWRKTAEKYRRHVADAVAEPFAFVKQQM 150600 ex5
150963 SALTSLFLAMTLYPEVQRRAQAELDGVVGTDRLPTFEDRDRLPYITAICAEVLRWMPVGPL 151145 ex7
151213 LPHRLTEDDVYEGYALPKGTIFFVNNWY 151296 ex9
151374 LLHDPDTYRDPMAFMPERFLGAAPELDPSKIAFGYGRR (?)
151542 ICPGILVAEATIFITVAATLAAFSIRPAQNGGAPSLPPVRQTSGII 151679 ex10
151753 HPAPFQCDVVPRSKKAEALV 151812 ex11

>Scaffold_54 similar to 15
87020 VIAVLAYGLFTVLRRLRLGVLGKSLPPGPIGIPVFG 87127 exon 1
88156 IARFVAEIAEHPEVQVRAHAELDQVVGRDRIPGAEHKSELPYIGAIVKVGLRFQ 88317 ex7
88732 PRTCLGKPLAQTEVFLAVACMLWAFEVQPFDTWEQEAEEDGEDEHPSPWPDPFLVRLRPR 88911 ex10

>Scaffold_66a
19677 TAIAFVIMAAATHPKAQAEVQAQLDSVVGRDR 19582 
19591 KGQRYVCAQTGAVTSGSPGLVPSFDDESLLPLVTAFYLEAYRWRPV 19454 ex 7
19328 AHPHNQFMQGEYVIPADAIVIGNHW 19254 ex9
19204 SIARDPDVFPEPEEFRPSRWLDESGKLREDLSSFNFGFGRR 19076 ex10

>Scaffold_66b 
32359 TAISFVMMAAATHPQAQAQVQAQLDSVVGRDR (?)
VPTFDDEKLLPLVVAFYLETFRWRPI 32129 ex 7
31872 AIGHDETVFSDPDVFRPSRWLDEAGKLRDDISPFTYGFGRR 31750 ex10

>Scaffold_164a 5 P450s on this sequence 28% to CYP61
10606 SWLLLIPALAIVAHILIWLLDPHGIRSYPGPLLAKFSDAWLGYVAAQGHRSEVVHDLHKQYG 10421
9282 SLGSSSCAITYYLAKYPDAQRKLQQELDEALGSDDEPVSTFDQVKRLPYLQAVIDEALRI 9103 ex 7
9102 HSTSGIGLPRLVPKGGMTVCGRFFPEGTVLSVPTYTIHRDEEVWGKDPEVFRPERW 8935
8934 FEQDKNAVQKTYNPFSFGPR (?)
8817 SCIGRNLANMELLIIVSSILRRYDFVLEDPDKPVSGFLVI 8698

>Scaffold_164b 5 P450s on this sequence
22646 DPAVIGFGFGRR 22681 (?)
22735 RICPGMHFAHNSIFIAIARMLYVFNFTKAVDKNGNEITPEVEYS 22866 ex10
22929 HPSPFVCSISPRSIAAAELV 22988 ex11

>Scaffold_164c 5 P450s on this sequence
38255 LDIALATLAVVLLKTIIARSKQRARYPPGPKGLPVIGNVLQMPKDREWLTFAQAER 38088 exon 1
37958 NIVYLSLLGQPMIILNSAKDAVALLDKRSSIYSDR 37854 exon 2
37796 PYGDRFREYRRLMAKFIGGKTQVERHFPVMEQEATSFLKRILRRPD 37659 ex3
37560 LKLAYGYTIREDEDPFVTLADRAMAQFTEATTPGAFL 37450 ex4
37431 LRHMPAWFPGASFKRTAQEWSDTLNSMADVPHAFVKEQM 37315 ex5
37040 VSSIHTFFLTMLLFPHVQKRAQAEIDSVVGTDRLPTFEDRAKLPYVEGVLKEVLRWHPIGPL 36855 ex7,8
36793 LPHRLAQDDSYEGHLFPKGAIVIANIW 36713 ex9
36655 LHDPDVYPNPSDFDPTRHLSENGRSPQPDPRDYCFGFGRR 36536 ex10
36228 HPKPFRCSIKPRSTRAEALI 36169 ex11

>Scaffold_164d 5 P450s on this sequence
45556 AFLSRTRRQGPYPPGPKGLTIVGNALEMPTSREWLTFSEW 45675 exon 1
45745 DIIYLSLLGQPMVILNSAKHAIALLDKRSNIYSDR 45849 exon 2
45877 IGWKYTLALTPYGQRFREYRRFIAKLIGGPTQMQTHLPLEEHETRRFLKRLLNEPERVADHIR 46065 ex3
46276 LRYVPAWVPGARFQKTAREWRKVLERMADEPHDFVKQRM 46392 ex5
46623 VSAIYSFFLAMTLFPHVAKRAQMEVDAVVGSDRLPTCEDRPNLPYVEALVKEVFRWNPVAPL 46808 ex7,8
46861 LPHRLIEDDIYEGYFIPKGSFVIPNIW 46941 ex9
46995 ILHDPNHYPNPFEFDPTRFLSDEGRTPQPDPRDYCFGFGR (?)
47169 RICPGLHLADVSVFLSCAMVLATFDISKAVENGKVIEPEVEYTSGTI 47309 ex10
47369 HPKPFKCTIKPRSTKAEALI 47428 ex11

>Scaffold_164e 5 P450s on this sequence
48060 LVLLSAILTVVLIRTAIARRKRWARLPPGPKGLPIVGNVLQMPKSQEWLTFSRWAEQY 48233 exon 1
48291 DIVYLNILGQPLIILNSAEDAVALLDKGGSIYANR 48395 exon 2
48822 LRHVPAWLPGASFKATAKRWGETLEQMADVPHNYVKEQM 48938 ex5
49234 VSSIHSFVLAMVLHPHVQRRAQAEIDAIIGPERLPTFEDRAALPYVEALFKEVLRWNPVGPL 49419 ex7
49474 LPHRLSQDDVYKGYLLPKGSIIIANIW 49554 ex9
49613 LRDHNLYPNPSDFDPTRHLPKNTEAASQPDPRNYCFGFGRR 49735 ex10
49855 VLAGQHLADASVWLACATMLATFDIENLVASDGTVIGVEPEYTSG 49989 ex10
50056 HPKPFKCSIKPRSALANALI 50115 ex11

>Scaffold_165 
53515 ILVLICLLLRVVRRNTTRRLEQLPPGPIGLPILGET 53408 exon 1
52432 PEVQAQAQMELDRVVGRDRLPQAEDAKDLPYVRAIVKVSISIR 52304 ex7
52236 PHMSTEDFSYRGYKIPKDTAVILN 52165 ex9
52097 HDSQRYPNPEKFD (0)
PDRYIDDERSSAESAKLADPYQRDHWTFGAG (?)
RRICPAIALAEHEIFLSVAGLLWAFDMRQLSD 51756

>Scaffold_245
3382 LLATAALLALLSARRTQQPTPPGPCELPIIGNVAELSGGFEWTRF 3516 exon 1
3707 IGVFMMAMALHPDKQARAQEEIDSAVGTDRLPTMDDKARLPYVYAVVQEAMRWHPMLPL 3883 ex7
3936 LPRRAEVDDEYDGYHIAKDTTVCANLWY 4019 ex9
4080 MEPNVKYPPEQFIPERFLDAEHPTPNPNTWAFGFGRR 4190 ex10