FASTA FILE OF ALL AEDES P450S (164 seqs, = 11 in the 2 clan, 84 in the 3 clan ,

59 in the 4 clan, 10 in the mito clan )

REVISED 6/25/2006 D. Nelson

 

CYP2 clan (11 seqs)

 

>CYP15B1 1.48_3

MWQNLVVLIIFVILFCLRDMRKPGYFPP (1)

GPNWFPLIGSGFEVFRLVKHFKFYHLMWAELMRRYGPIVGLRLGRDRVVIVSGLDA

IREVYSKDQFDGRPDGFFFRIRSFDKRLGVVFTDGAHWDIQRRFSVRTLKALGMGRTGMV

NSLEREAEEMIHHLRKLSRTQKVISMHNAFDVSVLNSIWTLIAGKR (2)

FDLDDKKLEWIMETIHKSFRVIDMSGGVLNQFPPIRYVLPDKSGFAPLLNLLRPLWTFLQ (0)

GTIKSIRSKLDQPDNPDCFIASYLRELNIAERHSSFTNEQLLCLCLDL

FQAGSETTSNTLGYGIAHMLHHPEIVQKIHNELDSVIGRYRLPLLADRPYLPYTEAVLCE

IQRISNIAPLAIAHRTVAPVQLGTYVIPKNTITLISLYSLHMDKAYWGDPEVFRPERFLN

ETGDKLVAHEYFVPFGS (1)

GKRRCLGESLAKSSLFLFFTAFMHAFLVEPAEPGKLPELDGIDGITLSPCPYYVQLKERLI*

>CYP18A1 1.133_1

MFLDTYLLGVVRQEFFDASKARST

2678 LLVFCCTLSCVVFLQWLFRLVCQIKKLPPGPWGVPIFGYLTFIGHEKHTQYMKLARKYG 2502

2501 SLFSAKLGAQLTVVISDYKIIREAFKTEDFTGRPHSPLLKTLGGF (1?)

     GIINSEGQLWKDQRRFLH 719

 718 EKLRHFGMTVLGNKKHLMESRIM (0)

 534 TEVAELLASLNEVGSQSTDLSKYLSVSVSNVICNIIMSVRFSLEDPKFKRFNWLIEEGMRLF 359

 358 GEIHTIDYIPQIQYLPGNINAKNKIAKNRQEMFDFYREVIDEHKRSFNAENIRDIVDAYL 179

 178 DEIQKAQAEGRDQELFDGKDH 116

     EIQMMQVIADLFSAGMETIKTTLLWLNVFMLRHPDAMKRVQDELDQVVGRNRLPKIEDVP 406

     YLPITETTILEVMRISSIVPLATTHSPKS (2) 319

2116 DVVINGYTIPAGSYVVPLINSVHMDPTLWDKPEEFNPSRFLDAEGKVHKPDFFIPFGVGR  1937

1936 RRCLGDVLARMELFLFFASIMHTFTIELPEDEPMPSLKGIIGVTISPQAFRVKLIPRPLN  1757

1756 ADLDRLRNVGSC*  1718

>CYP303A1ae

MYWYYLACFIVVFIIFLYLDCIKPANFPPGPKWYPIIGSAIEIARARQKTGMLCKAIKLIASKYDHKGVIGF

KVGKDKTVMAISGDSLREMMSNEDLDGRPTGIFYETRTWGLRRGVLLTDEEFWQEQRRFI

VRHLKEFGFARKGMAEIIGNEAEYVKNDFHALVKAGNGKALVQMQSAFSVYILNTLWLMM

AGIRYTRENKDLKYLQSLLHELFANIDMMGALFSHFPFIRFFAPRLSGYKQFVEIHNLMH

KFIGAEVENHKKSFNDTDEPRDLMDVYLKILQSNRDIPESFSQEQLLAVCLDMFIAGSET

TTKTLGFAFLHLVRQRETQLKVQKELDEVVGRNRLPTLEDRVN (2)

LPYCEAVVLEALRMFMANTFGIPHRALRDTKLCGYDIPK (0)

DTMLVGMFRGMMLNDWESPTSFKPERFLKGGKIVIPPNFHPFGVGRHRCMGEMMGKAN 110

LFLFITTLFQSFDFLVPEGYPIPSDEPIDGATPSVRQYTALIVPR*

>CYP304B2xx/yy 1.1104_2

22307 MFVTPTIFLWLVTIGLIAYRCHRFLFDRPKNFPDGPPKFPLLGGYAVMLLINFYHLHRAANKLCEYYRTKILGIYLGNFP

TVIVNDFATVKEVLNRVEFDGRPDLFIARMREKNFLLRGIFFTQGPDWKEQRRFILRYLRDYGFGRRFDELEAETNAEIL

TLVEMLRYGPRHEHETEFMTKDGCAMVPNVFFACFANAFLYVLTGERINRDEAGALFE (2) 22960

35137 TGKYAMMFQRTGDDYGTIYSLL

PWMRHLFPNRTRYRTIREGSLGVNRFIESIIQKRLETHEEGHVRCFLDLYFTEMKKTVPRTEDNRFTFQ (1) 35409

35466 HDQLVLGIVDF

FFPAISGATTQIALLLERLLWHPEVVQKMQAEIDDVVGHGRLPTLDDRINLPYTEATLREAMRIDTLVPSGVAHMAMKDT

TLRGYDIPKDTILVLGLDSIHMQKDIWGDPERFRPERFLNYRGELSLSKDVSVPFGAGKRLCAGETFARNTMFLIVSALV

QNFNIRQRLGDKLPDMGKRSTGIIISPADYWVKFEPR* 36092

>CYP304B3yy/xx  1.1104_3

46553 MLLNPSAILWTVAAGLLIYRCFRFMFDRPPNFPSGPPRFPLLGSYLVLLMVNYRHLHRAAVRLGQFYRTKILGIYLGDFP

SIVVNDLAIAKEVLARSEFDGRSDLFLARMRERNFQRRGIFFTDGPHWKEQRRFVLRHLRDYGFGRRFDELEAETRSELM

TLLDVLRYGPKFEHERLFAKDGCVKCPDAFYGLLGNVYFQVICGERFQRKDMAQLYE (2) 47203

61403 TGRHAINFQQKGDDYGTILSYLP

WLKDYFPEATNYRILREVNNRLNDLIEAMVQKYLASYDENHMRCFLDRYIYEMKQSKPLEGDAFTFQ (1) 61672

61872 YDQLVMILWDMLL

PTLSGSAIQLSMLLERLLLNPRVATKVQQELDGVVGHGRLPTLDDRVNLPYAEATLREALRIDTLVPSGISHVALEDTKL

CGYDIPKGCFVMLSLDVINNQREFWGDPENFRPERFLDESGKLSLKKDISVPFGGGKRLCVGETFSRNTLFLMFTALMQN

FNIKPRPGDPLPDLGQRITGVVTSMEPFWLRFEAR* 62501

>CYP304C1 1.1104_1 ae1

MVLISELIIAALLGLLIYRFYRYLFERPSENFPPGPPRL

PLLGGYPFMLALNYKHLHKAAARLSQLYKSKLIGLYLGPLPAVIVNDYDTVKEVLTRPEF

DGRPDLFMARLRDQHFQRR (1)

GIFFTDSESWREQRRFFLRTLHHFGFGRRSPEAEADIQAGLEDVISLLRDGPKYEHEKAL

VDSAGFALCPTVFFAVFSNVLLRMIVGVRLAREDQAVMFE

VGKNAIAFHRNGDDYGMLLSYIPWIRHLFPKTTKYDLLRKVNQQANAVILSLAQKCES

SYDENDIRCLVDAYIQEMRATGSKGESTGKDEFGFQ (1)

YDQLVIGAADFLVPPFSAIPAKICLILERLIQYPEVQTKMYRELNEVVGLNRLPTLDDRA

DLPYCDAVIREGLRIDALVPSGIPHMAVTDTQLNGYQIPKGTVIVNSLEFIHHQPEIFRD

PDSFMPERFLTPDGKLALDQDKTLPFGAGKRVCGGEQFARNALFLGVTSLVQNFTFQ

LPAGRACPDLDGRITGVIQTTPDFRLKFVSRR*

>CYP305A6 1.48_2 (305ae1)

1435  MITLVLSSVVIVSFIFWLWQDLQRPPNFPP (1) 1346

GPKWLPFFGNTLLIRNLARISGGQHLAFEALSKQYKSPVIGLKLGREHVVVALQ

YPAVHEALTKEAFDGRPDNFFIRLRTMGTR (2?)

LGITFTDGPFWTEHNSFVVR

HLRQAGYGRQPMQLQIQNELNELIGIIRDLDSEPVWPGSILPTSVINVLWTFTTGSRIPR

DDQRLTRLLKLLQDRSKAFDMSGG

ILSQLPWLRHIAPEWTGYNLINRFNQEIHEFFKATIEKHHQDYTEEKCSDDLIYAFIK

EMKERKDDPCSTFTDVQLSMIILDIFIAGSQTTSTTIDIALMILAMNTEIQRKIYAEIDD

NFHPDEIPDQNCRTNLQYTEAFLLEVMRLYQIAPIGGPRRALSDCTLGGYRIPRNTTILM

GLHTVQMDPDHWGDPENFRPERFIGPDGKIINTERLIPFGLGRRRCLGDSLARSCMFTFL

VGILQKFSLRLPDSLEGPSLKLTPGITLSPKPYKVVFEPRLK*

>CYP305A5 1.48_1 AAGE01051792 70% to CYP305A2

MIVLVLTSVLIIAFSYWLLQELRRPPNYPPGPQWLPFIGNTPFVRKLARASGGQHLAFEALSKQYNSPVIGLKLGREYVV

VALQYPAVREVHSKEEFDGRPDNFFLRLRTMGTRLGVTCTDGPFWAEHRNFVVRHLRQAGYGRQPMQLQIQNELNELIGI

IRDMDGEPVWPGSILPTSVINVLWTFTTGSRIPRDDQRLARLLKLLQDRSKAFDMSGGVLSQLPWLRHIAPEWTGYNLLK

RFNQELHEFFMIIVERHHQEYHEEKCSDDLIYAFIKEMKDRKDDPSSTFTDLQLTMIILDIFIAGSQTTSITIDLAFMML

TMHTDIQKKIHAEIDENLHQDEMPQQNDRTSLPYTEAFLLEVQRFFHIVPVSGPRRALSDCTLGGYQIPKNTTILMGLRT

VHMDPEHWGDPECFRPERFLSPDGKIITTERLIPFGLGRRRCLGESLARACMFTFLVGILQKFSLRQPANCSEKPSPKLL

PGITLSPKPYKVIFEPR.

>CYP306A1 1.133_2

MYLILGIVLILTYVLWTLLDRRGKPPGPFGLPILGYLPFIDSIKPYETLTNLAKRYGPVYSLRMGQVDAVVLTAPDLIRD

TLKREETTGRAPLFITHGIMGGHGIICAEGNLWRDQRRLSTEWLRKMGMTKFGPTRATLEARILIGVNELLEDLRRESEK

VFAFDPAPLLHHILGNLMNDIVFGLQYERDDATWRYLQHLQEEGVKHIGVSMAVNFLPFLRHLPSSKRIIEFLLNGKAKT

HKIYDSIIEKQRSRMEGGGSEVSDPGRHDDCILSNFLQETRRRETGARPELAFCSDVQLRHLLADLFGAGVDTTFTTLRW

LILFLALNKDAQERLRQEMASQLRGEPCLNDVDSLPYLKACVAEAQRLRTVVPLGIPHGAVSEITIAGYKVSKNTMIIPL

LWSVHMDPSLWPNPDRFDPDRFLDESGQYSAPAHFMPFQTGKRMCLGDELARMILLLYTGRLFWHFELDVFNGEGLDLTG

VCGITLTPPPFEIIFKERV*

>CYP307A1 1.427_1

MAYTLILVALMSLLSVVCYLKVLYEWHRKVRVQTVKSSRYAKKLQKLEESQPQEVEEAPVEFPQAPGPYPWPVLGSAAII

GQYPAPFMGFSALAKKYGDVYSIRIGQGQCLVVSSLELIREVLNQNGRYFGGRPDFLRYHQLFGGDRNNSLALCDWSSLQ

QKRRNLARKHCSPSDASSYYQKMSDVGVAEMHYFMDQLTDVVTPGQDFKVKPLIMQACANMFSKYMCSVRFEYDDAGFQK

MVHSFDEIFYEINQGYAVDFMPWLAPFYFRHMSKLSSWSNYIRGFILERIVNEREQNLGEDEPERDFTDALLKSLREDPS

VSRDTIMYMLEDFIGGHSAIGNLVMLALGYVAKNPEIGARIQQEIDHVTDKGLRNVTLYDTESMPYTVATIFEVLRYSSS

PIVPHVATENTCIGGYGVQTGTVVFINNYDLNTSEKYWDHPERFDPSRSNESQKQILRVKKNIPHFLPFSIGKRTCIGQN

LVRGFSFIMLANILQKYDVHTNDPAQIKMKPACVAVPPDTYPLAFTQRSQ.

>CYP307B1 1.224_1

MEKFTIFLFSSNTIYLLVACFLVTLIMLLLEVRQKISVKSDLVKLVKSFLFGQWLSVFTQNNKNRNLNDTEVKVLRRAPG

PKSYPIIGNLKDLDGYEVPYQAFSVLAKKYGPVVNLKLGVVDAVVINGIEHIKEVLINKAQYFDSRPNFRRYQLLFSGNK

ENSLAFCDWSEVQKARRDMLVPHTFPRNFSGRFNELNGVINDEIRLVIGESNVNRVIEIKPIIMNICANVFSQYFASHRF

ELEDPKFQKLVKNFDQIFYEVNQGYAADFLPFLLPLHHRNLKRMDQLAEEIREIMLETIINDRYDNWVEGNTENDYVDSL

INHVKSKIGPDMEWETALFALEDIIGGHSAVANFLVKTFGYIIQHPEVQQNIQSEVDRVLETEGKHTVDLSDRNHMPYTE

AVIMEALRLIASPIVPHVANQDSQIGGYDVPKDTLIFLNNYDLSMSENLWENPNDFVPERFLQNGRLVKPDFFIPFGAGR

RSCMGYKMTQLISFSIIANLLRSYTITPLSGHSYFVPVGSLAMPEKSYEFQINLRH.

 

 

CYP3 CLAN (CYP6 [47 seqs] and CYP9 [36 seqs] and CYP329B1)

 

 

>CYP6F2 1.1219_1 CYP6AL2 AAGE01012031 CYP6AL2v1 6T1.2

MTLLSIGVALLCVAAFAFLNYVFGYWKRRGIRQLTPHFPFGNFTDLFFGKASFPKVCENLYERSKQWRLLGGY

VLLRPILLVNDPQLAKDIMVKDFQHFHDRGPHVDEENDPLSGHLFSLAGEKWKHLRAKLT

PTFTSGRLKGMFQTLVDTGEVLQEYIQKYAEGEDVVEIREILARYNTDNIASVAFGIKID

SINNPNEPFRHIGRKVFEPNFRNNMRGLITFMVPKLNKYLKIKSVDDDVEKFILKVVQETLEYREKNGIVRRDMM

QLLLQLRNTGTVSVDERWDVETSDKFKKLTLKEVAAQAHVFFLAGFETSSTTMSFCLYEL

AKHPEIQRRVQAEIDSVTALHDGKLTYDSINDMRYLECCIDETLRKYPPVPVLNRECTQD

YKVPGMDFTIEKGTAIVLQIAGMQHDPQYYPDPMQFKPERFQDPEVKSKPYAPFGDGPRV

CIGMRMGKIQTKVGLCLLLSKFDFELFGHDEPELVMDPNNFVLTPVDGINLKVSCRE*

>CYP6F3 1.1219_2 AAGE01073711

MTPLSIGVALLCVAAFAFLNYVFSYWNRRGVQQLTPYFPFGNFSDLFLGKASFPRVCETLYERTKKWRLLGVYILLRPVL

LVNDPQLAKDIMVKDFQHFHDRGTHVDEENDPLSGHLFSLAGEKWKHLRAKLTPTFTSGRLKGMFQTLVDTGEVLQDYIH

TCAKNEEVVEIREILARYNTDNIASVAFGIKIDSINNPNEPFRQIGRKFFESNFRNNMRLMITFMVPKLNKYFKIKSVDA

EVEQFILGMAKETLEYREKNGVVRKDMMQLLIQLRNTGTVSVDERWDVETSTNSKKLTIGEVAAQAHVFFLAGFETSSST

MSFCLYELAKNPEVQRKVQSEIDSVTALHDGKLTYDSINEMRYLECCIDETLRKYPPVPVLNRECTKDYKVPDSDITIEK

GTAVILQISAMHHDPQYYPDPLRFVPERFLDPDMKGKPYAPFGDGPRICIGLRMGKIQTKVGLCLLLSKFNFELYGHKES

ELVMSPNNFLNTPVNGINLKVSCRE.

>CYP6M5 1.371_12 CYP6M5 CYP6M5v2 6I1.1

MEVITITLLTILILLLIYVLHLLRRQIHFFKDRNVPYKPASFERLDKTIHPAMHFLRWYKQFKGQYPLSGVFMFIKPIVI

PLDLELIKRILVKDFQYFQNRGIYYNERDDPLSAHLFSLEGAKWRNLRAKISPTFTSGKMKMMYPTMVAAGKQFSEYLEE

KVGDGNELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFEAPRNVLKDAFKMTAPGLARFLRVTEILPDV

SEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDKTEGSESLTISEIAAQAYVFFIAGFETSSTTMTWALHELSRNPDI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDQIINETLRLYPPVPMHFRVVSKDYHVPETDTILPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVNKRHAFAWTPFGEGPRVCIGLRFGMMQARIGLALMLKNLRFSPGPKTCTEMEFQPQNFIL

SPKEGLWLNVEKI*

>CYP6M6 1.371_11 CYP6M6 AAGE01004894 CYP6M6 6T1-1

MDVFLLIAAFVLLVAYGLHLLRKQVNFWADRNVPHNPVNFRQTVDQTVHMARRFQGYYHQFK

GQYPFAGMYLFTKPVALAIDLELLKCIFVKDFQYFHDRGTYYNEKDDPLSAHLFNLEGN

KWRNLRSKISPTFTSGKMKMMYPTMIAAGKQFSEYMDEKVGVEQELELKDLLARFTTDVI

GMCAFGIECNSMKDPNAEFREKGRMHFETPRNRKKDMMCSIAPKLARMMGLKQIIPDLSD

FFLGVVRETIDYRVKNGVRRNDFMDLLIGMLTGENVELGP

LTFNEVAAQAFVFFVAGFETSSTTMTWALYELSVNQDIQEKGRKCVRDVLEKYNGEL

SYETIMEMSYIDHILHETLRKYPPVPVHFRIVTKDYKVPNTETVLPAGTSVMIPVYAVHHDPEIFPDPK RFDPDRFTTEEINKRHPYAWTPFGEGPRICIGMRFGMMQARIGLALLLNNFRFSSG

KKSTVPLDFTAKSFILSPDEGLWLKVEKL*

>CYP6M9 1.371_13 AAGE01032555 CYP6M5v2 6I1.1

MEVITITLLTILVLLIAYASHLLRRQIRFFKDRNVPHIPASFELLDKTIHPAKHFLRWYKQFKGQYPLTGVIMFIKPIAI

PLDLDLIKRILVKDFQYFQNRGIYYNERDDPLSAHLFSLEGAKWRSLRAKISPTFTSGKMKMMYPTMVAAGKQFSEYLEE

KVEDGNELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFEAPRNALKDAFKMTAPGLARFLRVTEILPDV

SEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDKTEGSESLTINEIAAQAYVFFIAGFETSSTTMTWALHELSRNPDI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDQIINETLRLYPPVPMHFRVVSKDYHVPETDTILPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVNKRHAFAWTPFGEGPRVCIGLRFGMMQARIGLALMLKNLRFSPGPKTCTEMEFQPQNFIL

SPKEGLWLNVEKI.

>CYP6M10 1.371_14 AY433475 AAGE01031181

MEPITIILVTILVLLLTYGFHLIRRQLRFFKDHNVPHIAGNFVLIDKTQHPANHFLRWYKQSKGQYPLTGVFMFIKPIAI

PLDLELIKRILVKDFQYFQNRGMYYNERDDPLSAHLFSLEGAKWRSLRAKISPTFTSGKMKMMYPTMMAAGKQFSEHLEE

KMSEENELEMRDLLARFTTDMIGTCAFGIECNSMKEPNSKFREMGRKHFESPRSGLKDLLKITAPGLARFFGVTEILPDV

AEFFMDVVKSTVEYRMKNNVRRNDFMDLLIAMLDDETEGSESLTISEIAAQAYVFFIAGFETSSTTMTWALHELSRNPEI

QEEGRKCVQEVLEKYNGVMSYEAIMEMTYIDYIINETLRLYPPVPLHFRVVTKDYPVPGTDTVLPAGTFTMIPVYAIHHD

EDIFPEPEKFDPTRFTPEEVSKRHAYAWTPFGEGPRICIGLRFGMMQARIGLALLLNNLRFSPGPKSCTKMEFQPENLIL

TPKQGLWLKVEKV.

>CYP6M11 1.371_15 AAGE01105997

MEPLDVAITVVMVALAVYMYLDKKHSYWADRKVPFVKPKFFYGNAKEISQTMQVGQVFQQFYHELKGRSPFGGIYMFTAPVAVVTDLELLKCIFVKDFQYFHDRGTFYSEKGDPLSAHMFNLEGNKWKMLRNKLSPTFTSGKMKMMFPTIVAAGKQFHDFMDEKVKQESEFELKDLLARFTTDVIGMCAFGIECNSIKDPDAQFRVMGRKLFTTGRSKPKSFLMNTMPKVAKLLRLRIFPADVSDFFMKVVRETIDYRMANNVHRNDFMDLLIQMRNPDENKSSEGLLSFNEIAAQAFVFYLAGFETSSTLLTWTLYELAVNQDIQEKGRQHVKEVLKKHDGEMTYESITSMKYLDQILNEALRKYPPVPVHFRETSKDYTVPDSNIVIEGGTRLFVPVYAIHHDPEIFPNPEQFNPDRFTPEEEQKRHPYAWTPFGEGPRICIGLRFGMMQARIGLAYLLNSFKFSIGEKCKVPLEFDVKSFILAPKGGLWLKVEKI.

>CYP6N6 1.371_4 AAGE01504815 100% to CYP6Nae1 88% to CYP6N3v1 Aedes albopictus CYP6N6v1 6T1.4

MWIYLTVLALTLAVLWVRKRYAYWKERGIPYVEPSFPAGNIR

GMGRKEHFSTQMQRCYKELKGKGPVGGVFFFINPVPLALDLDFIKTVLVKDFQYFHDRSI

YYNEKDDPLSAHLVALEGAKWKNLRTKLTPTFTSGKMKTMFPTIIGVADEFQKMMKNEVV

GNTEIEMKDILARFTTDVIGTCAFGIECNSLQDPNAQ

FRRMGRKIFSVAKGRLLKLITAQQFRSLARMLGITLIDK

DVSDFFIGAVRDTIKYREENKIERNDFMSLLMKLKNDESSQDTNSGDVE

TLTVEQIAAQAFVFFLAGFETSSTAMSNSLYELAQNSDLQNKARKSVMDAIKKYGSLTYE

AMQDMQYIDQCINESLRKYPPASNLTRTVSTDYKLPDSNVVLQQGSTLIVPVYALHHDA

EYYPDPEKYDPDRFTPEEVAKRNPYCFLPFGEGPRNCIGMRFGMLQARVGLAYLLRDFSF

TLSNKTPVPLKISPHSPILTSEGGLWLNVRKL*

>CYP6N9 1.371_1 AAGE01173027

MIALLLIGAVTLVFLFVKQRFNYWKVRGVPYVRPTFPLGNLWGIGTKKHLSEGLEDLYVQLKGKAQLGGIYFFINPVVLVTDLDLIKTILIKDFNFFHDRSIYYNEKDDPLTAHLFTMEGIKWKNMRVKLTPTFTSGKMKLMFPIVRDCANELEKCISKEIVDGKEIEVKDILARYTTDVIGNCAFGLECNSLHNPNAEFREMGRKVFQLQGLGFLKLLLTQQFSTLSRALGATVLQPDVAKFFLKTVSDNVDYREKNKIERNDFIDLMIKLKNGQTLEHDKSDQRVEKLSIEQVAAQSFVFFFAGFETSSTLMSFCLYELAQNQDLQDKARKDILDTLNKHGSLSYEAVHEMKYLENCISETLRKHPPASNIFRTATQDYTVPGTSLTIEKGTSVMIPTLAIHRDPEYYPDPMKFDPDRFTADQVAARHPFAFLPFGEGPRVCIGMRFGLMQARVGLATLLKNFRFTVGERLETPAQLDPSSAILLIKGGLWLKVDKI.

>CYP6N10P 1.371_2p AAGE01078584 pseudogene 100%

MLLYLLLTVVTLAYLWIGRRYSYWKQRSVPYVEPRFPFGNLQGLNKRHFGLLAQDVYSKL KGSGSKFGGMFFFVNPVAVILDLDFAKDVFVKDFQYFHDRGVYSNEKVDPITSHLVAMEGIKWKNLRAKLTPTFTSGKMKMMFPTITAVADEFRKCMVNEVDKGGEIEMKEFLARFTT

DVIGSCAFGLECNSLADPEAEFRKMGKKALTMSPMGFLR RILSVTFRDLAKFLGVRISDPDVATFFMNVVRSTIEYRERNKVQRNDFMDLLIKLKNVEPIDENTNQLGPLTFNEIVAQAFVFFLAGFETSSTTMCFCLYELAKNQELQDKARRNIDEVLAKYGTMTYEAVH

EMRYMENCINESLRKYPPLPNILRNVNKPY

>CYP6N11 1.371_3 AAGE01020246 Charle’s version 100%

MLLFLLLSVVTAAYLWVIWRYSYWKRRSVPYVEPSFPFGNLQGLNKRHFGLLTQDVYSKL

KGTGCKFGGMFFFVNPMVVILNLDFAKDVFVKDFQYFHDRGEYSNEKADPIMAHLVTMEG

TKWKNLRTKLTPVFTSGKMKMMFPIITAVAEEFRKCMAKEADKGEDIEMKELLARFTTDV

IGNCAFGLECNSLMDPEAEFRKMGRKAMAMSSADFLRRKLCNSFRGLAKLLGVRLSDPDV

SDFFMNAVRSTIEYRERNKVQRNDLMDLLIKLKNAELIDEKSDRLGPLTFNEIAAQAFVF

FLAGFESSSTAMSFCLYELAKNQELQDKARRNINEVLVKHGTLTYEALYEMTYIENCINE

SLRKYPPVTNIVRNVSKPYRVPGMNVTLEEDCRVLLPVYAIHHDPSLYPNPDQFDPERFN

PENSAARHPMAFVPFGEGPRICIGLRFGSMQARIGLTYLLKNFRFTLSEKMHDPLKMMSN

TIILASEGGLWMRIEKL.

>CYP6N12 1.371_5 AAGE01273771  100% to CYP6Nae2, 85% to CYP6N3v1 Aedes albopictus

MLIYLTVLALTLAVLWIRKRYSYWMDRGILYVEPS

FPAGNLRGMGRKEHLSSQMQRCYKELKGKGPVGGMFFFINPVALAMDLDLIKSVLVKDFQ

YFHDRSVYYNEKDDPLSAHLFTMEGAKWKNLRAKLTPTFTSGKMKMMYPTIIGVADEFQK

LMKSEVSS

NAEIEMKEILARFTTDVIGTCAFGLECNSLHDPDAKFRAMGRKIFSFANGRF

LKAVIAQQFRSLARSLHIALVDKEVSDFFLGAVRDTIKYREENKIERNDFMSLLMKLKDD

GNTGNTETLTVEEIAAQAFVFFLAGFETSSTAMSYCLYELAQNSDLQNKARKSVMDSIKK

HGSLTYEAMQDMQYIDQCINESLRKYPPASTLTRSVSKDYKLPNSNVVLQQGSTLIVPVYA

LHHDAEYYPDPEKYNPDRFTPEEVAKRNPYCFLPFGEGPRICIGMRFGMMQARVGLAYLL

RDFSFTLSSKTPVPLKISPRSPVLTSEGGLWLKVQKL*

>CYP6N13 1.371_7 476419050 52% to CYP6N3, 63% to 6N2

102508  MWIFLLLSIAVLLILQVRRKYSYWKRHGVPFIQPRFPFGSITPVGDRVHSSQLMARFYNQ  102687

102688  LKGTYPFAGMYFFTNPVVLALDLDFIKNVLVRDFQYFHDRGLYHNEKDDPLTCHLFNIEG  102867

102868  TKWTNLRRKLLPTFSSGKMKMMCPTILAIADRFRTAIENSISDQNEIEMRDFLARFTTDV  103047

103048  IGTCAFGIDCNSLENPDAEFLKMGNKIFEVPTSRIIAYFFVSTFQELSKKLHIKAVPEDV  103227

103228  SRFFYKVVRETMAYRQSSGVQRNDFMNLLMQLKEKGELEGSDEKLGTLTLDEVVAQAYVF  103407

103408  FLGGYETSSTNMCFCLYELALNGEIQEKARECVQKAVAKHGGLNYEALMDMPYLEQCIY (1)  103584

        EALRKYPPIANLFRSVTQDYNVPNSNVMLPKGMNVWIPIYAIH  103767

103768  HDPEFFPEPELFDPERFTQEECEKRKPFTYMPFGEGPRTCIATRFGMMETKTGLATLLMN  103947

103948  FKFTKSARLEVPPKFSTKHVMLTPVGGLWVKVEKIEQ*  104061

>CYP6N14 1.371_8 AAGE01021887

112574  MWLNLLVMVFALSVILVRRRYSYWKRIGVPFIQPRFPLGSIGSIGTRIHSSQLLAQFYQQ  112753

112754  LKGSHPFAGIFYFLQPVALALDLEFVKNVMVRDFQYFHDRGLYYNEKDDPLSSHLFNIEG  112933

112934  TKWTTLRRKLVPTFSSGKLKMMCPTVVSVADRFKMCIEKSIAKEEAIEMRELLARFTTDV  113113

113114  IGSCAFGIECNSLENPDDKFRKMGEKVFDVSPFAILAFFFLSTFKDLARKCRISITDSEV  113293

113294  AAFFSTIVQKTITYREKNNVQRNDFMNLLMQMMKKNKEDESEENSVTLTLDEVVAQSYVF  113473

113474  FLGGFETSRTTMSYCLYELSLNQEVQNRARKCIQSAVAKHDGLNYEALMDMPYLEQCIN (1) 113650

113709  ESLRKYPPISNALRSTTKDYAVPGTEVILKKGTDVIVPIYAIHHDPEYYPDPELFDPD  113882

113883  RFSADQCAKRKPFTFMPFGEGPRMCVASRFGMMETKIGLAAMLMSFRFSKCEKSIVPLKI  114062

114063  SPNHLMLTPAGGLWLKVEQLESDETEMGFSKLISDERVNRLGYSM*

>CYP6N15 1.371_9 AAGE01004071  100% to CYP6Nae4

MWNLSTSSNPHTIVPAHPKEILLLATSSVPFIPARFPVGSFDGVGVRNHPSQLLAKFYR

QMKGLHPFVGVYYFLQPVVVVLDLDFAKTILIRDFQYFHDRGLYYNEKDDPISGNLLHLE

GSRWTNQRKKLIPTFSSGKLRMMCPTILKVADNLKVSFERYVAERDEIEIKDILARFSTD

VIASCAFGLDCSSLLEADDEFRRMGTKVFDISGWKLLKLFFVFAFGNVARRCHMKLIDED

ISQFFFKVVRETIDFRKKNHVHRKDFLNLLIQLKDNG

ELEGSNEKLGTLTLNEVVAHSFVFFLGGFETASTTMSYCL

YELSLNEEVQERARQCVKAAIHKYGDLNYDDLLDMPYLEQCINETLRKYPPSTIYRIVTQ

NYHVPDSSIVFPKGMSVMIPVYAIHHDPEFWPSPELYDPDRFAPEECVSRNPLTFIPFGE

GPRMCVAARLGVLQTKIGLATLLMNFRFSRCKNSTEPLQYSPKHFILTPVGGLKMRVEKIQ*

>CYP6N16 1.457_3 AAGE01005098 100% to CYP6Nae3

MWIYLLIAAITLSVLLVRRKYSYWKRHGVPYIKPTFPFGNIRPAGNRVHSSQLMTRYYNELKGKHQFGGIFFFTNPVALA

LDLEFIKDVLVRDFQYFHDRGMYYNERDDPISGHLFNIEGTQWTNLRKKLLPTFSSGKLKMMSPTIISVAERFQECLEKC

ITVDTEIEMKDLLARFTTDVIGTCAFGIDCNSLNDPEVEFRKMGNKMFELPTGRILKFFFISTFKNLARKARLKSVPEDV

SEFFFRVVRETIDYREKSHIQRNDFMNLLMQLREKGALEGSDEKVGTLSMNEVVAQAFVFFLGGFETSSTTMSYCLYELS

LHEDIQERARECVQSAIAKHGGFNYDAVMDMNYLELCINESLRKYPPGANLVRCATKDYQVRNSSVVFKKGMSVMVPIYA

IHHDAEYYPDPERYDPERFGVEELAKRPPFTFMPFGEGPRICIAARFGMMESKIGLAALLMNFKFSKCSKSIVPLVISNK

HVVLTPAGGLWLKVEKLEQ.

>CYP6N17 1.457_2 AAGE02018066.1  60% to 6N2

319978  MWIYLLIGIITSLVLFVRRKYLFWERQGVPFIKPKFPFGNLLVNGKRVHTSQLTTYYYNA  319799

319798  LKGKKHPIGGVFFFTTPFAVVLDRELMRNVLIQDFQHFHDRGLYYNEKDDPISCHLFNIE  319619

319618  GSYWTNLRKKLSPIFSSGKLKLMCPMVITIAERFQKCLSKSITQNQQEAEMKEWLNRFTI  319439

319438  DVIGTCAFGIECNSLTNPEEKFRKMGVKMFHVANSRIIKFFFISLFKNLAKKVHIKSVPE  319259

319258  DVSEFFFKVIRKTIAFREMNHVLRNDFINLSMQLMADGKLEGSDEDVGKITLNEVVAQSF  319079

319078  VFFLAGYETSSTVMMFCLYELSLQEDIQRRARENVITAVSRHGGLNYDALMDMGYLDQCV  318899

318898  N (1)

        ETMRKYPPAGNLGRCVTKDYNIPNTNITLRKGLNVVIPVH  318719

318718  GIHHDAEYYPDPERFDPERFSAEESTKRLPFTFMPFGEGPRNCIAARFGMLMAKVGVASM  318539

318538  LMRFQFSKCSKTAVPLVISPKHASMSPEGGMWLKVKEIK*  318419

>CYP6P12v1 1.702_1 AAGE02023125.1

48326  MLPLLLAVVTILLTAAALYIRSRHRFWSDRGIPCAPNPEFLFGHVRGQVTNKHAAYVNRE  48147

48146  LYQQFKARGEGFGGYSFFAVPAVIIVDPELVKTILVRDFAVFHDRGIYNNPKDDPLSGQL  47967

47966  FLLEGLQWKILRQMLTPTFTSGRMKAMFGTIMDVAEEFRQFLVDSRKRESVIEMKEILAS  47787

47786  FTTDVIGTCAFGIECNTLKNPDSDFLKYGKKVFEQRVSTLMKFIFASLFKDLARKLRIKI  47607

47606  TDAGVEKFFLGLVRETVEFREKNNVLRNDFMNLLLQLKNKGRLVDQLDEADEVAARGLTM  47427

47426  EELAAQCFVFFIAGYETSSTTMNFCLYELAKNPDIQEKLREDIEEAVASNSGRVTYDL  (0) 47253

44758  GLRYLDNVVN (1) 44729

44670  ETLRKYPPIESLNRVPTSDYTVPGTKHVLPKQTMITIPIYALHHDPDFYLDPDNFD  44503

44502  PDRFLPEAAQARHPYAFIPFGEGPRNCIGMRFGLMHTKIGLITLLRNFRFSPSPKTPDKI  44323

44322  AFDVKSFVLSPDGGNYLRYDKI*  44254

>CYP6P12v2 AAGE02030882.1 96% to AAGE02023125 allele?

8678  MLPFLLAVVALLLTAAGLYIRSRHRFWSDRGIPCAPNPEFLFGHVRGQVTNKHAAYVNRE  8499

8498  LYQQFKARGEGFGGYSFFAVPAVIIVDPELVKTILVRDFAVFHDRGIYNNPKDDPLSGQL  8319

8318  FLLEGLQWKILRQMLTPTFTSGRMKAMFGTIMDVAEEFRQFLVDSRERESVIEMKEVLAS  8139

8138  FTTDVIGTCAFGIECNTLKNPDSDFLKYGKKVFEQRMSTLFKFIFASLFKDLARKLGVKI  7959

7958  TDAGVEKFFLGLVRETVEFREKNNVMRNDFMNLLLQLKNKGRLVDQLDEADEVAARGLTM  7779

7778  EELAAQCFVFFIAGYETSSTTMNFCLYELAKNPDIQEKLREDIEEAVASNGGRVTYDLVM  7599

7598  GLRYLDNVVN (1)  7593

7510  ETLRKYPPIESLNRVPTSDYTVPGTKHVLPKQTMITIPIYALHHDPDFYLDPDNFD  7343

7342  PDRFLPEAAQARHPYAFIPFGEGPRNCIGMRFGLMQTKIGLITLLRNFRFSPSAKTPDKI  7163

7162  AFDVKSFVLSPDGGNYLRYDKI*  7094

>CYP6S3 1.371_6 AAGE01028822 Nelson’s version 100% to CYP6Sae

MILILLLLAATALFFRWINAYRARYQFWKEHNVPHLEPRFPVGNAGDILKSTIHFAHIMDNLYRELKHFGDYAGIYFFRD

PVLVVLSPEFAKTVLVKDFNYFLDRGVYSNEKDDPLSANLFFMEGHRWRKLRAKLTPTFTTGKLKAMFHTILAVGEQFDR

YLQDYTKQKDEVEVKDLLARFTTDIIGSCAFGIDCNSLENPESKFRQMGKRMINFPKLKALKIFFAMMYRKQARWLRIRF

NDEDVSDFFFAVVRDTIRYREENNFERKDFMQLLIELKNKGYMEDDGEYVEELQGGRLEKLTFEEIAAQAFVFFFAGFET

SATTMTFALHLLASNQEVQDRGRKCVYEVLERHDGKLSYEALMEMTYIDCIIQETLRIYPPVATIHRITTKPYKLPNGSV

LPEGVGVVIPNLAFQRDPEFFPEPMQFRPERFFEDEKDKRHNFCHLPFGEGPRICIGMRFGLLQTRMGIAMLLKNYRFRL

CPKSVFPLKTDPINLIYGPAGDVWLGIEKIQ.

>CYP6Y3 1.371_10 AAGE01054542 76% to 6Y1

MWLVYLVWLVAAVLLAVYLWIKKRFNFWKDRGVEYIEPEFPFGNFKTLGKVEHIAPITQR

HYDYFKQKGVPYGGVFMLTSPLLYILDTKLIKTLLVKDFNHFPNRGVYFNEKDDPLSAHMFAI

EGNKWKTLRNKLSPTFTSGRIKMTFPLVVGVCQQFCDHLGEVVQQSNEVEMHDLLSRYTI

DVIGTCAFGIDCNSFREPDNEFRKYGKIAFDKLPHSPLVVYLMKAFRSYANAFGMKQLHE

DVSSFFSKVVKDTIEYRESNNVVRNDFMDLLLKLKNTGRLEESGEEIGKISFEEIAAQAF

IFFTAGYDTSSTAMTYTLYELALNQKAQEKARKCVLDIFAANNGTLTYESVGNMGYLDQC

INETLRKHPPVAILERNADRDYKLPDSDIVIKKGRKIMIPTFAMHHDAEHFPDPERYDPDR

FSPEQVACRDPYCYLPFGEGPRICIGMRFGTIQARVGLASLLKRFRFRVCDKTQIPVRYSK

TNFILGPANGVWLRVEKL*

>CYP6Z6 1.371_16 CYP6Zae2

MFIYTFALFWLALVLVLRYIYSYWDRNGLASIKPQIPYGNLKSVAQK

TQSFGVATCELYWKSQERLAGIYLFFRPAVLIRDAHLAQRIMTTDFSYFHDRGVYCNEEI

DPFSANLFAL

PGKRWRNLRHRFTPLFTSGQLRCMMPTILDVGHKLQKFLEPAAERQEVVDIREIVSRGVL

ELIASLFFGFEADCINDPDDAFSKTLREFQLGGFMNNFRTACTFVCPELLQVTRISSLSP

QMIKFATDVVTKQIEHREKNNVSRKDFIQLLIDLRREEANNNEVALSFEQCAANVFLFYV

AGSDTSTSAITFTLHELTQNPEVMDKLQSEIDEMLVQTNGELTYTAIKELPYLDLCVKET

LRKYPGLAILNRKCTKSYAVPESSVVIQEGTQIMIPLLAYGMDEKYFPEPERYYPERFNKQSKNYDEKAYYPFGEGPRNCI

AYRMGVMVSKIGLILLLSKFKFEATQGPKIVFSAATVPLVPKGGIPVKISNR*

>CYP6Z7 1.371_17 AAGE01005406

MLFVYTLTILSIAITLVLKFVYSYWDRYGVQNIKPHIPFGNLKTVVKKTESFGVAINQLY

WQTKGQLVGIYLFFRPAILIRDAHLAQQIMTTDFNHFHDRGVYCNEEGDPFSASLFSLPG

KRWRNLRNKLTPLFTGGQLRGMMPTILAVGDKLX

KHLEPVAENREPIEIRDIVSRFV

LEIIATVFFGFEANCIKDRNDAFCRVLREAQRESMYTNFRAAAVFVCPGLLKYTGISSLE

PEVKEFVSGIVTEQIEHREKNGATRKDFIQQLIELRREDSQNQNVRMSIEQCAANVFLFY

IAGSETSTGTITFTMHELSQHPEVMKKLQAEIDDTLAKSNGEITYENVNQIQYLDLCVKE

TLRKYPGLPILNRECTSDYKVPDLDLVIRKGTQVVIPLYGISMDEQYFPEPECYKPERFD

GASKNYDEKAYYPFGEGPRNCIAFRMGVLVSKIGLVLLSSKFNFKPTQGPKIVFSPAAVP

LVPKGGISLMISRRDKVADLYMGLHISVVLKVVCS.

>CYP6Z8 1.371_18 AAGE01065173 6Z3 like

MFIYTFALFWLAVAFAIRYIYSYWDRNGLPSIKPHIPYGNLKAVANRTESFGVATCDLYW

KSKDRLVGIYLFFRPAVLIRDAHLAQQIMTTDFSHFHDRGVFCNEEVDPFSANLFALAGK

RWRNLRNKFTPLFTAGQLRCMMPIILSVGHKLQNVLEPAAKKQEVLEIRELVSRCVLDII

ASVFFGFEANCINDPNDAFIQNLRELQYDGFFNNLRAAASFICPELLKLTRISSLSPEMI

RFVTDIVTKQIEHREKNKVTRKDFIQLLIDLRREDTNNNEAALGFEECAANVFLFYVAGS

DTSTSAVAFTLHELTQNAETMGKLQTEIDEMLVKTSGELTYDGIKEMSYLDLCVKETLRK

YPGLAILNRECTKSYAVPNSDILLKKGTQVVIPLLAYGMDEKYFPEPDRYLPERFDKSTK

NYDEKAFYPFGEGPRNCIAFRMGVMVSKICLVLLLSRFNFEATRGPKIDFTPSTVAL

LPKGGIPVKISIR.

>CYP6Z9 1.371_19 CYP6Zae1

MLFIYSVALLCIAVTLALKYVYSYWDRHGLPSVKPHIPFGNLKTVVKKTESFGIAINQLYWQTKGQLAGIYLFFRPAILV

RDAHLAQQIMTTDFNHFHDRGIYCNEEGDPFSANLFALPGKRWRNLRNKLTPLFTGGQLRGMMPTILEVGEKLQKHLEPV

AERQEVVEIRDIVSRFVLEIIATVFFGFEANCIEDRDDSFSKVLREAQGERLSAVLRAAAMFVCPGLLRYTGISSLEPQV

IAFVSEIVTKQIEHREKNSVTRKDFIQQLIEIRRGSGENQVPAMSIEQCAANVFLFYAAGSETSTGTIAFSMHELSHHAD

VMKKLQDEIDDALAKSNGAITYESVMQMQYLDLCVKETLRKYPGLPFLNRECTMDYKVPDSDLVIRKGTQLVLPIYGFSM

DEQYFPEPECYIPERFEEASKNYDEKAYYPFGDGPRNCIAYRMGVLITKIGLILLLSKFTFEATQGPKMMFSSASVPLLP

KDGISLKISNRKR*

>CYP6AA5v1 1.702_3 AAGE02023125.1  55% to 6AA2, 97% (12 aa diffs to AAGE01185776)

15290  MVFLFTTLCLLLPHLGLLYYYVRRKFAYWADRGVPYVPGSLPMGSFNGMGSTKHFVELLD  15111

15110  PVYKQYRNTHKAVGMFLSINPVLLAVDPDLVKQILVKDFNSFHDRGMYFNERDDPLASHM  14931

14930  FSVEGERWRFLRNKLSPTFSSGKIKYMFLTVREIGLEFLASFEPFMERKEPVEIGIQAQK  14751

14750  FTCDVIGSCA FGLSCNALKDESTELLDIADRVFNPKPLEMMYMLLLICFRKWAVKLRLKQ  14571

14570  TPADIERFFVNMVRKTVEHREKNNISRPDFLQLLMQLKNKGTLEESKEDSKETISMNDVI  14391

14390  AQAFLFFFGGFETSSKALSFALFELALNPELQEKARDEVLRTLDKHDGLLTYEALKDMTY  14211

14210  VEQIVH (1)  14193

14133  ESLRKYAPIGNVIRKANEPYQIHSPDIILEKGTMVMIPVHSIHHDPEIYPDPSR  13972

13971  FDPDRFTPEAISARHSHSFLPFGDGPRNCIGMRFALLEVKFGIAQLLSRLRFTVNEKTQL  13792

13791  PLRYDPKTNVASALGGLWLDVERI*  13717

>CYP6AA5v2 AAGE01185776 probable allele

MAFLFTTLCLLLPLLGLLYYYVRRKFAYWADRGVPYVPGSLPMGSFNDMGSTKHIVELLDAIYKQYRNTHK

AVGMFLSINPILLAVDLELVKQILVKDFNSFHDRGMYFNERDDPLASHMFSVEGERWRFL

RNKLSPTFSSGKIKYMFLTVREIGLEFLASFEPFMERKEPVEIGIQAQKFTCDVIGSCAF

GLSCNALKDESTELLDIADRVFNPKPLEMMYMLLLICFRKWAVKLRLKQTPADIERFFV

NMVRKTVEHREKNNITRPDFLQLLMQLKNKGTLEESEEDSKETISMNDVIAQA 682

681 FLFFFGGFETSSKALSFALFELALNPELQEKARDEVLRTLDKHDGLLTYEALKDMTYVEQIVH (1)

    ESLRKYAPIGNVIRKANEPYQIHSPDIILEKGTMVM 325

324 IPVHSIHHDPEIYPDPSRFDPDRFTPEAISARHSHSFLPFGDGPRNCIGMRFALLEVKFG 145

144 IAQLLSRLRFTVNEKTQLPLRYDPKANVASALGGLWLDVERI*

>CYP6AA6 AAGE01569058

MGLYNTVLYLVLPIVWLLYTYFRRKYSYWADRNVPQVPGSL

PLGSFNGMGTKYHFVDVLKRVYDTYHKTHKAIGMYLSVKPILFVSDLDLIKKILVKDFNS

FRDRGMYYNEKDDPLSAHLFSIEGERWRFLRNKLSPTFTSGKIKYMYLTICE

IGEEFLACFDKYLDRKEAVDIKPLAQRFTSDVISSVAFGLKTNALKNEGSELLNKGDSVF

KPGRWETIRIFALLSYRDLAKKLGLRQFPRDVTDYFMDIIRGTVDHREKTNVMRQDFLQL

LLKLKNKGTIEDHEEESKEKITLNELAAQAFLFFFAGFETTSTTVSFALFELANNAEVQEKTR

QEVQRVLAKHGGHLTYDAIKDMTYLEQVVNETLRKHPPVGNLIRLANDPYRIDSLGTDIE

RDTMIMIPVHAIHNDPDIYPDPERFDPYRFTPEAINARHSHCFIPFGDGPRNCIGMRFAL

VEVKFGIAQLLTRLRFTVNEKTQFPVRYDPKSQFAEVKGGIWLNVERI*

>CYP6AG3 1.231_4

MWWTVVGVLGGILSAIYLFLSWNFNCWKKDGIKGPKPRLLFGNLPNVLTQKKHIFYEYEKIYNDFKTEPVVGYFSVRTPQ

LMIREPELIKEVLIKGFRYFSANEFSDVVDEKSDPLFARNPFSLSGEKWKTRRGEITPAFTNNRIKALSTLMDEVCDRMT

DHVKKQKESALETKELMSKYTTDVVSNCVFAIDAQSFSKDKPEIREMGRRIMDFNFAAQIILMVTTFLPSVKKFYKFTFV

PREVEQFFIRIMKDAIRHRKENNIVRNDYLDHLLSLQEKKQISEIDMAGHGVSFFADGFETSSLVMTYCLFDLASHPEIQ

TRLREEIRNVQATKGGINYDNIGEMTYLDQVLNETLRIHPIIPVLAKRCTESTVLVGPKDQKIPVSAGTTVVIPYFVQLD

SQYYQEPNKYNPERFSPENGGTKPYRERGVYFPFGEGPRMCLGMRFAIAQVKRGIIEIIDKFEISVNSKTQVPLKYEPKM

FMLYPVGGIWLNYKPIK.

>CYP6AG4 1.231_5

MWWTVVGVLGGILSAIYLFLSWNFDCWKKDGIKGPKPRLLFGNLPNVLKQKKHIFYEYEKIYNDFKTEPVVGYFSVRTPQ

LMIREPELIKEVLIKGFRYFSANEFSDAVDEKSDPLFARNPFSLSGEKWKTRRGEITPAFTNNRIKALSTLMDEVCDRMT

DHVKKQKEPAVDTKELMSKYTTDVVSNCVFAIDAQSFSKDKPEIREMGRRIMDFNFRAQIILMITTFLPSVKKFYKFTFL

PREVEQFFIRIMKDAIRHRKENNIVRNDYLDHLLSLQEKKQISEIDMAGHGVSFFADGFETSSTVMTNCLFDLASHPEIQ

TRLREEIRNVQATKGGINYDNIGEMTYLDQVLNETLRIHPIIPVLRKRCTESTVLVGPKDQKIPVSAGTTVVIPYFVQLD

SQYYQEPNKYNPERFSPENGGTKPYRERGVYFPFGEGPRMCLGMRFAIAQVKRGIIEIIDKFEISVNSKTQVPLKYEPKM

FMLYPVGGIWLDYKSIK.

>CYP6AG5 1.231_1 AAGE01005157

MWLIVISILVTIVSLVYHYLTWNFNYWKYRGVPGPLPKPFLGTFSSTFTQKEHPIEENNRIYRLFREYRKDVPFIGGFSF

RSPQLFALSPTLVKDILVKYHKHFRANEVGGTFDSKADPLLARNPFFLDGEEWRSKRAQITPAFTNSRLKALLPIMDNIC

NNMVSYIDRHIPNGPIESKELSAKYTTDVVSSCIFGAEGGSLTSDRSEIREMGNALFQQTFMFIVLAVISSIAPILKRFV

KLSLIPKSIENYFVGLMTEAVRKRKASGTKQVDYLDHLINLQEQKEISILDMAAHGVTFFIDGFETTSEVLGFSLLELSI

DKEIQNRLRQEIHSAEDGQLTFETIMELPYLDQIVNETLRKWPPAYALSKRCTEEITFRLKDNHEVLIEKGITAILPIWA

IHLDKEFYPDPNRFNPDRFSEEDGGHSVRYYQEKGVFLPFGDGPRACIGRRIGLLQVKRALVEIVKNYDFTVNSKTVLPI

KIDPKNIAVTPLGGIWIDYRKL.

>CYP6AG6 1.231_2 AAGE01002325

MFLTITLIVTAVAAIYLYLTWNYNYWKKLNVPGPSPLPGLGSFPSFITQRRPVADEMDEIYREYKPKYNFVGVFSNRSPR

IMITSSELAKDILSKNFKNFHDNEFGEMTNKEIDPLFGRNPFMLTGDEWKAKRAEITPAFTTSRMKALFPLVEDVCSRMT

KYVTQNRGSVLDSKELSAKFTTDVVSSCIFACDAQSFTSGKPEIREQGRKLMEQSFSSFLILLFIINFPTLAKIFKIGLV

PKSLEKFFTDLMKEAISHRDASGTNRVDYLDYLISLRNKKEISELDMAAHGVTFFIDGFETSSVAISFMLYEIAKNPEVQ

KRLRKELQKVTTDQGTVSYDSLLELSYLDQVVNESLRLWPPAAFISKKCTEPMDLPLTANQNVTIGKEICAIINIWSLHR

DPEYYDDPLTFNPDRFSPETGGTAPYREKGCFIPFGDGPRQCLGMRFARMQVKRCLYELVSNFKITVNEKTKQPMKLDPK

QFLTMPLGGIWLDFEPISK.

>CYP6AG7 1.231_3 AAGE01024111 JP_25

MFITITLIVSAVTAIYLYLTWHFNYWKKLNVPGPSPLPGLGNFPSFITQKRPVAEEMDEIYREYKPKYNFAGVFSNRSPR

IMITSAELAKDILVKNFKNFHDNEFGELTNKEIDPLLGRNPFLLDGSEWKAKRAEVTPAFTTSRMKALFPLVEDVCSRMT

KYLIKNRGSVIDAKELSAKFTTDVVSSCIFACDAQSFTSEKPEIREQGRKLIEQTFSSFMLLLFIVNFPTLAKIFHVGFI

PKSMEKFFTNLMKDAVRYRDASETNRADYLDYLITLKKKKELSELDMAAHGVTFFIDGFETSSVAISFMLYEIAKNPTVQ

KRLRQELKKVTTDNGTVSYDSLLELSYLDQVVNESLRLWPPAAFMSKKCTEPMELPLTANRSVTIGKEVCAIINIWSLHR

DPEYFDDPLTFNPDRFSPETGGTSPYREKGCFVPFGEGPRQCLGMRFARMQVKRCLYEAVTNFAITVNPKTMEPMRLDPK

QVLTMPLGGIWLNFEPISK.

>CYP6AG8 1.4359_1 AAGE01024260

MLVTVGLLLTAFAALYLYLTWHFDYWRKRNVPGPEPLPLVGNFPAFFRRNRPVMEEKYQIYKDYCSKYNFVGIFTNRSPQ

IFITSPALARDILVKYFKNFHDNEIGLITNKELDPLFGRNPFVLNGAAWKAKRAEITPAFTASRIKALYVSVENVCAQMT

KYVKEHCESPIEMKELGDKFTTDVVSSCIFGADAQSFIHQDAEIRDMGSKLMDSSLSFALKMAVMTVLPSVAKIANMSLV

SKPREKFFIKLMAEAIRHREESSEKYLDFLDYLSMLKKEKNITELDMAAHGVTFFLDGNETSSATLSLNLYELAKQPEIQ

KRLREELMNATNDDGTISYETLSELPFLEQVFSEGLRLWPPVTFMSKVCTDPIELDLTSTRKVPIERGTCAIISNWSLHR

DPNFYEDPLKFNPDRFAPEKGGIFPYKEKGCYMPFGDGPRQCLGMRFGRMQVKRGIYEVIRNFEISVASRTSDPLKIVSS

PAISLGLSGIWLSFKPIRS.

>CYP6AH1 1.257_1 AAGE01277917 63% to 6AH1 Anopheles (ortholog)

MLELYIALAVLAVCLYFKWSCSYWRRVGNVDGPQPLPIFGNGLEQITGAKHFGEIFEEVYRTYPTAAWVGIYELFNKPAI

VVRDLELVKEILVGSFQHFNRNSFEVDETIDPLVAINPFTQSGDLWKERRSQVVPVFSQTKIRSCFPIIKNVADNFLEYV

TKTRKTSPDFEAKDICARFTIDSVASCAFGIDAESFTNPNSEFRRVGFELFNPSSIMATVRSLLALFAPKLASLLRIPFV

PPYVDRWFRKLVNEVIRQRKEGEVKRQDLFQAMYDTLTQQGTVDVKNDEIVGHSVTFLTEGFETSSTLMCYFLYELASNQ

HIQDRVLNEIDCVLKEYDGKLTDEAVNKLTYMERAMYETLRMHSPVFTLTKVCTKEYELPPQYTDDVGKRITMKPGMSAI

IPVHAIHLDPEIYPDPCRFEPDRFLDENRKGRHRYAFLGFGEGPRICLGMKFGLSQSKIGIATLLSKYRVVGSDKQELPL

EISRKSFLLASKNGIWVKFVERG*

>CYP6AK1 1.136_1 AAGE01171970, 69% to 6AK1 Anopheles (ortholog)

MPLVAWLAAIALICYLAWKRNNFWNRHGVPYVLEIPAVGNFSSVALQMHSMFD

YVARIYDHVRTRDADFFGINIFFRKALVIRNPDMVKKMLVADSRYFINRQMC

TDREGDHFGYYNLMMIKEPLWKDLRGYLSPSVTSSRLRRMFSLIDEIGNNMLAHLDGVQQKPTK

LRETEFKELCARFTTDVIASTFFGIQANCLSDEESEFRYYGR

KIFEYGPKRALNMAAFFFMPELVPYLGFKLFPRDTERFLKTIIEQEIARRETSGENRGDFIDSMIALKNNEATIGVEEKIHLKGDILVAQAATFYMASFETTSSVLSFTLYELTKN

PEIQQRLREEIHNCIKKYGRDLSYECLVNEMPYLGMVISEAARLYPVLPFIERQCSLPAGA

TGYKLDPFHNFVVPNKMPVLVPIYAIHRDPKYFPDPLRFDPDRFSKDNADNIVPCSYMPFGVGPRTCLGSHFGTLQVKVAITRLLSKYRI

LRSESSPETLTYRKNAFTLHSNEGLYADLELDELC*

>CYP6AL1 1.354_1 CYP6AL1v2 6I1.2

MLFLAFAIFVLFAIIQIVYHFRYWMRRGVPQLRPSFPFGDFGEF

FRQKHGIPMTYANIYARTRHLPYVGIYLSMRPVLFVNDPQMVKDILSRDFEHFHDRGL

HVNEETDPLSGNLFSLGGVKWKNMRAKLTPTFTSGCLKGMLAILIDKATVLQKQFAKE

IATHNTIEVKDLFARYTTDVIASVAYGIDNDSINNDHDLFRQMGIKVFQQDFKTSLRL

ALTFFIPKIKALLGFSLVAKDVEDFMINLVSKTIEHRERNGIQRKDMMQLMLQLRNSG

SVSINDQQWNLDSSATVKNLTINQVAAQVFVFFVAGYETSSTLMSFCVWELARNPEIQ

VKVHQEIDSVLSNYGGALTYEALADMEYLECCMEETLRKHPPVSFLNRECTKTYRIPE

TDVIIDKGTAVVVSLLGMHRDPQHFTQPTEFKPERFSSDEQSNESNKAYFPFGGGPRL

CIGMRLGMLQAKVALVTLLAKFEFSLGKEHVKDMELPLKANTLLLVPQDGIQLVVKKR.

>CYP6AL3 1.415_1 AAGE01116725

MLLAFLALSAPLVTVLIWLQFRYWTRCGVPQLDPSFPFGNFSEFFCQKNGIPSTYANLYHRTKHLPFVGIYLSLRPALLINDPELVKNILTRDFEHFHDRGIHVDEETDPMSGHLFALGGVKWKNLRAKLTPTFSSGSLKEMFPLLVEKATVLQKRFLKEIATSEVVEVKELAACY

TSDVIASVAYGIDMDSINNRDDLFRRMGEKVLAHDLITSLRLALAFWFPKLKVMLGSKSIAPVIQEFMTELVRKTIEHREKEGVHRKDMMQLLLQLRNGVSLKRNGVQWTEDSAPKNAIKSLSIDEVTAQVMVFFVAGYETSSSTVSFCLFELARHQDIQAKVHQEIDTVLAEHEGNLTYASLASMKYLEQCLEETVRKYPPVAILNRECTKTYRIPETDVIVEKGTPIVVPLMGMHRDPQYFPQPNDFQPDRFEGGAQSKAYFGFGAGPRLCIGMRLGILQSKVAVVTLLRKFKFSLANPEDQHTELRMKPRSFILTTEGGIQLVVQQRHVCET*

>CYP6BB2 1.1327_1 AAGE01011017  CYP6Pae1, 54% to 6BB1, 53% to 6P4, 48% to 6P1

MDPVTVILTIFVGLTGLVYFFLRREQQKWPRLGVPFAKNPH

LLFGNVRGIFQKEHSCEILQRLYWEFKGRGLKLGGIMNFFQPAVLVIDPEISKSILVKD

FNKFHDRGIFVDPAGDPLSANLFSLEGAQWKAMRTKMSPTFTSGKMKYMFESVLNVAERLK

DYLAENCLKEDIELKNILQRFTMDVIGNVAFGV

ECNSIKNPSSEFRLMGLKANRFDGVRFLKFFIGGAYKNFAKKIKLKVVEDDVHKFFMSLV

HSTVHYREGNNVKRNDFLNLLMEIKNKGKFSDEPNSGGEGITMNEIAAQCFIFFTAGFET

SSTTINFCLYELANNPDIQDRLRNEIEDVVAKDGGELKYDTLLGMNYLDRVVS (1)

ETLRKYSAVDNLFRISNSPYTPDGCNFTIPAGTLFQIPIHSMHHDPEYFPDPGRFDPDRF

LPEVAKSRHPYCYLPFGEGPRVCIGVRFGLMQTKIGLVTLLRDFRFGPRSETPDRLQFEA

KTFVLTPQTGIYLKIEPIGI*

>CYP6BY1 1.7_1 AAGE01026936

MSALLIILALTPLFLFIIYVKQKYAYWARRNVPFLKPHFPYGNFEALDRKSIADVAREAYEEMKNRGPFYGAYFFLQPLITITDPDLIKMVLIKDFNTFPDRGLYFNERDDPLSAHMFAIEGNKWRSLRQRLSPTFTSGKMKMMFPTLAAVGDQFSAFLDEEIGSGKVVEVKDFMAKFTTDIIGSCAFGIECNSFKDPHGRFRQFGKMVFETPVHGSLVRFALKSFPEISRRLRIKALHEEASKFFYGVVEDTVKYREKNGVERKDFLSLLIDMKKDGVDFTMDEIAANSFIFFGAGFETSSSNQTFCLYELARNPECQDKARQSVLDALRNHGGMTYDAACDMQYLDQCINETLRLYPSVPVLERRAFQDYKIPGHDVVIPKGMKINIPAYAIQRDERFYPDPDVFNPDRFHQKEVAKRHICTFIPFGEGPRICIGLRFGMMQSRVGLATILSKFRISICSETANPLEYSSKTSVLIPKEGLWLRVDPL*

>CYP6BZ1 1.702_2 AAGE01408667 50% to 6P2

MAILELYLAIGVTLVLATAGCVFLFLDKKRSFWKDRNFPCTGRAKMIYGDYKNMNQTEHMQYINQRIYNEFKARKLPIGG

TVLFLVPSTVVVDPDLIKAMLVKDFNFFHDRGVYNNPEVDPLTGHLFSLEGQAWRQLRAKLSPTFTSGKMKMMFSTILSV

ADDLKEFLLEKTESGPTELEMKNVLAGFTTDVIGSCAFGIECNSLRATHCRFREVSRKIFEQSVGQMLWMIVLMLFKGVA

TKLKLKATPAEVENFFTNMVQETIDHRERNNVQRSDFMNILIQMKNSTNLEEKLTLNEITAQSFIFFVAGFETSSTTMVN

CLFELAMNPDIQEKLRAEIFKVCGEGDLTYESVSSVEYLNMVIDETLRKHPVVDSLLRTSTQPYNIPNTDLKIPKGTFVF

IPVHALHHDPEYYPDPDRFDPERFNAENRASRHPFVYLPFGEGPRNCIGMRFGLMQTRVGLITVLRNFRVRPSSNTPERL

VVNPKSGIPAPLGGIPLLIERI.

>CYP6CA1 1.1219_3 AAGE01005840 no introns

MLLCLLILGSIATFYLFLHHHYSYWKRRGISQLKPSFAFGDFGPVIRGRANFVHHLQGIYERTKRDYSLLGLYVLFRPAL

LVNDFVVARDILSRDFQHFGDRGIYVDEKRDPFSGHLFALDGERWRHVRHKVAPAFTPLKLKDVFQTQLIGGVVLQDHLK

HFAESGQSVDVADLFLRYSVDMIASVAFGVEIDSVNCPEEQFYRVAHSSVESNVKNLLRWTGGFLIPKVLKYTGTR  LVDQ

HVQDFFMHVVQQTVEYREKTGFTRRDVLQSLLKIMNAESQNVSIDFTITDLTVTAFTFLLAGMETSSSTATFCLYEIVNN

QEIQRRLQKEIDESLQEHDGLITYDSVVAMKYLDHCVNEAMRKFPALAYLHRICTEDYLVPSTRTIIKKGTLVLIPIYAL

QRDQEFFPHPDLFLPDRFNDPEAIRQAPFFPFGEGPRSCIGQRMGKMNVKIALVHLLSRYNFTLANPVDQGREAPIDPLH

FTISPQGSFNMNVTHRKCSSPSSHSKSLTNHSVSLAH.

>CYP6CB1 1.48_4 AAGE01206812

MLLPILLVVLVVYLFQKWTYSHWKRRGVPQLNPAFPFGNVADTFKQRTSYSNRLAELHHQAVRDGHRFVGIYTLLQPILL

VTDVELVKRMLTVDFEHFVDRGAHVNEKRDPLSGHLFSLTGAKWRRMRLKLTPAFTTAKLKAMFPTMMACGRTLSAVIDD

HVGRALAIRDLMTRFTMDVIASVGFGLECNSMRNPDELFRQMGGRFFSKSWKTSVRMLLAFVAPKVNRYLQVKLNDDDVE

EYMLNLVRDTIAKREGGGEVRKDFIQLLVQLRNQVEVKDGGSWEMNKVDQNKTLTVEEMAAQSFVFLNAGYETTSSTVTF

CLFELCRNKDLIGKVQEEIDRVMDGGREISYEALAEMTYLESCIDETLRKYPISPVLFRVCTKPYKIPETDVVIEKDTLV

QISLVGLQRDTRYYEDPMKFDPDRYGERKSETMPHYSFGDGPRVCIGLRMGKVMAKMALVELLSRYDFELESPAADSGEI

ELDPSLLMLQAKHDVKLIPRLRTK*

>CYP6CB2 1.1337_1 AAGE01003592

MFLVILLITLSLYLYQKWIYTYWKRRGVPQLNPSFPFGDVADTFKQRKSYANRLAELHHQSASDSHRFVGIYTLFQPILLVTDVELVRRMLTVDFEHFTDRGAHVNEKRDPLSGHLFSLAGAKWRWMLQKLAPAFTSAKVKSMFPTMMTCGRTLSAVVGDHLGRALPIRALMTRFTMDVIASVGFGLDCNSMRNPDEPFHKMGSKFFSKSWKTSVRMLLAFVAPKVNRFLQLKLNDDDVEEYMLNLVRDTIAKREHGGEVRNDFIQLLVQLRNQVEVEDGGSWEINKVEPNKALTVQEIAAQSFVFLNAGYETTSSTITFCLFELCRNRDLLGKLQEEIDEVVDGGREASYEAITEMTYLEACVEETLRKYPISPVLFRVCTKPYRIPDTDFVIEKGTLVQISLVGLNRDPRYYEAPLKFDPDRYGERKAETMVHYSFGDGPRGCIGLRMGKVMVKMALVELLSNYDFEMESPTGENELDPSLLMLQPKHDVILIPKFM*

>CYP6CC1v1 1.1327_5 AAGE01083421b 17 diffs, new gene or allele?

MISGTVCIVLVLANVAFLVLFVRGVLQSRQVYWVRRRIPFVAWPHLLFGNVRRLWRHEHSSTIGQRLYRDLKARRLAAGGFNLLVSPSILVADPDLAEEVLVGNVRRFPDRGLHVDAEVDPLSETLFALSGNSWQDKRNQLTPVFSEETLKPVFRMIASFADELRKEISKNLDRRLQDVQEWVSRYVTQVMGKSVFGMRCRMMQDPNTDFRRYGRISTELSWLLLLKNWIGVTMPWIARKVGLRITDATVEKFYVDLCRSNVLVRESYKVKENDILQLFMRLREARQLTMEELTTACYSFVKHGMEPCTSVMTFCLYELAKNVSIQKRLRDEISHYLEDTDGQLTYDVIMSMNYLDQVVNETMRKYPPVDFIYRRSSQSRDNIPQGTLFVIPVYAFHHDPDHFPAPEKFDPERFTAKQARTRHPYCYLPFGAGPRECLGARFGLLVVKAGLVTLLRRFRFAMPEELVHEKLQFKPNASVLSPVEGSVRLRVEAI.

>CYP6CC1v2 AAGE01083421a

MISGTVCILLVLANVAFLVLFVR

GVLQSRQVYWVRRRIPFVAWPHLLFGNVRRLWRHEHSSTIGQRLYRDLKARRLAAGGFNL

LVSPSILVADPDLAEEVLVGNVRRFPDRGL HVDAEVDPLSETLFALRGNRWKDKRNR

LAPVFSEETLKPV FRMVASFADELRKEISINLDRRLQDVQEWVSRYVTQVMGKSVFGM 202

203 RCRMMQDPNTDFRRYGRISTELSWLLLLKNWIGVTMPWMARKVGLRITDATVEKFYVDLC 382

383 RSNVLVRESYKVKENDILQLFMRLREARQLTME 481

482 ELTTACYSFVKHGMEPCTSVMTFCLYELAKNLSIQKRLRDEISHNLEDTDGQ 637

638 LTYDVIMSMNYLDQVVN (1) 688

745 ETMRKYPPVDFIYRRSSQSRDNIPQGTLFVIPVYAFHHDPDHFPAPENF 897

898 DPERFTAKQARTRHPYCYLRFGAGPRECLGAR

    FGLLVVKAGLVTLLRRFRFAMPEELVHEKLQFKPNASVLSPVEGSVRLRVETI*

>CYP6CD1 1.138_1 AAGE01126587

MILTTVFLIGLLYKNPVAFFLVIVAGLLVRELIKYHFRHWERCNVPGPKPSLIFGNIASNIFLRQHFAEMIDGWYNKFPN

APFIGFYKIFKPSVMIRDPEMIKNVLVRDQACFSANDFAFDEKLDPLLAHNPFMVSGERWKKSRQLLTPIFTGSKMKQLF

PIMDEISSQFVDFVGRQCGREVEAKSISAAYTTQNVAGCAFSLDADCFNNPNSEWRVMGKKIFQPTLLAGIKFMLMLFVP

SVTWFIPVPFLPKEVDRWMRKLVSTLLQERKNKQPERDDQLQSLLKTKSAELTEEQIAGHSLAFFSEGFETSSTTMGFAI

LHLAENPDVQEKLFQEIQNTLGKNDIPLTFDLVQKIEYLDWVLQESLRITPPAAGLQKLCTQNYCLKYKVDGKEVGTWIM

PGTTVLIPIVAVHMDPKYYPEPEKFRPERFSPEEKAKRTDPVYYPFGEGPRMCLGMRFAQIQIKMALLKLVQQFRVRTSP

NYKPWQYNRNTFLTEAKDGLQVVFERRS. 

 

 

>CYP9J1/9J2v2 AF390099 mRNA new to this set, probable allele of 9J2

MVEVNIFSALAVGAVILLLYHYIAKKYHYFLTKPIPCIKPTFLL

GIFDMVVLKRVELVFGSKLLYNSYPDAKIIGYYELTKPTYMVRDPEMIKKIAIKDFDS

FTDRTPVFGDAVPADSLFFNSLFSLRGQKWRDMRSTLSPAFTGSRMRHMAELVVKCAT

SMTDFFHSEAKAGRRLEFNMKDTFSRFVCDAIASVAFGIEVDSFRDPENESYKKGNES

QKIHTFKSLATFVTLRFVPFLQKVFNFDFVDANVAGYFKKLILDNMDQRNKQGIVRND

LVNMLMETKNGALKYEEQDTQVPEGFATVEESHVGKSTHSRIWTDNELISQCFFFFFA

AFDNVSSILTFLSYELTVNQDIQRRLYEEIAVTESTLNGQPITYEALQKMAYLDMVVS

ETLRKYPTATLTDRYVNKDYVFDDEEGLRFVIEKGKTIWIPMLALHHDPKYFPEPERF

DPERFSEDNRSKIVPGTYLPFGAGPRSCIGPRLALLEVKMALYHLVKDFNLQASEKTQ

IPLRLSKSAFTMQAENGVWLELKARPKA

>CYP9J2 1.221_4 AF329892 JP_11 100% note: 9J1 mRNA may be an allele of 9J2

MVEVNLFSALAVGAVILLLYHYIAKKYHYFLTKPIPCIKPTFLL

GIFDMVVLKRVELVFGSKLLYNSYPDAKIIGYYELTKPTYMVRDPEMIKKIAIKDFDS

FTDRTPVFGDAVPADSLFFNSLFSLRGQKWRDMRSTLSPAFTGSRMRYMAELVVKCAT

SMTDFIHSEAKAGRRLEFNMKDTFSRFVCDAIASVAFGIEVDSFRDPENEFYKKGNET

QKIHTFKSLATFVTLRFVPFLQKVFNFDFVDANVAGYFKKLISDNMDQRKKQGIVRND

LVNMLMETKKGALKYEEPDLQVSEGYATVEESHVGKSTHSRIWTDNELISQCFFFFFA

AFDNVSSILAFLSYELTVNQDIQRRLYEEIAATESTLNGQPITYEALQKMAYLDMVVS

EALRKYPTATLTDRYANKDYVFDDEEGLRFVIEKGKTIWISMLALHHDPKYFPEPERF

DPERFSEDNRSKIVPGTYLPFGAGPRSCIGPRLALLEVKMALYHLVKDFNLQPSEKTQ

IPLRLSKSAFTMQAENGVWLELKARPKA

>CYP9J6 1.62_2 CYP9J6 AY433038 AAGE01000868 CYP9J6 6I2.1

MEVNLGAVIVILSTVILIYKWITRNNDYFHEKPIPSMAVKPLFGSTGPLILKQFSLHGFI
NHIYQKYPNAKVLGIFDALTPIFVVRDPELIKKIAVKDFDHFIDHRPMFGNSENDNPYS
IFGKTLFALEGQKWRDMRATLSPAFTGSKMRKMFELVIECSDSVAQYYVKQSKKVVEVEL
TDMCTRFGSDVIATCAFGIKMDSLRERDNEFYDNGKKMMRFERLSVALRMFAFKFFPTLM
GQMGIDIIDREQAKYFSALIMDAVRQRQTKGITRPDMIQLLIQARKGTLKHQEEKEVEEG
FASVKESSIGKTNVSFNMTDNEMIAQAFVFFLAGFETVSTTLTFLIYDLVVNKDVQQRLY
EEIVATNDSLQGKLLNYDTLQKMKYLDMVLSESMRIRPAAATLDRLCVRDYEVDDGQGLK
FTINKGTAVWIPTQGIHMDPMYYPNPERFDPERFNDENKATIDPMTYLPFGVGPRNCIGS
RFALMEIKAIVYYLLLHFSFEANRKTPIPLELRKGFTIVAAEGEVWIDMKAR*

>CYP9J7 1.118_9 CYP9J7 = AAGE02029679.1 CYP9J7 6T1.5

MDTIFVLALVGLLLLILLVLLYRFLSRKNDYFLNKPIPSLPGPLLLGGTSPLMLFRVSFT
DYVKTVYDSFPDAK (2)
VCGVMNTVIPLYIVRDPELIKKIAIKD
FDHFADHRPVFGSDHGDHPNLIACKALFVLTGPKWKTMRATLSPAFTGAKMKFMFELIVE
CSEALVDYYRDQGAKEWDMKDLFARFSNDVIATCAFGIKVNSSSDRDNEFYRRGKEMMVF
TNFKTQLKIAGYLFTPWLMNWFGIDLIKQEHSDYFAGLIRDTVRTREANGIIRPDMVHLL
MQSRKGILKNQQEDDPEQEVSETTRSLPGPTMTESEMIGQCLFFFLAGFDTVSTALTFLA
YELALNPDVQEKLSAEIAETHQSLNKRSITYEALYSMKYLDMVISESLRKWPSAPAVDRL
CVQDYTLDDGQGLQFRMEKGIGIWIPIYGIHRDPKYYPEPDKFDPERFSEQRKGDIQPGT
YLPFGIGPRSCIGMRFALMELKCIVYYLLLNFRLEKTERTEVPPVLEKGYVTLSAANGVW

LKMVPK.

>CYP9J8 1.221_9 AAGE01187448 JP_1 AAGE02011008.1 (third P450 on contig) CYP9J8 6T2.2

MLDPFLLAAFAAVIFLVYHLLNRKYQFFAERGIPYVKPTLLLGNGASVLLKKEDLLQNIQRTYETFPNAKIMGIFDFVKPIMMIRDPDAIKQIGVKDFDHFVDHTPLFTPADCEDVGTNSLFGNSLFALRGQKWRDMRATLSPAFTGSKMRHMFELVLDCARSTAEYFREEAKSGRTTEYEMKNVFSRFSTDVIGSVAFGIKVDSLREQDNDFFVKGKAMLNFQNLKSLIKVIMLRSAPGLMNRLNVDITSPQMNAYFKDMIMDNMKQREINGIVRNDMINILMQVQKGALLHQKDEQDTKDAGFATVEESSVGKALHNRVWSENELVAQCFLFFLAGFDTVSTCLTFVSYELLANPDVQQKLFEEIMAVEASLDGKLLSYEVLQKMQYLDQIISETLRLWPPAPFVDRYCVKDYLFDDGQGTRIPIEKGQIVWFPITALHHDAKYFPEPNRFDPERFSEQNRPKINPGAYLPFGVGPRNCIGSRFALMEVKAIVYHLVKNFTLERSGKSRVPLKLEKSYIAMIVEGGMWLEFRPRA.

>CYP9J9 1.221_5 CYP9J9 9J9v1 CYP9J9v1 6T2.3

MVEVDLYVAVAIGAIILLLYHYGSKKYEYFLTKPIPALKPTFLLGNT

GAMMFRRRDVSAHVKLLYNSLEGYKVAGFYDLMKPIYM

LRDPEVIKQIAVKDFDYFMDHTPTMTNNRADDEVGGDSLFGNSLFALRGQK

WRDMRATLSPAFTGSKMRHMFELVADCAKSMAEFFKSEAAAGKKLEYEMKDTFSRFGNDV

IATVAFGIKVDSLRDRDNEFYMKGKNMLNFQSVSVMFKFLLLRAFPKLSQKIGVDFVDST

LTEYFKGMIVDNMKQRDAHNIFRNDMIQMLMEVRKGSLKHQKDEKETKDAGFATVEESNV

GKSTINRVWTENELIAQCFLFFLAGFDTVSTCMTFLTYELMLNPDIQQRLFDEVMETEES

LNGKPLTYEVLQRMEYMDMVVSEALRKWPPAVVSDRFCVKNYMYDDGKGTRFPIEKGQTM

WIPTIAIHSDPRYYENPEKFDPERFNEENRSKIDTGAYLPFGVGPRNCIGSRLALMEVKV

IIYNLLKEFSLEASEKTQIPLKMAKNFFALQAENGVWLELKPRKH*

>CYP9J10-de2b  AAGE02029680 new pseudogene exon 2, upstream of 9J10

37792  KIYEYFLSKPVPCIEQTFFEGRNGPTLLRKGDINT  37688

37592  RVTGFYDLTAPMYMLPDPEMIKKV  37521

37208  PEQFDPERFNAVNRT*ISTNLCIPFEFKPCNCIGLRLALIEMKRIIF  37068

37077  YHLLKDFELLTSKKTQIPVHNARDPFALHPEKSVRAELK  36961

>CYP9J10 1.221_6 CYP9J10 AAGE02011007.1 5 (sixth P450 on this contig) CYP9J10v1 6T2.5

MVEVDLYVALAVGAIVVLLYHYAAKKYEYFLTKPIPALKPTMLFGNTGPMMFRQRDVSSHLKMLYNTYEGSKMIGFYDLMKPIYMLRDPEVIKQIAVKDFDYFMDHTPTMTNSNPEDEVGGDSLFGNSLFALRGQKWRDMRATLSPAFTGSKMRHMFELVADCAKSMAEFFKAEAAAGKTLEYEMKDTFSRFGNDVIATVAFGIKVDSLRDRDNEFYLKGKAMLNFQSLSVLVKVLFLRAFPKLSQKLGLDFVDSTLTEYFKQMIVDNMKQRDAHGIMRNDMIQMLMEVRKGSLRHQKDEKETKDAGFATVEESNVGKSNINRVWTENELISQCFLFFVAGFDTVSTCMTFLTYELMLNQNIQQRLYDEVLETEKSLNGKPLTYEVLQKMEYMDMVVSEALRKWPPAVISDRFCVKNYMYDDGQGTRFLVEKGQTMWIPTIAIHSDPKYYENPEKFDPERFNEENRSKIDTGAYLPFGVGPRNCIGSRLALMEVKVIIYNLLKDFSLVSSEKTQIPLKMSKNFFVLQAENGVWLELKPRKR.

>CYP9J10-de1c  AAGE02011007.1 pseudogene exon 1 new seq last P450 on this contig

168bp downstream of 9J10, 51% to CYP9Jae4

220106  MLQVHMFLAATVVLLL*YSYSITT*RNIYEYSLSKPISCAKPTFLVGRNWSTSLCKADMT  220285

220286  LHFKKICVFFPDA  220324

>CYP9J15 1.221_1 AAGE01005986 JP 8 100% to CYP9Jae7

MDFTFWGVMAAAAIGIGLIYRYMTRNYFYFADKPIPFLEPVFAIGNLGPLLMKKRDIFEHFRWLYNRFPNDKIFGMFSMS

DPVFMIRDPAMLKRIAVKDFDHFADHSGLGGDTELDNPHMLVLNTLVALRGNKWRDMRATLSPAFTGSKMRQMFALIAEC

GQRMVEFYKGAEEGSRIEVEAKEMFSRFTNDVIATTAFGIEVDSFRQPENEIFSLGKAVMQPSGLLNTLKGIGYVLFPKL

MVKMNVDFLSKKDDQFFRGTIQETMRIRQEKSIFRPDMIELLIQAKKGNLKHSADKQSEVEAFSAAEESQVGRRSHDRTW

TDDELIAQALIFFSAGFETVSTTLSFVAYELARNDDVQSRLYEEILETNRSLDGKILSYEALQAMPYMDMVVSETMRLWP

IGTIVDRLCVKDYVYDDGQGCRFTIEKGRSVMGSVIGMHHDPKYYPQPEKFDPERFSAENRRNINPDTYLPFGIGPRNCI

GSRFALMEMKAVVYYLLLNLSFDVTEKTQIPLKMQKSPSRFVSEKGIWIALKPRVTVV

>CYP9J16 1.221_2 AAGE01172381

153975 MLEVNLFAAIAVGALILAVYHHISKRYQYFLSKPVPCMKPTFLVGNSGPMLTRKKDIASHIRTMYDTYPDAK (2) 154190

154250 MIGFYDLTKPVYLVRDPEVVKTMTVKDFEHFTDHTPTMTGTGEEVSEKSLFGNSLFALRGQKWRDMRSTLSPAFT

GSKMRHMFELVVECGQSMAEFLISEAKAGKRLEFEMKDTFTRFGNDVIATVAFGIKVDSMRDRENEFYMKGKQLLNFQRFTLMIKFLLMRAMPALAEKLGADFVDAEAGKYFTGVIMENMKQRKAHGIVRNDMIHMLMEVRKGALKHEKGEQETKDAGFATVEESQVGKTTHSRIWKDNELVAQCFIFFLAGFDTLSTGLTFLTYELALNPEIQQRLYEEVMETESNLDGKPLTYEVLQQMKYMDMVISESLRKWPPGIVADRYCTKDYQFKDGPGSFLIEKGTSLWIPTIAIHNDPRYYPNPDKFDPERFSDENKSKINPAAYIPFGVGPRNCIGSRLALMEMKSVVYYLLREFSFEPTEKTQIPL

KLTMSGFTLQGEKGVWLEFKPRSI* 155653

>CYP9J17 1.221_3 AAGE01021462

MEVDLFAAIAVGALILAVYHHLLKRYQYFLTKPVSCVKPSFPMGSSGVMLTRKRDIFSHIQMMYNTYPDAKIMGFYDFTKPVYMIRDPEVIKRITVKDFDHFIDHTPSMTGQGEEPGENSLLGNTLFALRGQKWRDMRSTMSPAFTGSKMRHMFELVAESGQSTAKFLLAEAKARKRLEFEMKDTFTRFGNDVIATVAFGIKVDSMRDRDNEFYMKGKQLLNFQTFLLKIKFIMMRAMPTLAEKLGVDLLDAEAVKYFKGMILENMKQRKAHGIIRNDMIHMLMEVRKGALKHEKDEQDTKDAGFATVEESQVGKTTHSRIWKDNELVAQCFIFFVAGFDTVSTGLTFLAYELALNPEIQQRLYEEIIETETTLEGKSLTYEVLQKMKYLDMVVSEGLRKWPAGILGDRYCTKDYQYKDAAGSFVIEKGTSLWIPTIAIHNDPQYYPNPEKFDPERFSDENKSKINPFAYMPFGVGPRNCIGSRLALMEMKLIMYYLLREFSFEPTEKTQIPLKLVMSGFALQGEKDVWLEFKPRAL.

>CYP9J18v1 1.221_7 AAGE01179692

MAAAVLVAVLLFCRYVAKKYQYFLTKPVPCVKPTFLLGSSGPTIFRKVDVATHFKKIYDVFPQAPVIGFYDFTTPMYLLRDPEMIKKVSIKDFDYFTDHVPMMPTDAEKEHNPDTLFGNTLLSLRGQKWRDMRSTLSPAFTGSKMRHMFELVAECGRSLVEHFKAEAAAGRTMEHEMKETFSKVGSDLIATLAFGIKVDSLREPENVFYANGKKMLNLKSLATFVKFLLITFVPRLMRWLKVDVLNGQSAAYFKRIILDNMEQREAHKILRNDMIQILMEVRKGTLQHQKEEKDTKDAGFATVEESQVGKSSHSRVWTENELVAQCLLFFLAGLDTISTCMTFLTYELTVDPDIQQRLYEEITETDKSLNGKPLSYDVLQRMQYMDMIVSETLRKWPPGVISNRYCNKNYLYDDGRGTQFVIEKGQVILIPSYCIQRDPRYFPDPDRFDPERFNEANRAQINTCAYIPFGVGPRNCIGSRLALMEVKCMVYYLLKDFELIATEKTQIPVSIARDSFGLHPEKGVWIEFKPRSSQDS.

>CYP9J18v2 1.118_12 CYP9Jae4 not sure of start - maybe 8 amino acids shorter

96% to 1.221_7, possible allele

MLKVDLFMAAALLAAVLLFCRYVAKKYQYFLTKPVPCVKPTFLLGSSGPTIFRKVDVATHFKKIYDVFPQASVIGFYDFTTPMYLLRDPEMIKKVSTKDFDYFTDHVPMMPTDAEKEHGPETLFGNTLLSLRGQKWRDMRSTLSPAFTESKMRHMFELVAECGRSLVEHFQTEAAAGRTMVHEMKETFSKVGSDLIATLAFGIKVDSLREPENVFYANGKKMLNLKSLATFVKFLLIMFVPRLMRWLKVDVLNGQSAAYFKRMILDNMEQREAHKILRNDMIQILMEVRKGTLQHQKEEKDTKDAGFATVEESQVGKSSHSRVWTETELVGQCLLFFLAGLDTISTCMTFLTYELTVDPDIQQRLYEEITETYKSLNGKPLSYDVLQRMQYMDMIVSETLRKWPPGVISNRYCNKNYLYDDGRGTQFVIEKGQVILIPSYCIQRDPRYFPDPDRFDPERFNEANRAQINTSAYIPFDVGPRNCIGSRLALMEVKCMVYYLLKDFELIATGKTQIPERIARDSFGLHPEKGVWIEFKPRNSPDF

>CYP9J19 1.221_8 AAGE02011008.1  use this seq 6 diffs to AAGE01339434 (second P450 on contig)

MEVDLLSAFAVGCIVILIYHYVSQKYLYFLAKPIPSLKPTFLVGNIGDIIFRTKDALTHINELYYAFPESKVVGFYELTK

PVFMLRDPEVIKQITVKDFDHFMDRSLPSANDRADTDQPVEGLFANSLVAFQGQKWKDMRSTLSPAFTGSKIRHMFDLVA

DCSRSMVEHFRSEANAGRRLECELKDVFSRFCNDVIATVAFGIRVDSVRDPETEFYVKGKQLLDFQSPKIILKFLLFQTV

PWLMRKLKVDFADADLADYFKGIIQDNMKQREVHGIVRNDMVQMLMEVRKGTLKHIGDDRESKDSGFASVEESHFGKSTH

SRAWTDNELISQCFVFFIAGLDTVSSCLTFLTYELTLNPDIQKRLYEEVMDTERLLSEKPLSYEALQSMKYLDMVVSETL

RKWPPTIDTDRYSTRDYLLDDGAGLKVPIEKGRSIYIPIVAIQNDPKYYPDPDRFDPERFSDENRSKIVPGTFIPFGAGP

RNCIGSRLALMEVKVAVYYLLREFSLERTERTDVPIRLTKKAIDLRTENGAWVELKPRKI*

>CYP9J20v1 1.221_10 AAGE01007189 AAGE02011008.1 (fourth P450 on contig)

MFFALAIFAGLVLFCLYNVQQKYKYFESRGIPYVKPSFLLGNGAPLIFKKKDMLRHIQDLYHTHPEAKIMGLFDFTAPVW

MVRDPEAIKQLAVKDFDHFSDHTPIYTGGDVEDMGTDSLFGNSLLLLRGQKWRDMRATLSPAFTGSRMRLMFELVSECAQ

SMVDYFREEATAGKRLEYEMKDVFSRFSNDVIASVAFGIKVDSLREPDNEFFINGKELMNFRNMKTVAKVLLMRMFPRLM

IKLKADISSAEMNAYFRGMITDNMKQRQAHGIVRNDMINILMQVRQGALKNQKEDQETSNAGFAVVEESTTIGQPRDRVW

SDNELAAQCFLFFIAGSETVSTYLTFLAYELLINPEVQEKLFREIAEVERSLAGKPIGYDQLQAMKYMDMVVSENLRLWP

PAPFADRYCSKNYRYDDGQGTRVTIEKGQIVWFPTTALQHDPEYFPDPYRFDPERFSDQNRSKIKTGTYLPFGIGPRACI

GSRLALLEVKVVAYHLVKHFKLVRSERSKVPLKLKSKMIGMEVDGGVWLELEPRERS.

>CYP9J20v2 1.1188_13 AAGE02029680.1 note 9 P450s on this contig

13173  MFFALAIFAGLVLFCLYNVQQKYKYFESRGIPYVKPSFLLGNSAPLIFKKKDMLRHIQDL  12994

12993  YHTHPEAK (2) 12970

12907  IMGLFDFTAPVWMVRDPEAIKQLAVKDFDHFSDHTPIYTGG  12785

12784  DVEDMGTDSLFGNSLLLLRGQKWRDMRATLSPAFTGSRMRLMFELVSECAQSMVDYFREE  12605

12604  ATAGKRTEYEMKDVFSRFSNDVIASVAFGIKVDSLREPDNEFFTNGKELMNFRNMKTVAK  12425

12424  VLLMRMFPRLMIKLKADISSAEMNAYFRGMITDNMKQRQAHGIVRNDMINILMQVRQGAL  12245

12244  KNQKEDQETTNTGFAVVEESTTIGQPRDRVWSDNELAAQCFLFFIAGSETVSTCLTFLAY  12065

12064  ELLINPEVQEKLFREIAEVERSLAGKPIGYDQLQAMKYMDMVVSENLRLWPPAPFADRYC  11885

11884  SKNYRYDDGQGTRATIEKGQIVWFPTTALQHDPEYFPDPYRFDPERFSDQNRSKIKTGTY  11705

11704  LPFGIGPRACIGSRLALLEVKVVAYHLVKHFKLVRSERSKVPLKLKSKMIGMEVDGGVWL  11525

11524  ELEPRERS*  11498

>CYP9J21 1.221_11p AAGE01004684 AAGE02011008.1 both ours were wrong CYP9L

19802  MDINSYYLLVTIVLLILIVLYRRVSKHYGYFSDKPIPSLTPIPLFGNMFPLFMKKYTFPE  19981

19982  FIQMIYNRFPDAK(2)

       ALGMFDMSTRFVVLRDPELIKKVLVKD  20161

20162  FEFFIDRRSLFGDSASESDSILITKTLLLLTGQKWRDMRATLSPAFTGSKMRAMFELIVT  20341

20342  YSDRMVGILKDQAGPVGYVDYEMKECCSRIASDIIATCAYGLEVESLANRENDFYTMGKK  20521

20522  MMNFGKTSFFVRLLLYSVFPKLMSKLQVDLFDGEQTRYFTEIIKDTVKARD*HGIVRPDM  20701

20702  IHLLMQARKGVLKHHQETAEASAGFATVEESEVGKTAIGKTMTDSEFVAQCLIFFIAGFE  20881

20882  AISSQMSFMCYELATNPDIQQKLYEEIKETNKLLKGKPLTYDTLQQMKYMDMVTSEALRM  21061

21062  WSGPATDRKCVRDYVLDDGAGWKFPIEAGTCVMIPSYAIHRDPKYYPNPDRFDPERFSEE  21241

21242  RRADINMTMYLPFGAGPRNCIGSRFALMEMKAIVYGLLLNFSIERNEKTQVPLRLNKGFA  21421

21422  PLAGEKGMHLRLKVRG*  21472

>CYP9J22 1.221_12 59% to CYP9J5

MEVNVLYLLIVVAVLAVIYRRITRFYEYFHDKPIPSMAAGPPFGSAGPLYRKKYSFNDFIKMTYDKFPGAKVFGLCDMTTKLFVIRDPELIKKVTVKDFDYFVNRRATFGESIDDHDEMLFAKSLLALNDQKWRDMRATLSPAFTGSKMRAMFELIEGYSARMVEILKEQSQAAGYVDYEMKDCFTRVANDIIATCAFGLQVESLKNRENEFYVMGKNMLNFNRVSIMFRIFGFNLFPGLMAKLGVDLIDAEFGQYFSKIIKDAVHTRETRGIVRPDMIHLLMQAKKGALKSQYETTDANTGFATVEESEVGRSSIAKAITESEMIAQCFVFFLAGFDSVSSEMVFMAYELALNPDVQQRLYEEIVETDKQLGGKPPTYDTLQKMQYMDMVVSESLRMWPAGAFDRKCDRDYVLDDGAGLKFTIDRGAYVWIPVHGIHRDPKYYPDPDKFDPERFSESNRDNIDMTMYMPFGAGPRNCIGSRFALMEIKAIMYALLLQFRIERNEKTSVPLKLVKGFAGLNGEGGVHLRLTLRQ.

>CYP9J23 1.1188_6 AAGE01001411 100%

MDLDWTQLLAIVAIVVIIYRWVNGNHDYFHHKPIPSMTVRPIMGSTGPLLLKQCTFPEFIQSSYKKFAGARVFGLFDTNI

PMYVICDPDLIKRIAVADFDHFMDHRPIFGASNSDHPNLLFEKTLFALTGQKWKNMRSTLSPAFTGSKMRQMFKFVVDCS

ESMVRFYQSEPRGTSHEMKDVFSRFANDVIATCAFGIEVDSLRKRNNEFYVHGSKMLRLTRLSVVARLLGYRFAPTLMGK

LGLDINDQEQNQYFSSLVKETVKIRDVQGIFRPDMVHLLMEAKKGTLHHQEEIEHNKGFATVEESAMTKMRSMNSMTEVE

LIAQCLMFFLAGFDTVSTCLTFTAYELALNPTIQDKLYEEIKRIHEAMSGKSLDYETLQKMSYMDMVISEVLRKWPAIAA

LDRLCVQDYEMDVGNGLKFTIDRGSGIWIPIHAMHHDPKYYPDPERFLPERFSDENKASINMGAYLPFGIGPRNCIGSRF

ALMEVKAIVYHMLLRFSFERTAKTQVPVEIVKGFAPLKPKDGVFLEFRPRDAV.

>CYP9J24 AAGE02029679 9J new seq 87% to 1.118_3

74892  MEVNLFYFGAIVAIFGA

74841  LYYLLTKKHGYFHDKPIPAMGAKPILGSIGDLMLQRVPFNTFLQAAYDKYS GVK  (2) 74680

74616  VFGMFDLMTPTYVIRDPELIKQVGVKDFDHFVDHEQVFGNSSYDH  74482

74481  PNLLTGKTLFSLTGSRWKTMRATLSPAFTGSKMRYMFELIVECIERAVKYYEEETKKKGA  74302

74301  QVYEMKDVFSRFANDVIATCAFGLQVESSRDRDNEFFVNGSKMVDFGKPSFILRLMGHQL  74122

74121  VPWLMAFFGWDVIDGQQNTYFKRLIMDAIKEREHRGIVRPDMINLLIQAKKGTLKHQQEN  73942

73941  EQVPEGFATVQESEVGKSTATTMMTDVEMVAQCLIFFLAGFDTVSTSLLYTSYELAVNPE  73762

73761  VQKKLYDEIQNTRTALGGKPLTYDAVQKMKYMDMVISEVLRKWPPIASTDRVCTKNYVMD  73582

73581  EGNGIKYTIEKGAALWFPTYALHHDPKYYPQPEKFDPERFSDERKGSINTGAYLPFGIGP  73402

73401  RNCIGSRFALAEVKTILYYMLGSFSFERCSKTEVPPVMPKGFDVIPVNGMHIEFKPRPKG*  73219

>CYP9J25P AAGE02029679 9J new pseudogene seq 88% to 1.118_4 62% to 9J5

72260  PFLGASGPLMLRKVTFIEFIQSIYNKYPGVK (2) 72168

72106  VFGMFDTITPFFEIR 72062

(deletion)

72060  IDLLDREQADYFTHVFQETIRTRESHGIIRHDMIDLLLQARKGTLKYHEEKDDQEGFA  71887

71886  TVQESEVGKVEMSKSMTEAEMIAQCLIFFLGGFDTVSSCIMFTAYELVRNPEVQQKLCEE  71707

71706  IVQTDKELGGKPLSYDALQKMKYMDMVVSESLRIWPLAPATDRLCTKDYIVDDGQGLKFT  71527

71526  IDKGTCVWFPAAGLHHDPQYFPNPERFDPERFNDENKRNINLGTYLPFGIGPRNCIGSRF  71347

71346  ALMEVKAVMYYILLKFTIARSAKTQIPVQLRKGFTNVGPDHGMHMELKLR*  71196

>CYP9J26 1.118_4 AAGE01065801  9Jae5

MEVELLHVGVLVAIVAFLYRWITRNNDYFHDKPIPSMAVTPFLGASGPLLLRKVTFNDFV
QSIYNKYPGVKVFGMFETITPFFVIRDPELIKQIGIKDFD
HFVDHRPTFGLDDETAEHPKALFRKTLFSMTGQRWKEMRATLSPAFTGSKMRQMFSLMSE
CCDEMMKHYLDKAKGSGRVEVEMKDLLSRISINVIASCAFGIKVDCFKEQEHEFLYHGRK
MMGFGRPIVIARMLAMRVFPKFAAKFGIDLLDREQANYFTHVFQETIRARESHGYIRHDM
IDLLLQARKGTLKYQEEKDDQEGFATVQESDVGKADVSKSMTEAEMIAQCLIFFLGGFDT
VSTCAMFTAYELVRNPEVQHKLYEEIKQTEKELEGKPLSYDALQKMKYMDMVVSETLRMW
PLAPATDRLCTQDYTIDDGQGVRFTIDKGTCVWFPAAGLHHDPQYFPNPEKFDPERFNDE
NKRNINLGAYLPFGIGPRNCIGSRFALMEVKAVMYFILLKFSFVRGAKTQIPMQLRKGFT
NLGPENGMHVELKLR*

>CYP9J27 1.1188_17 AAGE01006393 use this seq = AAGE02029680.1

MEVNLVYLAVVLAVIAYLYRWITRNNDYFHDKPIPSMAVRPFLGASGSLVLRKVSFPDFI
QTIYNKFPGVKVFGMFETITPFFVIRDPELIKQIAIKDFDHFVDHRPTFGLFDEESAEHP
NALFRKTLFSMTGQRWKEMRATLSPAFTGSKMRLMFSLMGECFDGMIDHYVKKAKTSGRV
EVEVKDMMSRVSINVIASCAFGIKVDCFKDQDHEFLRHGKKMMDFARPIVIARMMAMRVF
PKLSSRFGIDLLDPEQARYFTHVFQETIKARESHGTVRNDMIDLLLQARKGTLKFQEEKN
DQEGFATVQESDMGKVEVTKQITESEMIAQCLVFFLGGFDTVSTCAMFMAYELVRNPEVQ
QKLYEEVLETSKELAGKPLSYDALQKMKYMDMVVSETLRIWPLAPATDRLCTKDYTIDDG
QGLKFTIDKGTCVWFPAAGLHHNPQYFPNPERFDPERFNDENKRNINLGAYLPFGIGPRN
CIGSRFALMEVKAVMYYTLLKFTIVRSAKTQIPMQLRKGFTNLGPEKGMHVELKLR*

>CYP9J28 1.1188_3 AAGE01088707 CYP9Jae2 AAGE02029679.1

MEVNLFYFGVLVAILGTLYYLLTKKHGHFLDKPIPSMAAKPILGSVSDLMLQRVPFSTFIQ
TLYDKYRGVKVFGLFDMMTPTYVIRDPELIKQVAVKDFD
HFADHVQVFGNSSYDHPNLLTGKTLFSLTGLRWKTMRATLSPAFTGSKMRYMFELIVECT
ERAVRYYEKNALKSGPKVYEMKDVFSRFANDVIATCAFGLQIESSRDRDNEFFVNGSKML
DFSRPSVMLRIMGHQLVPWLMAFFGWDVIDEQQNTYFKTLILDAIREREHRGIVRPDMIN
LLIQAKKGTLKHQQENEQVPEGFATVQESEVGTSSVTTVMTDVEMVAQCLIFFLAGFDTV
STSLLYASYELAINPEVQQKLYDEIQNTRTALNGKPLTYDAMQKMKYMDMVMSEVLRMWP
PAPSTDRLCTKNYVMDEGNGVKYTIEKGTSVWFPIHALHHDPNYYPQPEKFDPERFSDER
KGSINAGAYLPFGIGPRNCIGSRFALAEVKTILYYMLGSFSFERCSKTEVPPVLAKGFDV
IPANGMHIEFKPRPKK*

>CYP9J29 1.1188_1 AAGE01015732 100%

MEVNLLLLATVLTVFVYLYRLITKNNDYFHDKPIPSLKARPLLGSTGPLLLKQVTFSDFVAYVYNKFPGVKVLGMFDTLT

PFFVIRDPELIKQIAVKDFDHFMDHRPFFGESVESEEHPYALFKRVIFALNGQQWRNMRATLSPAFTGRKMRLMFTLMVD

CSERMLKHYESLMSSTGQMEVEIKDMLSRYGINVIASCAFGIDVDCFKDVDHEFMYHGTRMLQMGNPLVIAKMLFTRMFP

KLANNWGMDVIPREQAVYFSKLIKETIRTRESQGIVRNDMIDLLLEARKGKLKYEEEREEEQEGFATVQESDVGKAQVTK

AISEVDMIAQCLIFFIAGFESVSANTMFMIYELILNPDIQQKLYEEVEQTYKELGDKRLTYDALQSMKYMDMVISETLRK

WPLTPVGDRMCVKDYVLDDGQGLRFTIDKGTCVWFPIHGLHHDPQYYPNPDRFDPERFKDQNKGHIKMGTYIPFGIGPRN

CIGSRFALMEMKALMYHMLRRFSFHRTANTQIPPKFRKGMNNFGTEQGLHVELRLRGQ*

>CYP9J30 1.1188_15 AAGE01253357 100% to CYP9Jae3

MEVNLLLLATVITVFVYLYRLITKNNDYFHDKPIPSLKARPLLGSTGPLLLKQVTFADFV

SYVYNKFPGVKVLGMFDTLTPFFVIRDPELIKQIAVKDFDHFMDHRPFFGESAESEEHPYALFKRVI

FALNGQRWRNMRATLSPAFTGRKMRLMFTLMVDCSERMLKHYESLMSSTGRMEVEIKDML

SRYGINVIASCAFGIDVDCFKDVDHEFMYHGRRMLQMGNPVVIAKMLFMRMFPNLAKKSG

MDVIPREQAVYFTKLIKETIRTRESQGIVRNDMIDLLLEARKGTLKYEEEREEVQEGFAT

VQESDVGKAQVTKAISEIDMIAQCLIFFIAGFESVSTTSMFMIYE

LILNPEIQQKLYEEVEQTYKQLGDKLLTYDALQSMKYMDMVVSETMRKWPLSPIGDRICV

RDYTLDDGQGLRFTIDKGTCVWFPIHGLHHDPQYYPNPDRFDPERFNDQNKGNIKMGTYL

PFGIGPRNCIGSRFALMELKAVMYHMLRKFSFHRSTNTRIPLKLRKGMNNVGTDEGMHVERIRRL*

>CYP9J31 1.62_1 AAGE01000868 CYP9Jae6

MEINLELWIAVISIGILLYKWITRNNDYFHEKPIPSMAVKPFFGGIAPLVFKSFSMNGFISHIYQKYPNVKVFGFFDALT

PIFVVRDPELIKKITVKDFDHFIDHLPMFGNSENDNPYSIFGKTLFALTGKKWRQMRATLSPAFTGSKMRKMFELVIECS

DSVAQFYKTQSNETHEVELTDLLTRFGFDVIASCAFGIRMDSLRDRDNDFYNNGIKMRRFQRLSVAIRFVMFKFCPTLMG

KLGIDVIDRDQVRYFSALIKDAVKQRQTKDIIRHDMIQLLIQARKGTLKHQEEKEVEEGFATVKESSIGKTNVTFNMTDN

EMIAQAFVFFLAGFETVSTALTFLIHDLVMNKDVQHRLYEEVASTHEYLQGKHLNYDTLQKMKYMDMVVSESMRMRPAGP

FMDRVCIHDYDLDDGQGLKFTIDKGTAVWIPVQGIHMDPKYYPNPERFDPERFNDENKAAINPMTYLPFGIGPRNCIGSR

FALMEIKAIVYYLLLHFSFEANRKTQIPLKLRKGFTVVAAEGEVWIDLKAR.

>CYP9J32 1.352_1 AAGE01063458 Nelson’s version CYP9Lae1 59% to 9J5

MEVNLLLLLIIVGILGVIYRQVKKHYDYFHDKPIPSMATVPLLGSTGPLMTKRCTFNDFIQTIYYKYPSAKV

FGLFDMTTKMFVLRDPEVIKKITVKDFEYFVDRRPLFGANKEDDGNENIL

FNKTLVGMVDQRWRDMRAILSPAFTGSKMRAMFELIEQYCTQMVPILKEQSAESGYVDYE

MKDFFSRVANDIIATCAFGLQVESLKSRDNEFYTMGKQMMNFNRFIVLLRVMGLRFFPSL

MIKMGVDIVDREQNQYFSKIIKEAVRARETHGIVRPDMIHLLMQARKGTLKHQQETTEST

AGFATVEESDVGKSVVSKTMSEPEFIAQCLIFFLAGFDTVSTGMLFMAYELDLNPNIQQK

LYEEIAQTNKELGGKPATYDTLQKMKYMDMVVS

ESLRMWPVAAFDRKCGRDYVLDDGAGLKFTIDAGTCIWVPVYGIHRDPKYYPNPDKFEPE

RFSDENRGKIDMTMYMPFGMGPRNCIGSRFALMEIKAIMYALLLNFSIERNEKTQVPLKL

VKGFVGLQVENGLHLRFKKRK*

>CYP9M4 1.29_1 AAGE01012700

MFESLALIVPVAAFLVYLWSIATYNYFKKRKIPFVKPYPLIGGLWPALTGKVLPLEAATLGYDMFPKHRFSGYFMFRNPE

YLIHDPALAKQVMIKDFDHFTDHTSVFPVEVDPIIGRSLFFMDGQRWRNGRSGMSPAFTGSKMRNMFTLLSKYADSAMQR

LVEDAGKNKLELEIRDLFQKLGNDIITSISFGLDIDSVHNPDSEMFKKGKQLAGTTGFQGFKFFLSMALPSSIYKLFGIR

LITKDVADFYLDIVTNTIKYREENNIVRPDFIHLFVQARKNELKEDKTDETLDSAGFTTVQEHIKSSSENSKYSDFGITA

VVASFFFGSIETTSTVLCFAMYELAANPEIQQKLQDEIELVKDQLNDSPLTYEVLQKMKYLDMVVSETLRRWPPLGTTNR

VCVKPYTLEDYDGTQVTIEKGQAVQIPIISYHHDPNYFPDPYRFDPERFSDESRDKINQDAFLPFGSGPRNCIGSRLALM

QVKSLLFYLLTCFSVEFSEKMDVPIKLKKMSMTYTAQSGFWFNLVPKSVEV.

>CYP9M5 1.29_2 AAGE0108959

MGVLEWLAVFVPIVTYLLYRWSTATYDYFREKKIPFVKPYPLFGSLWPIFSGKLHPVDATILGYDMFPGRRFSGFFTFRT

PSYLVHDPALAKQVLIKDFDHFTDHTSTILPDVDPVLGRNLFFMDGQRWRHGRSGLSPAFTGSKMRNMFVLLSNYVDGAM

KRLAQDAGPGKMELELRDLFLGNDIITSISFGVDIDSIHNPNNKFYKRGQKVTATGGIQGFKVFLTTVIPGSVFKFFGVK

VLPKEAADFYVDVISKTVKQREEYKIVRPDFIHLFMQARKNELKEDKADEELKDAGYSTVEEHLQSTTKNNQYTDLDIAA

VAVSFFFGGIETTSSVLSFVLYELCLNPAIQHKLQEEIDTVRAQLEGNPLSYEVLQKMKYMDMVVSETLRRWAPLGIVSR

KCVKPYTFEDHDGTKVTVEKGHIIQIPLQSFHRDPNFFPDPYRFDPERFSDENKHKIKQDTYIPFGSGPRNCIGSRLALM

QTKCVLFYLFANFSVEFSEKMDVPIKLNKMALSYTAQNGFWFHFAARDVKT.

>CYP9M6 1.29_3 AAGE01023613 JP_18 100% to CYP9Mae4

MVLLDLLVVLIPIVSYLLYRWAVATYDFFEKRKIPYVKPYPFVGGLWPVFSGKLHPTDAAVLGYNLFPEN

RFSGFFAFRRPGYLIHDPALAKQIMIKDFDHFTDHMNTISVDVDPIFGRALFFMDGQRWR

HGRSGLSPAFTGSKMRNMFTLLSKYVEGAMQRLAQDAGQGKMELEIRDLFQK

LGNDIITSISFGVEIDSVHNPNNEFFKRGKQLAATGGFQGLKFFFSLVVPDSVFKLFGI

RFLPKEAADFYVDVVSKTIKHREEYKIVRPDFIHLFVQARKNEL

KEETADDELKSAGFTTVEEHIEASTENSQYTDLDITAVAASFFFGGIETTTTMLCFALYE

LAGNKEVQQKLQAEIDSVRKELGGGSLTYEVLQKMKYLDMVVTETLRRWPPLGITNRVCV

KPYTFEDHEGTKVTIEKGQLIQIPVQSFHRDPSFFPDPYRFDPERFSEENKHKINQDAFL

PFGSGPRNCIGSRLALMQAKCLLYYLFSAFSLEYSDKMDVPIKLNKMSLTYTAKNGFWFN

LLPKKVAV*

>CYP9M7 1.29_4 AAGE01026951 100% to CYP9Mae3

METLVWIALVLLIIIFLIYRWSIACYDYFEKRNILY

VKPYPFFGGLWPVFCRKLHPTDATIMGYNMFPERRCSGLFTF

RNPAYDIHDPTLAKQIMVKDFDHFTDHMNTISADVDPILGRALFFMGGSRWRHGRAGLSP

AFTGSKMRNMFVLLSKHVDEAMRRLVEDAGEGALEVEIRELFQK

LGNDITTSISFGVEVDSVHNPGNTFLEM

GKLLIATSAFQGFKYLLSLVVPESVFKFFGVRFFPKEAADFYLDIVTETISHREKNKIVR

PDFIQLFVQARKNELKKDNTDDNFK

SAGFTTVDEYIESSTENGQYTDLDIAAVALSFFFGGIETTTTAICFAVYEIVLNATIKEK

LQTEIDSVKEGLEGRPLSYEILQQMKYLDMVVSEALRRWPPVGVTNRACVKTYAFEENDG

TTVTIEEGQVVHIPVQSFHRDSNYFPDPLRFDPERFSDENKHVINQDAFLPFGSGPRNCV

GSRLALMQAKCILYYFFCTLFDGLFQQNGPTDQTQDYVSLLRSAEWFVVSFDAEHGKVVKYKK*

>CYP9M8 1.41_1 AAGE01236202 100% to CYP9Mae1

MMELLLLGAAALTAVCYLLYRWSTSTFGYFEKRSVPFGKPYPLLGALWPYLKGEKSPVDALCEGYRHFP

GCTYSGVFLFRSPCYLIHDPELIKKIAVRDFDHFADHANNVSLEVDPFMGRVLFFANGQR

WKQGRTALSPAFTGSKMRNMFGLVSEYTNGAVQRLVEDAEASGGKMERELNDLFKR

LGHDAITSISLGTDIDSIREPENEFFAHGKELAKTTGLQGFRFFIMSLLPEKILRLSR

MRIVPEHLANFYHGVVSKVIKHRLDNGIVRPDFIHLLLQARRNELKTDKTDE

KFNDAGFATVQEHLQAPTKNPIEWTDYDIAATVATFFFGGAESTTALLCFTIYELALN

PHVQQKLLAEIDSVQKTVGTEKLTYESMQQMKYLDM

VISETLRKWPPFGVTNRRCTKPYQIQDVDGHSVTIEKGQVVFLPIQHIHRDPHFFPNPMR

FDPERFATENRDQLNQDAYLPFGAGPRNCIGSRLSLMQTKCFLYYLLSTFEVQLSNRTEV

PIEIDLKATGLNSKNGFWFHLIQRVK*

>CYP9M9 1.43_1 AAGE01015749

MILLLLVVAVGYLIYRWSVATFDYFEKLNVPFLKPYPFFGALWPSLKGE

KSPTDATAEGYRLFPGNRFSGFFSFREPGYLIHDPELIKQIAIRDFDHFTDHANNVPLEV

DPFLGRGLFFTGGQRWKHGRTALSPAFTGSKMRNMFQLLSSYTDGAMKRLVKDAAGGKLEREMKDLFQRLGNDVMTSISLGFDTDSVHDPDNEFFQYGKRLSRTSGLQG

LRFFVLTLLPENILKVIGIRIIPSDIANFYNEVV

IKVIKERLEKNIVRPDFIHLMLQARKNELKADKTDEFLNDAGFSTVKEHLQSSAKNQ

IEWSDYDIAATSASFFFGGIESTTTLVCFALYEIALNHDVQQKLRAEVDATKLSLGDAKL

TYESMQQMKYMDMVITETLRKWPPFGVTNRRCTKAYSLENANGTKVTVHKGQVIFIPIYE

IQRDAQYYPNPERFDPERFSDQNRGNLNQDTYLPFGIGPRNCIGSRLTLMQAKCYLFYML

TCFEIQLSTKTDVPMQLDARSSALNAKNGLKMQLIPRGV*

>CYP9AE1 1.96_1 AAGE01014192 AAGE02005788.1, ESTs DV359961,DV294300,DV294302,DV359959

MEAFLLISALVGALILLYRYATAFANYFNQRGIKYRKPTFLLGNLGPILFQRTT

PVANLTDLYREFAGEKVYGFYEFRRPTIILRDLQLIKRVF

VKDFNHFTNHTAPVDEHMDSILGNGLISLEGQKWRDMRAMLSPMFTGNKIRHMVPLVGKC

AEDLCRFVERETDEVEWDVRELLAKCLVEVIGSCAFGIEVDSFNDPDNEFDRVAKYLMNQ

SDVRKVARFLLIMVFPKMCKQFGMELFDDKYKRLFRRLVSETMLKRESDGVSRPDLIQLLMLARRG

KLEADKDVEGESFAAANDYLETGTDDVKRSWSDDELTAQAVIFFAAGFDTTSTLLSFTLM

ELAIHPEIQDRLFEEIKSVQRSDSVISYEQIQSLEYLDAVISESLRKWPPLTATDRKCTK

DYLMVDPEDGSPMFSIEEGYSVWVPIYCFHHDPKYFPNPEKFDPDRFNRVNRHQLNPAAY

MPFGVGPRNCIGSRFALMSAKMILLRLLRSFRVEVCPKTDTTLQLSKTKMNMTLEKGHWV

YLKRRS*

>CYP329B1 1.96_2p AAGE01024220 seq error? AAGE02005787.1  4455-6111

43% to 329A1 of Anopheles, ESTs DV315790.1, DV385613.1, DV351402.1

DV385611.1 plus 10 more cyan = site with variants in the ESTs (allele)

      METEDLYWFSFILVTIVGFFTFKLMTKNR  ILSGQRSSLREAAFYLRKSG*GNK (intron)  wrong N-term

4455  METEDLYWFSFILVTIVGFFTFKLMTKNRHFFRVRGVPFEKPHFIYGNLGEVTSGKLSSLELIASF  4652

4653  YQKFENER (2) 4676

4729 IFGFYNYLSPVYYIRDPELIRKLWINEF

NSFANHAYFLDESKDPILGNQLHLLKNEKWRQMRHTLTPVLSGQSVSSMSSLIRTNSLDLVDHLKASVDSELEFKGIFLK

YVFNVIANCAFGLELNTFKDESDKFCTYGTALVYGNNPVQTLKTMMFYLFPKMTTQMKVRLMEDEHAAYFTNLIGSTISE

REKKNVNRADVIQMLHQANKGELKAEGQDDEVLQMKDFSKCKWNQEELIAQCIAFFGSGFEPLVNLLSFAAYELAANPDI

QQKLLSELEGSLRDDPVVSDTVDKLSYLNMVISETLRKWPASPSLDRECSKDYLLDDGGCRVQFRKGDTLWVSIWALHRD

ERNFPDPERFDPERFSEKNKASITPGTYMPYGVGPRNCI (1)

GTRLASLVAKITLVDLVRNFKLELGSRMVQPLRLSKTSYSMEPEGGFWLKMTPR*

 

 

CYP4 clan

 

 

>CYP4C38 1.673_1 AAGE01009885 CYP4C38 4T1.4

MSELTTFIYGILVFLIFAPFLQWWVKRARLVQIIDKIPGPKAYPFIGTTYTFFGKKHYELFYIIDERTRRYPDIHRIWTG

MRPEIRISKPEYVETIIGASKHMEKSHGYDFLFDWLGEGLLTSKGERWFQHRKLITPTFHFNILDGFCDVFAEQGAVLAE

RLEPFANTGKPVDVFPFITKAALDIICETAMGVKVNAQTGGENNYVNAIYRMSEIFVDRSIKPWLHPEFIFKRTEYGRQH

KKALDIVHGYTKKVIRDRKEALQVKENSTGAGDTGEDLYFGTKKRLAFLDLLLEGNAKHKQLTDDDVREEVDTFMFEGHD

TTTAGMSWALFLLGLHPDWQDRVHQEIDSIFAGSDRPATMKDLGEMKLLERCLKETLRLYPSVSFFGRKLSEDVTLGQYH

IPAGTLMGIHAYHVHRDERFYPDPEKFDPDRFLPENTEHRHPFAYIPFSAGPRNCIGQKFAILEEKSIVSSVLRKFRVRS

ANTRDEQKICQELITRPNEGIRLYLEKRQ*

>CYP4C50 1.295_3 AAGE01102043.1 4C25 ortholog  80% to 4C25

MIEATVKSSFVLSKVAKMLSYFSPITIILATMIAGAIYVYNKRRARLVKLIEKIPGPASMPLIGNSLHINVDHDEIFNRI

ISIRKLYGRQQGFSRAWNGPIPYVMISKASAVEPILGSPRHIEKSHDYEFLKPWLGTGLLTSQGKKWHPRRKILTPAFHF

KILDDFVDIFQEQSAVLVQRLQRELGNEEGFNCFPYVTLCALDIVCETAMGRLIHAQKNSDSDYVKAVYQIGSIVQNRQQ

KIWLQPDFIFKRTEDYRNHQRCLSILHEFSNRVIRERKEEIRKQKQSNNNTINGNANNAVEANILDGNNNAEEFGRKKRL

AFLDLLIEASQDGTVLSNEDIREEVDTFMFEGHDTTSAAISWILLLLGAEPAIQDRIVEEIDHIMGGDRDRFPTMKELND

MKYLECCIKEGLRLYPSVPLIARKLVEDVQIEDYTIPAGTTAMIVVYQLHRDPAVFPNPDKFNPDNFLPENCRGRHPYAY

IPFSAGPRNCIGQKFAVLEEKSVISAVLRKYRIEAVDRRENLTLLGELILRPKDGLRIKISRRE. 

>CYP4C51 1.295_2 92% to Aedes albopictus AY971511

MLKEPLLLVITIASQLLHAVKEFPLPATVLLGVVIVVYLFAHADRDQLKSLLRINGAKDGSKKSVKFYLNQLPGPQCIPL

LGNSLMMATDREDMFNRLTTARKLYGRKQGICRIWNGRTPYVLISKAEPVERILSSSVNIEKGRDYGFLRPWLGNGLLTC

PGSRWYKRRKALNPTFNYKMLSDFLEVFNRQAQTMVRLMEKELNRENGFNCTPYATLCSLDILCETAMGYPIQAQEQFGS

DYVKAHEEIGRIMLERLQKIWLHPDFIYKRTNFYKRQSECLKILHGFSENVIKQRRLQRDASLANKHDEDPSIEIGRKRQ

LAFLDLLLEATQDGQPLSDRDIRDEVDTFILGGHDTTATAIGWLLYLLGTDLQVQDRVFEEIDSIMGQDRDRPPTMIELN

EMKYLECCIKEALRLFPSIPLIARKLTESVNVGDYTIPAGTNAVIVVYQLHRDTQVFPNPDKFNPDRFLPENSQGRHQYA

YIPFSAGPRNCIGQKFGLLEEKAVAVAVLRKYRITSLDRREDLTLYGELVLKSKNGLRISISQRQ.

>CYP4C52 1.295_1 AAGE01029369 Hils Version  72% to 4C26

MNHNIAAKIASLFSVLSPITTVILVVMVCAIITYKKKRARLVHHINRIPGPFMLPIIGNGLHVTLGCKDEFLDRVISAQK

MYGRRIGMSRAWNGPIPYVMISKASAVEPILSNPKLVEKSVDYDFMKPWLGNGLLTSRASVWHPRRKTLTPAFHFKILSE

FVNIFHKQALVMNEKLAEQLDNTAGFDIVPFTTLCALDIFCETAMGCPVNAQRNSDSEYVRAHKLIGKIIRNRLQKVWLR

PDFIFKHTEDYRKHHECLQVLHSFSDRVVQERKAEIVAKRRQAEDLIDLNNNNESEELTSCCRKKQLAFLDLLIEGSLDG

NGLTDLDVREEVDTFVIGGHDTTAAAMAWILLLLGSDQKIQDRVIDEIDGIMNGDRDRKPTMQELNDMKYLECCIKEGLR

LYPSIPLIARRLTEDVQVDDYIIPSGTTTLIVVYQLHRDPSVFPNPDKYNPDNFLPENCSGRHPYAYIPFSAGPRNCIGQ

KFAILEEKMVLSTVLRKFRIEAVERREDVKLLGDLVLRPRDGLKIRVSRRL.

>CYP4D23 1.283_3 CYP4D23v2 4T1.3

MSILDWILVITGAVLAINYLLVRRNLKYQSQWPGPAAVPLIGCYYLYFNKKPEDVMDFIFTLSRKYGTMFRVWVGTRLAL

FCTNTPDTETVLSSQKLIRKSELYKFLVPWLGNGLLLSTDQKWFNKRKIITPAFHFKILEQFIEVFDRQSGILVQKLKPE

ASGKLVNVYPYVTLCALDVICETAMGTPINAQTDVDSKYVRAVTELSYLLTTRFVKVWQRSDFLFNLSPDRKRQDKVIKV

LHDFTTNIIQKRRKELMDHGDSGISGDDSIGSKKKMAFLDVLLQASVDGKPLTDKEIQEEVDTFMFEGHDTTTIAIAFTL

LLLARHPEVQEKVYKEVTEIIGTDLSIPATYRNLQDMKYLEMVIKESLRLYPPVPIIGRKFTEKTTIGGNVIPEDSNFNL

GIIVMHRDPKLFDDPEKFDPERFSPERTMEQSSPYAYIPFSAGPRNCIGQKFAMLELKSTLSKVIRNYRLTEAGPEPQLI

IQLTLKPKDGLKIAFVPRA.

>CYP4D24 1.283_7 AAGE01006231 CYP4D24 4T2.6

MLILLASVVVLSIGLAVYFYQQFANRLHYAAKIGGPKGYPLLGNSIQYGTKSPVEFLQEVQKTNEQCGKFYRLWIGPDLI

FPITDAKLAILSSQKLLDKSVQYDFIRPWLGNGLLTSTGRKWHSRRKIITPTFHFKILEQFVEIFDQQSNIFVGQLKSKA

QSGEDFDVFPVVTLCALDVICESAMGTKVNAQLNSDSKYVRAVKDMATVAMARSFKAFARFNFTFYFTPYRRMQDKALKV

LHDYTDSVIRSRRLELAKGAFTKSDENENDVGIRKKVAFLDMLLQATVDGRPLDDLEVREEVDTFMFEGHDTTTSAISFL

IGILAKHPDVQQKVYDEVRNVIGDDLNVSVTLSMLNQLNYLDLVIKETLRLYPSVPIYGRMLLENQEINGTVFPAGSNLA

IFPYFMGRDPEYFENPLEFRPERFAVETSAEKANPYRYVPFSAGPRNCIGQKFAVAEIKSLISKLVRHYEVLPPKQPNSE

RMIAELVLRPEGGVPVRIRSRVR.

>CYP4D37 1.283_4 AAGE01019344 82% to AAGE01055570 same seq as AAGE01019344.1

MWIYLSLLTVGFVAVVIYRKFARTLEVAQQYAGPPALPILGNGLWFLNKQPD

EFLPIIHKLTSTYGDVVRFWQGPQFTLYVGNPSMIEILTNKHLTDKSGEYDYLSNWLGDGLLLSKRHKWHARRKAITPAFHFKILEQFVDVFDRNAAELVDVLEKHADDGKTFDMFPYVLLYALDVICESAMGTSVNALRNADSEYVRAVKEAAHVSIKRMFDIIRRTSLFYLTPSYQKLRKALKVLHGYTDNVIVSRRNQLMSKTDSGGVSDEFGAKKKDAFLDMLLRTSINGKPLTNLEIREEVDTFMFEGHDTTTSAVVFTLFNLAKHPEIQQKVYDEIVSVIGKDPKEKIELSHLHDLSYTEMAIKETLRLFPSVPLIGRRCVEEITIEGKTIPAGANIIVGIYFMGRDPKYFENPSHFIPERFEGEFSVEKFNPYKYIPFSAGPRNCI

GQKFALNEMKSVISKLLRHYEFILPPDSVEEPPLASELILKPHRGVPLQIRHRALN*

>CYP4D38 1.283_5 AAGE01055570 100% but N-term does not match

MWFLLSLVAAACLAWAIYRKFARTLEISGQHTGPPALPILGNGLWFLNKQPDEFLPI

IQRLTDEYGDVFRFWQGPEFTLY

VGRPSMIETLLTDKNLTDKSGEYGYLSNWLGDGLLLSKRNKWHARRKAITPAFHFKILEQFVDVFDRNASELVDVLGKHA

DSGEVFDIFPHVLLYALDVICESAMGTSVNALRNADSEYVRAVKEAANVSIKRMFDFIRRTPLFYLTPSYQQLRKSLKVL

HGYTDNVITSRRKQLSNSSNKNHKDSDDFGFRRKEAFLDMLLKTNINGKPLTDLEIREEVDTFMFEGHDTTTSAVVFTLL

NLAKHPAIQQKVYDEIESVIGNDLQKPIELSDLHDLSYLEMVIKETLRLYPSVPLIGRRCVEETTIEGKTIPAGANIIVG

VFFMGRDPNYFEKPLDFIPERFSGEKSVEKFNPYKYIPFSAGPRNCIGQKFALNEMKSVISKLLRHYEFILPAGSPAEPL

LASELILKPHHGVPLQIRRRGH.

>CYP4D39 1.283_6 AY431801 64% to 4D24

MFLLVTVFFAVVSLAVFVYQKFANQLYYGAKIGGPKCYPLVGNAFRFINKSPPDFFLTIERTVREAGKCFRLWLGPELLI

IVTDAKVAEGVLSSPKFIEKSGEYNFIRPWLGDGLLTSSYRKWHSHRKIITPTFHFKILEQFVEIFDSQSNILIDKLTPF

MESGETFDVFPLVTLCALDVICESAMGTKVNAQIHSDSEYVQAVKEITTIIHIRTYDVLARYDFLFNLSSYRKRQDKVLE

VLHGYTNSVIRSRRRELSDAKEANPDNNATSELGIRRKVAFLDMLLQATVDGRPLTDVEIREEVDTFMFEGHDTTTSAIS

FLLYRLAKHPEVQHKVYDEIKAVIGEGMTGPVTLSMLNELHYLELVIKETLRLYPSVPFYGRKVLENSEIEGTTFPAGSN

LILMPMFMGRDPEYFDDPLEFRPERFEKEISAEKVNPYRYIPFSAGPRNCIGQKFAMAELKSVASKVLRHFEVLPPEGGQ

EESFIGEMILRPTYGVLLRLKKRQ. 

>CYP4G35 1.318_1 AAGE01114834 100% to  AAGE01340100  80% to 4G17

MVIFMTLVLVASALFHFWMISRRYVQLGNKIPGPRAYPFIGNANMLLGMNHNEIMERAMQLSYIYGSVARGWLGYHLVVF

LTEPADIEIILNSYVHLTKSSEYRFFKPWLGDGLLISSGEKWRSHRKLIAPAFHMNVLKTFVDVFNDNSLAVVERMRKEV

GKEFDVHDYMSEVTVDILLETAMGSQRTSESKEGFDYAMAVMK

MCDILHSRQLKFHLRMDSVFNFTKIKQEQERLLGIIHGLTRKVVKQKKELFEKNFADGKLPSPSLSEIIAKEESESKESLPVIS

QGSLLRDDLDFNDENDIGEKRRLAFLDLMIETA

KSGADLTDEEIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQDVQDRVYKEIYQIFGNSKRKATFNDTLEMKYLERVIFET

LRMYPPVPVIARKVTQDVRLASHDYVVPAGTTVVIGTYKVHRRADIYPNPDVFNPDNFLPERTQNRHYYSYIPFSAGPRS

CVGRKYAMLKLKVLLSTILRNYRVVSNLKESDFKLQGDIILKRTDGFRIQLEPRV.

>CYP4G36 1.106_1 AAGE01072700.1  88% to 4G16

MSATVAPADPVMANANIASPMNVFYFLLAPALLLWFIYWRISRQHMLKLAEKIPGPPGLPLLGNALELIGTSHSVFRNVIEKGKDFNQVIKIWIGPKLIVFLVDPRDVELLLSSHVYIDKSPEYRFFKPWLGNGLLIST GHKWRQHRKLIAPTFHLNVLKSFIDLFNENSRLVVEKMHKEAGKTFDCHDYMSECTVEILLETAMGVSKKTQDQSGFDYAMAVMKMCDILHLRHRKMWLYPDLFFNMSQYAKRQVKLLDTIHSLTRKVIRNKKAAFATGTRGSLATTSIKTAEFEKPKSNINTNSVEGLSFGQSANLKDDLDVDENDVGEKKRLAFLDLLLESAENGALISDEEIKNQVDTIMFEGHDTTAAGSSFFLSMMGIHQHIQDKVIQELDDIFGDSDRPATFQDTLEMKYLERCLMETLRMYPPVPIIARSLKQDLKLASSDLVVPSGATIVVATYKLHRLETIYPNPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLKVILSTILRNFRVISDLKEEDFKLQADIILKREEGFQIRLEPRQRKPKAAKA*

>CYP4H28 1.85_2 AAGE01082714.1 CYP4H28 4T2.2

MLAILVSLATVAFLWLVYQRRMARAAKIAAYFPHPKPVLPLLGNSLMFANKDAPAIFHTVLDLHKQCGQNLVTYGLFGDV

QLHISSPKAIERVLLSKVTKKNYIYEYLEPWLGTGLLLSFGEKWFQRRKIITPTFHFKILEQFLEVFNAETDRLVTKIEQ

HVGGEEFDMYQYITLHALDSICETSMGVSINALDNPDNAYVHAIKDFGSIVIQRTFSALRSFPLLYFLHPFYWRQQKLIK

TMHNFTNSVIKAKRQALEEKRHTEGETKEHNEDDGIYGKKRMSFLDLLLNESSMSDADIREEVDTFMFEGHDTTTSGIYF

SLMALAMHPDIQERLYGEIRQVLETEEERHAPLTNATLQQMKYLDMVIKEVLRVYPSVPIIGRELLEDVEINGCQVPRGT

AMVVIIHNVHRNAEVFPDPERFDPERFSDESGGKRGPYDYIPFSVGARNCIGQKYALLEMKVTLVKLLLAYRFIPGKSTD

SIRIQGDLVLRPFGNMALRIESR.

>CYP4H29 1.285_1 4H29  AAGE01010708 CYP4H29 4I1.8

MVPLLMLISLLASALIWVLSALVKNLLVYRELQRKLPNFVSTPTVLLLGNTHLFKKDPTPPGIFATFNQFHRTYGNDLIV

QGLLNRPALQITSAPVVEQVLQARTIKKSIIYEFMRPWLNEGLITSLGKKWAQRRKIITPAFHFKILEEFLAIFNERTEV

FVDKIKDQVGKGDFNIYEHVTLCTLDIISESAMGVKLNAQDDPNSSYVQAVKEMSEIIFQRLFGLLRMHKFFFQMSEAAQ

RQRAALKVLHKFTDSVIFQRKDQLDDEQARQESKQKLEETDIYGKRKMTLLELLLNVSVEGHHLSNSDIREEVDTFMFAG

HDTTTSCISFSAYHIARHPEVQQKLYDEMVQVIGKDFKNAELSYSTLQELKYLEMTIKEVLRIHPSVPIIGRKTTGDMRI

DGETVPAGVDIAVLIYAMHNNPEVFPEPEKFDPERFNEENSAKRHPYSYIPFSAGPRNCVGQKYALLEIKVTLVKLLGHY

RLLPCEPENEVKVKSDITLRPVNGTFVKIVPR.

>CYP4H30 1.85_1 AAGE02005220.1 65% to 4H14

89011  MITLVLVAGVVLYFLRSFLQKRNKLLKIANHFGGPKPLPVIGNLLEFNTDIP (1)  88856

71635  GIFEKIVHLNHTYGPNLFVWGFLNENVLFLGDTKLVEKVLLAKQTQKSLLYSYLTCWLRTGLLLAS  71438

71437  GEKWFQRRKIITPTFHFKVLEQFVTVFNREAQTMVDVMRKHVGGKEFDVYSYVTLMALDSVC (1) 71252

71190  ETSMGTSVNAQKDPDNRYVRNVKR (2) 71122

71063  MSVLFLLRVIHPLATHPELYSLIHPNAYEQRKIVRELHEFTDNVIATRRKQLKSGQM  70893

70892  LDINRNVEDRYSKQKMTFLDLLLNVNIDGKPLTDLDIREEVDTFMFE  (0) 70752

70216  GHDTTTSGISFTIYQLALNPHVQDKIYEEIVAILGKNHKTVELTYQSLQEFKYLEMAI  70043

70042  KEGLRLFPSVPFIGRNLVEDLEF (1)

69911  DDITLPAGQDILIPIYMIHRNPEIYPDPERYDPERFSDGTESKRGPYDYIPFSAGTRNCI  69732

69731  GQRFAMLEMKAALIKLIGNYRILPGESLKKLRIMTDLVVRPEKGVPIRLEERV*  69570

>CYP4H31 1.48_5 AAGE01049176 67% to 4H14

MLFLAIVVGALLYLVVNFYVTRKPLERMAVHFSGPKPHYLLGNVLEFLNKDLPGIFETMVGFHRKYGQDILTWNVLNLNM

ISVTSAENVEKVLMAKQTKKSFLYSFVEPWLGQGLLISSGEKWFQRRKIITPTFHFKILEQFVTVFNKETDTMVENLKKH

VDGGEFDIYDYVTLMALDSICETSMGTCVNAQKNPTNRYVQNVKRMSVLVLLRTISVLAGSPLLYDILHPHAWEQRKIIK

QLHEFTISVIESRRRQLEADKLEQVDFDMNEESLYSKRKMTFLDLLLNVTVEGKPLTNADIREEVDTFMFEGHDTTTSGI

SFAIYQLALNPQIQDKLYDEIVSILGKNSSNVELTFQTLQDFRYLESVIKESMRLFPPVPFIGRTSVEDMEMNGTTVKAG

QEFLVAIYVIHRNPKVYPDPERFDPERFSDTAESKRGPYDYIPFSAGSRNCIGQRYAMLEMKVTLIKLLMNYKILPGESM

GKVRVKSDLVLRPDRGIPVKLVARS.

>CYP4H32 1.283_1 AAGE01321728.1 JP_16 3aa diffs use this seq 57% to CYP4H14

MFNFAVFLVILVVGLARFCINRSKLQQLAKHFPGPKPALLVGNLLQFPADIGGIFRRMVYYHEKFGPDIVTWGIGNTLKFNVSSTRNVEKVLMAKTVQKSLSYSFIEPWLGKGLLTSTGRKWFQRRKIITPTFHFTILEGFAEVFNRNADTLIDKLKVHEGGSEFDVYRYVSLYALDSICETAMGVQVHAQDDPENQYVRDVNRLSELFLLRIFSFLGMFPTLYWYLHPNAWEQRKLIRTLHQFTDNVIWKRREQLMNGPRNDEMDNTTSSKKKQTFLDLLLCMSVEGQSLSNEDIREEVDTFMFGGHDTTSSAISFTIMQLALHQDIQDKLYAEIVSILKGQNLKTTHLTFNNIQDFKYLDLIVKESLRLLPPISYVGRKLTEDTELNGATIPAGQDIFIPIYMVHRNPKIYPDPERFIPERFAENAENLRGPYDYIPFSIGSRNCIGQKYGMMQLKMTVVRLIANFRVLPSEATASVKLRTDLVLRPEYGIPIKIEARN.

>CYP4H33 1.923_1 AAGE0107691 68% to 4H18

MLLILTLIFATVGYALFNYHRQRQKLLNIRSHFDGPDSHYLWGTFPMFIGKTIPDIWDIITDLHKKHGEDIAIIAAFNEL

VMDLSSSKNVEKVLLAKSIKKSFAYDFLEPWLGTGLLISTGEKWFQRRKIITPTFHFSMLEGFLEVFNKEANILVSKLKA

KAGKDEFDIYDYVTLYALDSICETSMGVQINAQDDPNNEYAVAVKQMSTFILRRVFSILRTFPSLFFLYPFAKEQKKVIL

KLHNFTNSVIDARRAMLEKEKSNKNVTFDLQEENMYTKRKMTFLDLLLNVTVNGKPLSREDIREEVDTFMFEGHDTTTSG

ISFTLWHLAKYQDVQQKLFEEIDRVLGKDKVNAELTNLQIQELDYLDMVVKESLRLIPPVPIIGRTLVEDMEMNGVTIPA

GTQISIKIYNIHRNPKIWEKSDEFIPERFSKTNESKRGPYDFIPFSAGSRNCIGQRYAMMELKVTIIKLIASFKVLPGDS

MDKLRFKTDLVIRPDNGIPIKLVERI*

>CYP4J13 1.869_1 AY431450 65% to 4J10

MFSSVLSLVIITLIVLLAVYEWYLRQRDGYRAALQYPGGPMLPVLGNILEVLIKDTVQTFNYARSNALKYGRSYRQWIFG

NVILNVIRIREAEPILSSTKHTRKSILYRFLEPLMGDGLLCSKGSKWQARRKILTPAFHFSILNDFLQVFQEEAEKLVGL

LDSCADAEEEVVLQSIVTRFTLNTICETAMGVKLDTFIGADKYRSQVYDVGERIVHRTMTPWLYDDGVYNLFGYQKPLED

AIEPIHDFTRSIIRQKREQLKQDSTMHIVDSDGIYGSKQRYAMLNTLLMAEENDAIDEEGIREEVDTFMFEGHDTTAAGL

IFSILLLATEQEAQQRVYDELLKARSTKSESEAFTIADYNNLKYLDRFVKEALRLYPPVSFISRNLSGPLEVDSTTFPHG

TIAHIHIYDLHRDPEQFPDPERFDPDRFLPEVAAKRNPYAYVPFSAGPRNCIGQKYALLEMKTVLCALLINYRILPVTTR

QEVIFIADLVLRAKTPIKVQFAKRKANATRS*

>CYP4J14 1.869_2 AAGE01397643 AAGE02025842.1 ESTs DW194177.1 EB096538.1 use this seq

182386  MDFLMDWWFAVLIIVIVLLAWDAIDKSGRPYRAMNKFPGPRVFPLIGTLSEILFKDQ (1) 182556

182616  AKTFQLAREWPKRYGGSYRFWVNSTLYVLNVVRVREAEPILSSTKNIDKSRFYKFLHPFLG  182798

182799  LGLLNSTGPKWMHRRRILTPSFHFNILNGFHRTFVEECDQLLATIDEHVDKGVSTALQPV  182978

182979  MSKFTLNTIC (1) 183008

        ETSMGVKLSTVSGADVYRTKLYEIGEALVHRLMRPWLLNDFLC

        RLTGYKAAFDKLLLPVHSFTTGIINKKREQFQASSEPLVELTEENI (2)

        YLNPKKRYAMLDSLLVAEQKQLIDEAGIREEVDTFAFEG  183506

183507  HDTTAAALVFIFFTLAHESAVQDRIYSEIRQVYNGKPQSDRVFTPQDYSEMKFLDRALKE  183686

183687  CLRLWPPVAFISRNISEDIVLEDGAVIPAGCVANIHIFDLHRDPEQYPDPDRFDADRFLP  183866

183867  EEVDRRNPYAYVPFSAGPRNCIGQKYAMMELKVVIVNALLKFRVLPVTKLEDINFVADLV  184046

184047  LRSTNPIEVRFERR*  184091

>CYP4J15v1 1.869_3 matches Nelson 223407477 on top AAGE02025843.1

6807 MDFLTNWWFGALVIVTVLLVRDAIDKSGRIYRAINKFAGPPCLPLIGTLCEILFMNQ 6637

6575 ATTYQWARKWPKRYGGSYRFWFSSTLYVLNVVRVREAEHILSSTRNIDKSRFYKFLHPFLGLGLL

     NSNGSKWMHRRRILTPSFHFNILNGFHHTFVEECDQLLATIDEHVDKGVPTALQPVMSKFTLNTIC (1) 6183

6127 ETSMGVKLSTVSGADVYRTKLYEIGEVLVHRLMRPWLLNDFLCRLTGYKAA

     FDKLLLPVHSFTTGIINMKRKQFQESLEPSVELTEENI (2) 5861

5801 YLNPKKRYAMLDSLLLAEQKQLIDEAGIREEVDTFAFEGHDTTAAALVFIFFTLAREPAVQDRI

     YREILQVYSNKPQSSRAFTPQDYSEMKFLDRALKECLRLWPPVTFISRSISEDIILDDGS

     LIPAGCVANIHIMDMHHDPEQFPDPERFDADRFLPEQVDRRNPYAYVPFSAGPRNCIGQK

     YAMMELKVVVVNALLKFRVLPVTKLEDINFVADLVLRSTNPIEVRFERR* 5100

>CYP4J15v2 AAGE02030510.1 98% to AAGE02025843.1 6807-5100. 9 aa diffs

11199  MDFLTNWWFGALVIVIVLLVRDAIDKSGRIYRAINKFAGPPCLPLIGTLCEILFMNQ (1) 11029

10967  ATTYQWARKWPKRYGGSYRFWFSSTLYVLNVVRVREAEPILSSTRNIDKSRFYKFLH  10797

10796  PFLGLGLLNSNGPKWMHRRRILTPSFHFNILNGFHHTFVEECDQLLATIDEHVDKGVPTA  10617

10616  LQPVMSKFTLNTIC (1) 10575

10519  ETSMGVKLSTVSGADVYRTKLYEIGEVLVHRLMRPWLLNDFLCRLTGYKAAFDKLLLP  10346

10345  VHSFTTGIINMKRKQFQESLEPSVELTEENI (2) 10253

10193  YLNPKKRYAMLDSLLLAEQKQLIDEAGIREEVDTFAFEGHDTTAAALVFIFFTLAREPAV  10014

10013  QDRIYSEILQVYSNKLQSALAFTPQDYSEMKFLDRALKECLRLWPPVTFISRSISEDIIL  9834

9833   DDGSLIPAGCVANIHIMDLHHDPEQFPDPERFDADRFLPEQVDRRNPYAYVPFSAGPRNC  9654

9653   IGQKYAMMELKVVVVNALLKFKVLPVTKLEDINFVADLVLRSTNPIEVRFERR* 9492

>CYP4J16 1.4503_1 96% to AAGE01005255, = AAGE02035951.1

MYVFTTVAGLLVFIFILYKIYLRSLPSYRAAKYFPGYPVYPIVQNLFTALFKSQTGAFQQARQWARIFNNRTYRLLIQGV

LYVQIIHHKDVEMLLSSSRLITKSPLYKLIVPFIGNGLLNSTGEKWHQRRKILTPTFHFNILQGFLQIFHEECRKLVNQL

DKDAAQGITTTLQPLSTQVTLNTICETAMGLKLDTSETAEVYKSNIREVGKVIQQRIMNPLLFEDWIYKITGYQAKFDKI

LRPIHAFTNSIIRQRRETFHETMKNVDSPSEENIYTNIKQRYAMLDSLLLAEAKQQIDGEGIREEVDTFTFEGHDTTGSA

FVFTFLLIAHEQLVQQRLFEEIERMFNLQPNPTQQDYNDLKYMDRVIKESLRIYPPVPFISRLITEDVQYDGKLVPRGTI

MNIEIYDLHRDPEQFPDPERFDPDRFLPEEVQRRSPYAYVPFSAGPRNCI GQRFAMLELKAILIGVLREFRVLPVTKRED

VVFVGDMVLRSRDPIVVKFERR.

>CYP4J17 1.985_2 AAGE01216085 JP_4

MDWLTIVLLLILALLALYEVHLRLLLSNRAAKQFPGPRRLPVLGNALALLFNDQVSTFKLPRRWAQRYKESYRLVIRGGF

VINAIRARETEALLSSTKLIDKSILYTFLYPFMGKGLLTSTGPKWFHRRKILTAAFHFNILPKFLVTFQEECDKLLRKLD

ADVKAGNTTTLQSVAARFTLNTICETAMGVKLDSMSMADEYRAKIQEVIKLLLLRVMNPWLVEEFPYRLLGFRRRLMKVL

KPIHAFTRSIIKQRRDLFHANVKNVDDFSEENIYVNTNQRYALLDTLLASEAKNQIDEEGIREEVDTFMFEGHDTTASAF

TFIFLVIANHQEAQRQLVEEIETMIAGRSNPTEPLSMHDYGELKFMDRVIKECLRLYPPVPFISRAVLEDAQLGDRFIPK

DSMANVHIFDLHRDPEQFPDPERFDPDRFLPENVEKRNPYAYVPFSAGPRNCIQRFAMLELKAILTAVLREFRVLPVTKR

EDVVFVADMVLRSRDPIVVKFERR*

>CYP4K3 1.283_8 AAGE01021812  51% to 4K2 correct PKG, 54% to 4K2 after first exon

ESTs DV397661.1, DV284971.1, DV284970.1, DV314922.1, DV397660.1

2979 MLIVVLLPLVITLCLVFAFVHRKLLQFPNLAGPPEWPIAGSATEIVNLSSI (1) 2827

EIFKLLRRYAQQYGTAYKLSFWYQYTLVFAKPDIAE

KILNTQSYASKSEDYDKVAEWIGYGLLISKGEKWFKRRKVLTPGFHFKILESFVRVFNEKSDVLCRKLASYGGS

EVDVFPTLKLYTLDVLCETALGYSCNAQTEDSFYPAAVEELMSILYWRFFNLFASVDTLFRFTKQYRRFHKLIGDTREFT

LKIIEEKRKLLNELHDEGAVNEEDDEGKKKMALLDLLLRATVDGKPLSDDDIREEVDTFTFAGHDTTASALTFLLFNIAK

YSDVQQKLFEEI SSVVGSTSELSLHTL  NDLRYLDLVIKESLRLYPSVPMIARIATENTKLDDMPIPKGTCVSVDIFQMHR

DPDRFEDPESFIPERFDAIRDGGKHNAFTYIPFSAGNRNCIGQKFAQYELKIAVVKLIQTFRLELPSPDIEPILKAEIVL

KPAEKLPIRFITRTTK. 

>CYP4AR2 1.457_1 AAGE01044016 4I1.3 2aa diffs probable ortholog of 4AR1

MIAIIAFTAIFVLFVYVWQWRRRLSRPFRTVPGPPGLPLIGNCHQFIGKSST

NIFHMLIELERLYGSVFKVDVATGIWLFYMSPGDIERIMTGP

EFNCKSDDYDMLLEWLGTGLLISNGNKWFTHRKALTPAFHFKILDNFVQVFDEKSTILAR

KFLSYSGKVVGIFPLVKLCTLDVIVETAMGTESNAQTEESGYTMAVEDISEIVFWRMFNN

VYNTEFMFKLSNKYGTYKKCLETIREFTLSIIEKRRSTLNVFDKNGGTSEVCNDSTGLKK

KMALLDILLQTEIDGRPLTNEEVREEVDTFMFAGHDTTASAITFLLYAMAKYPDVQQKVYEEAVSVLGDSIDTPITLSALNDLKYLDLVIKESLRMFPPVPYISRSTIK

EVELSGCTIPTGTNITVGIFNMHHNPKYFPDPEEFIPERFEVERGVEKQHPYAYVPFSAG

GRNCIGQKFAQYEIKSTISKVIRLCRIELI

RPNYEPPLKAEMILKPQDEMPLRFFPR*

>CYP325E2P AAGE02000570.1 = AAGE01056055.1 N-term 61% to 325E1 57% to AAGE01193335.1

Fourth of five P450s on this contig Partial seq N-term only

69592  MFGLTFALIVVYLLALYVYAKIKYRFANKIPSIEPMVPFFGNGLEFAQKNCYKIFVNLKR  69771

69772  IFENNKHHRLFKLCFGPIVVLCPTHPDLIQKVMTDTGSMEKPYVYEFLRVDLGLLSAK  (1) 69945

>CYP325E3 1.6_7 AAGE02000570, AAGE02000571  fifth of five P450s on this contig = AAGE01193335.1 66% to 325E1

86011  MALLLITLALLGGIWLALYIYCRIRFGFARNIPEVRPLKFFFGNGLDFAQKNSYEIFVSINRVFR  86205

86206  ENKRIFKISFGPIKVVCPTHPDLIQKVLCQSASMDKPYVYDFTRMGSGLLTAP (1)  86364

6804  YDTWKVHRKLLNPTFNTRILNSFIPIFNDCADKMIESIHEHAAPGKVLNILEFTSPCTLAM  6986

6987  ICRTSLGGKVLEREGTQKFVEGLEI (2))

      ILSNVGLRMFNANL  7166

7167  HPDIVYRFTRFYRREMESRKFCYAFTDK (0)

      IILEKQQELAVAKAK  7346

7347  GKQDTNNNASDSGNDNFEEEEDDLLSYKKPQIFIDQLLTIPLPDGKPFSHKEISDHIYTM  7526

7527  IAAGNETSATQAAHTLMYLAMHPEVQEKAVKEIKELLPTPESKITSEVMKNMVYMERIIK  7706

7707  ESQRLAPVAAVYGRKTIADLQLDQFTIPKGNIFILNIFALHRRKEYWGEDAELFNPDRFL  7886

7887  PENSKNRHPFAYLPFSGGNRGCI (1)

      GNRYAMMSMKTIVSAIL  8066

8067  RNFKISTDLEYEKIEFKFKVSMHLSGPHRTFVEPRNLYG*  8186

>CYP325G2 1.738_8 AAGE01082531 AAGE02023796.1  61% to 325G1

46056  MFQSVLVLVLFPIVVYLILRWKHRRFYRISSELPGPVNYPLIGCGHLFIGKSNEEQFAIL  46235

46236  NDITKTYPSPCRAWLGPKLFVFIDNPEDMQVILNSPNCLEKADLYRFFRCEKGLFSSPAS  46415

46416  IWKVHRKLLSPCFSPAILASFVSIFNVKSEILVQRLEKNLGQGAFNLFGDISRCTLDMIC (1)  46595

46657  ATTLGTNMDLQSNEGTEFIKSIED (2) 46728

46788  ACELINCRLYKFWLHPEWIYQRTKYYKEEKYCYEKAYEMSRKILKMKQEARSKSRN  46955

46956  TLNNNDNILSKSPQIYIDQILRLAEETDVFDNQAIKDELDTIIVGGNETSALTLSHVMLM  47135

47136  LAIHQDIQQKVYNEIVNVIGSCDPSIPVHNDQLSKLIYTEMVMKETMRLFPVGPVVARTC  47315

47316  TSPTRI (1) 47333

47393  SKTTIPAGTNIVLGVYNVHRNPKHWGPDVDRFDPEHFFPERVAERHPYSFLPFSGG  47560

47561  PRNCIGYKYGLMSMKIMLCHLLRAYRFRSPLKMDQLQLKMSITLKIANRHMVTVERRNG*  47740

>CYP325G3 1.738_3 AAGE01073923 51% to 325G1

MVLSVIVLLALPIIAYLVLRWKQRRFYQISAELPGPVSYPLIGSAHLFIGKTNEELFAILNGIVKTYSSPCRGWLGPKLF

VFIDNPEDIQVILNSPNCLEKAEIYRFIRSLNGLFTSPVSIWKVHRKLLSPCFSPVVLSSFISKFNSKSATLVQHVGKNI

GRAEYDSYGDISRCTLDMICATFLGTDMNLQSNEGTEFIKNVEDGCELINYRLHRFWLHPEWIYRLTKYYRTERKCFENV

FNMLNKIWKKRQMVLSESKTASLYESMSTKKPLIFIDRIQRLAEETQVFDEIDIRDELSTIIVAGNETSALSLSNTILML

AIHQDIQEEVYNEIVNVLESGDPSVPVNNEHLSKLCYTEMVIKETMRLFPVGPMLGRKCTAPTRISKSTIPEGTNIILGV

NNVHRNPAYWGPDANRFDPNHFLPDRIAERHPYAFLPFSGGPRNCIGYKYALMSMKIILCYLLRAYRFRSPLKLDQLQLT

MSLTLKIANRNVMTVERRDN.

>CYP325K2 1.174_2 AAGE01011003 AAGE02009247.1  51% to 325K1

14328  MLAFVSLVLLIVAILMVHWWHAKVDFARYLPRAQPHYPVIGNLQIALPFGKSAEELLGLL  14507

14508  HSYFRQHDRMFAIHIGPKVAIGLSHPELVQQVLNHPYCQEKSNVYELLRLPNGLLSSK (1)  14681

14743  YKVWKLHRKTLNSTFNLRILNSFLPIFNDSTRKLIQLLDQYASTGKTFNILAPLTHCTLGMV  14928

14929  CETSFGKKVLEREGKEQFFDDLEV  (2) 15000

15057  LLTSLGKRVVNVLLHSEIIYRLTPMYRDETKSRAVCRQFTDKVIEEKRIEI  15209

15210  ESSFAGDSSLITTEGTLSDDEGEAYKRPQIFIDQLLKMPLMTKSAYNFTDLEISDQVFTM  15389

15390  IIA (0) 15398

16042  GNETSATQMAHTCLLLAMNPAIQQKAYQEVQQFIETENSYIDADILRKLVYIEAVLKESM  16221

16222  RLLPVGSLISRKNLQDIVLDGHIIPKNTPLLMKPYSLHRRPDIWGSDAEQFVPERFLGED  16401

16402  SKRRHPYAFIPFSGGPRGCIGLRYAMMTLKIMLALILKNFEISTQLKYRDLRIHYQLSLN  16581

16582  LAGPHAVSLERRR* 16623

>CYP325K3 1.174_3 AAGE01421194.1  AAGE02009247.1 60% to  325K1

37082  MIALLWVVLSITIAVLVQRQWQKKVKFAGAIPRAKPYYPVVGNLPLALGKTSDELFSSLY  36903

36902  DCFRQHDRLFTLQFSTIVAVCLSHPELIQRVLNHPDCQEKPDVYKVVRLPKGLLAAR  (1) 36732

36675  YNTWKVHRKILNSTFNSKILQSFLTIFNNSSRRLIERLDHHADRGKSCNILEYISECTLEMIC  36487

36486  RTSLGGRALERDGRQDFIENLEV (2)36418

26045  ALTALGKRILSFPLHNDFIYQFTTLYRDEMKAISTCHQFTDK  (0) 25920

25824  IIAEKHVEFKSLFDEREKSKERETLQENDDESESYKRPQIFIDQLMKMPLMMKDA  25660

25659  YSFSDQDISDHVYTMIVA (0)

       GNETSATQLAHTCLLLAMN  25480

25479  PEVQEKAYQEVKEVVVSSDVFIDMDTLKQLVYVEAVLKEAMRLIPVAPLIARENIRDIEL  25300

25299  DGHLIPKGTVLLMNMYALHRRNDVWGSDFERFYPERFLGETAKRRHPYAHLPFSGGPRGC  25120

25119  IGYRYAMMSLKILLALILKNFELSTDLKYNDIKYHYQISLNLAIPHAVSLKRRL*  24955

>CYP325L1v1 1.610_1 AAGE02021468.1

7153  MITQIVLICFIISLTYWWHNRLIHQQLGCLPGPFSLPLLGSSYIFLGKSYSEILDAFHRI  6974

6973  SSTYGRNGNPVRFFLGTKPFIIINHPDHAQTILNSTSCLDKPWIYQYTPLEGIFSLPTQK  6794

6793  WRIHRKAIQPSFNWSILKSFLPIFKSKVDLLIRKLKQRTSGHEPFDVYGFVAACTLDMVY  (1) 6614

6543  ATTLGIEMNIQQQSSCEYLEILEELFELVTNRVTNVLLHYDWIYRWTSYYRRECKARKIF  6364

6363  QSPAQQVLRQKPILVSNATESDDLTQPQIFIDQLYRIAVKDPHFTKETIEKELNTMIFGG  6184

6183  NETTAVTMSNALLLIAMHPDVQLKLLEEFNVVFEGNLENMTVANLQRLVYMEAVLKEVMR  6004

6003  LWPITTILGRTTSTEVRLDEFLIPAEVNLVIDVYSIHRNARYWGADANRFVPERFFDREQ  5824

5823  YPYAFLGFSAGPRNCIGTRYAWLSMKVMLTAILYNFELRTPLRMEDIRLKVAMTLKVENK  5644

5643  HMITLSDRRK*  5611

>CYP325L1v2 Constructed from trace files 578965186, 581849161, 512981174, 520523626

MITQIVLVSFIISLMYWWRNRLIHQQLGCLPGPFSLPVLGSSYIFLGKSYSEILDAFHR

ISSTYGRNGSPVRFFLGSKPYIIINHPDHAQTILNSTGCLDKPWIYQYTPLEGIFS

LPTQKWRIHRKAIQPSFNWSILKSFLPIFKSKADLLIHKLKQRTSSHEPFDIYGFVAACT

LDMVY (1)

ATTLGIEMNIQQQSSCEYLEILEELFELVTNRVTNVLLHYDWIYRWTSYYRRECKARKIF

QSPAQQVLRQKPILVNQSNATESDDLTQPQIFIDQLYRIAVKDPHFTKETIEKELNTMIFGG

NETTAVTMSNALLLIAMHPDVQLKLLEEFNAVFEGNLENMTVENLQRLVYMEAVLKEVMR

LWPITTILGRTTSTEVRLDEFLIPAGVNLVIDVYSI

HRNARYWGADANRFVPERFFDREQYPYAFLGFSAGPRNCIGTRYAWLSMKVMLTAILYNY

ELRTPLRMQDIRLKVAMTLKVENKHIITLSDRRK

>CYP325M1 1.738_1 AAGE01004435.1

MWWYLLVPYICAGVIIVVSYVHWTRRKMYKTLATMSCPKTLPLIGHAHKFFNATAESIADGLKFFAEFPSPVVIHLGPSP

QVAIFDPEQARIVLNSQNCLDKAFFYSFLRVPGTLISSPGPLWRSQRKALNSSLGPAILGSFIPIFNNKSAILVDLLEKY

AGEPERDFSVDIAKCFLDQIYETAFGCNFSMQTSPEGDKTVDMMGDYMHIVSKRFFTIWQYPEVLYRMTDAYKTEQALLK

AHHEITENIVRQVKFHEQINMTDEKFAALDGSSKTHNFIECLVKYMRTSVHTSQADIFSHIDMTLFAGNDTTAKSLSYVL

LLMAMHPEVQERCYQEVMEVCPGEERFISAEDTANLTYLDMVCKEGMRLFPVVPIMARVTNNDVKLDGKCEHHTIPANCN

IILGVYQMHRDPNIWGPNADQFNPDNFLPENAAKRHPYAYLPFSAGPRNCMGLRYARIAMKVTAAHILKKYRLRTSLTLE

ELRVSYGVMLNIANGVLMSLEKR.

>CYP325M2 1.738_5 AAGE02023793.1  40% to 325F2

151537  MWWPLVLLYFTLGVILVYSYVQWTRRKMYAMLATMSNPKSLPVIGHAHKFFNVTL (1)  151373

        ADTLQYFGSFPSPVCIHMGPLPHVAIFDPESVQVV  151178

151177  LNSPDCLQKMHQYSFFWVPRTLLCAP (1)

151037  VHMWKGQRKALNPAFSSAIIGKIVPVFNKKCEKLMHILDQYVGKQQKDCTVDILKCTLDQIY  (1) 150852

150793  ETSFECEFNMQLSPDGEKTLDIFENFMKLASERICTIWKYPDLIYQWTKAYK  150638

150637  KQLSCIDTYYDTILEKVARHIDIDKRINEVNEADNSTKKHNFIHCLSKYLRSQGPIPRED  150458

150457  VLAHFCLIVFAGNESTAKTVSTAMLMLAMHPEIQERCYQEINTVCPGENQYISAGDAANL  150278

150277  TYLEMVIKETLRLLPVVPVLGRTATSDVKLN (1)  150185

142052  DRHTIPANTGIVIGTFQIHRDPKIWGPNAERFDPDNFLPENVAKRHPYSFIPFSAGPRNCLGVRYAWYSMKIL  141834

141833  LAYIVRQYRLSTTLKLDQVKVAYGVLLALKDGYPVSLEKRK*  141708

>CYP325M3 1.738_6 AAGE01030046.1 42% to CYP325F2

MWWPLLLAYLLAAVVLIYSYVQWTRRKMYAMLASMSSPKTLPVIGHAYKFFNVSPEALAKTIRYFRRFPSPVCLHMGPLP

HVVVFDPESIQVVLNSQHCLQKPHQYSFLWIPRTLMCAPVHMWKTQRKAFNPAFGPAILGSFVPVFNEKCAILMEILEQH

VGKPQRDFTRDILKCTLDQIYVTAFECEFNMQLSPDGDKSMDLFESYVGFVTKRFFSVWKYPDFIYRWTKAYRKQMLCCT

TYFNEVLEKIVRHVDIDRRVNDLCGEQSVEKYHNFVYCLSKYLQAQGPIPREDILAHFGFMIFAGNETTAKTINAVLLML

AMHPEIQERCFLEVAAVCPIENQYISAEDVSNLTYLEMVCKETMRLFPVAAMLARVATSDVKLNDRQTIPANTRIIIGTY

QIHRDPKIWGPNSNRFDPDHFLPDNVAKRHPYSYIPFSGGPRNCLGPRFAWLSMKTIIAFILRQYRLNTSLKFDQLKVAY

GVLLTIADGCPMTIEKR.

>CYP325M4 1.610_3 AAGE01152759  AAGE02021469.1

11337  MLCWVTMLTYICASVILAVFCLRSTRRKMDCKLASMSGPRRLPLLGHAQNFYKSTP (1) 11170

11016  KAIAGTLKYFSKF  10978

10977  PSPVCIHMGPLPHVAIFDPEQLQVVLHSQNCLDKSVQYSFLRVSETLISAP (1)  10825

10767  THLWKGQRKALNPSFGPAILTTFAEIFNNKCAILTKRLEEYAGKPERNFY  10618

10617  RDISKCTLDQIY (1) 10582

10112  ATAFGCDFNMQTSLDGERSLDLQEAYMKVMANRFFSVWKYPEFIYRWTAGYKKELELRRI  9933

9932   YHETITCKLVQQVSVEEKLHTKEDIDFKTEETGKRIPENFIECLVKYLRAEGETSKDAVY  9753

9752   PHIDMTVFAGNDTSAKTICSILLMLAMHPEVQERCYQELMEVCPEKDQHISYKDAANLTY  9573

9572   LEMVCKETMRLLPAVPFMARITSGDIVLN (1)

9428   DQHTIPANCTII  9393

9392   MGIFQIHRDPRIWGPNADNFDPDNFLPDNVAKRHPYSYIPFSAGPRNCIGTRYAYLSSKI  9213

9212   MVGSILRKYRLKTSLTMDKLRISCGLLLHISNGCQMAIEHR*  9087

>CYP325M5 1.610_2 AAGE01303772 JPs version AAGE02021468.1

21687  MWWYSWLTYLCASVCMVMNFLQWSRRKTNAKFAKMSGPRRLPLIGHAHKFFRATP (1)  21523

16266  GKIANTLKYFGSFPSPVCIYMGPLPHVAIFDPEQLQVILNSQNCLDKSIQYSFLRVSRT  16084

16083  MISAP (1)

15999  THLWKNQRKALNPSFAPAILNNFVPIFNEKCA  15904

15903  ILTGLLGKYVGQPERNYTRDLCKFTLDQIY  (1) 15814

15755  ATALGCDFDMQRSPDGERSLDLIESYIKVMVARIFTVWKYPEFIYRMTSGYKREQEILKT  15576

15575  YHETIISKLLRAIDFEEKLKLSDENNNEAMNEDTGSKKPNIFIDRLLKLMRDGDEIAKED  15396

15395  IFQQIDMILFAGNDTTAKTTSFILLMLAMHPEVQERCYQEIMAVCPGENQIVTAEDAAEL  15216

15215  IYLEMACKETMRLFPVGSVLARVTTADIKLN (1) 15126

15067  DEHTIPADSTIIMGIYQIHRDPKIWGPKADEFDPNNFLPERAEKRHPY  14924

14923  SFLPFSGGPRNCVGMRYAWLSLKVLVVHMLRKYRLSTSLTMDQIRIKYGIILNIANGCLL  14744

14743  TLEKR* 14726

>CYP325N1 1.738_2 AAGE01347884 AAGE02023793.1

79977  MWSVVIGYSLSVLVFLAVYYRWSRRKTNAALANMNGPPKYPLIGHLYLLKYTSQ  (1) 80138

88311  EKIFETFVELGSTYSSPMGIELGPITLVVVYQPEHLQAVLSSPHCISRPFWYDFFR  88478

88479  VSRGIFSSP (1) 88505

88574  AHIWRGQRKVLNHSFGPGILNCFVSIFNEKS  88666

88667  EILTKLMTSHVGRGERDFGHEIARAALDTIY (1)

88812  STAFGLNFGMQEAPEGSKYLEAQEEFIGLVLKRIFSVINYSERIYRLTKDYKREQELL  88985

88986  SYARTLTNRIMQARNAEQILSGAIGLPSVTTENTDGKKPQIFLDKLFELAVENKQQLSKE  89165

89166  DIPEHLDTIIFAGNDTTATTMSNLLLMLAMHPDVQERVYQEVMEACPDLEQPVSMEDTAK  89345

89346  LTYTEMVCKETMRLFPVGPLIGRIAEVDIKIS  (1) 89441

89510  DEHVIPAGSEVGCGIYMVHRDRKIWGPRAEEFNPDHFLPENISKIHPYAYLPFSGGIR  89677

89678  NCIGVRYAWISMKIMIVHILRRYRLKTSLTMDKITLQYCILLKIGNGCRISLEERNI*  89851

>CYP325N2 1.738_7 AAGE01001430 AAGE02023796.1

23727  MWNTVGVFVVFVTIFSLAYYRWRRRKVIAMLAKMDGPRSLPLVGHTHMLHLFGS (0)  23566

16194  EIFNTFLQYGDRYTSPIAVEMGPMVYIFVYTPEQLQVVLNSPHCLEKP  16047

16046  LQYSFFQVSRGIFSAP (1) 16002

       VDLWKILR  15400

15399  KLITPSFGPGLLSSFVPIFNEKSSVMVEQMAKNVGKPQRDYYSEIVLCFMDTIC(1)  15235

15172  NTAFGVDCDLQRSPAGAEYVETQEKYIDIVTERYLKPWQYLNFIYRFTNAYQIFKKRHGKF  14990

14989  LALLTQATRINEVEDMLSKNSISKDYQDKDVGAKKIPIFVEKLLDEIQKSGHIKREDIDD  14810

14809  HIVTMCFAGNDTTATTMSNILLMLAMHPDIQERVYQEIIAACPDRNQQVSIEDAGKLTYT  14630

14629  EMVCKETMRHFSIAPVIGRTATQDVKLN  (1) 14546

10885  DDITIPANSTLICCFYKLHMDPKNWGPDVKNFNPDNFLPDLVAKRHPYSFLPFSGGPRNC  10706

10705  LGVRYAWLSMKIMLVHILRRYRLRTTLTMDTITVKFNSFMKIEDGCPITVEER*  10544

>CYP325P1 1.6_5p AAGE01077592.1  AAGE02000578.1

42754  MLQLVLVFVLFTGFTYYLAFRRSRKRLYELAATFPAPFDLPLIGSTYIGIGLNSKTIIEY  42575

42574  LLKFLHNLPSPFRAWMGPFLGIIFDKPQHLAVILNSQHCVQKSVFQKFFRFDKGLINSDR  42395

42394  NIWRPQRKQLAAPFSYQVVANFAPSFNEYAEEQLKYLDRFVGAEAFDMLPKLSFYVLSST  42215

42214  LANLFKVQLHSHDYDFMEKFVKNSEQ (2) 42137

42074  MWINIFRRVYKPWLISEFIYRLTPAYKMELQQVGKLRALSEE (0) 41949

21976  IVEARKVLQQKSHPGDDHNASSEV 21905

21904  LIERLERLTYQTGEMTNEEMMDNIDTFLFAAVDTTTSTMASTLLMMAIHPEVQER  21740

21739  VYQEVSQVVPNDYIAIEDLPNLVYLERVMKETMRLIPIAGMLNRVCEKELQVGEWTIPVG  21560

21559  ATIGIPVLKVHRDRAIWGERSDEFDPDNFLPEKVAQRHPYAYIPFSAGIRNCVGMRYANV  21380

21379  SMKVLLAKLVKRFRFKTDLRMKDLKFEAAFLMMLANKHMMRIEKR*  21242

>CYP325Q1 1.187_1 AAGE01039338  AAGE02009773.1

200611  MLFALLATGAILSLAVIWSIVQKNRFAQNVPTIEPWYPVVGNGLLFFGKNDIKKFHKLRK  200432

200431  AFDRKDALFRLYLGPRMLLCTSDPTVAQAIMTDANCMEKPYVYKFFNLNEGVFAAK (1)  200264

200202  THIWKGQRKALNPAFNSKILESFVSIFCEVSKTMIQRLDTVGKGD  200068

200067  TINIMEHASRCTLEMVCSTTLGFNVDIFDQIDEMGHKIEQ  (2)199948

184059  FFYIAARRILKFYLHVDSIYRWTKDYKDEQTLRENLDVYGMQ  (0)183934

183878  IYDDANNRFSK

183845  GSMNDETDDDKTEGFRKPQIFVNQIFTNTIRKFERQEIIDNIITIVGAGTDTSATAIAFT  183666

183665  FLQLAMYQEHQQKVYEEIVKVFPESEPHITTEALKKLQYTKMVLNECLRLYPVAPILLRE  183486

183485  NTADITLCGGVRVPKGNILTIDVYNIHRRKDVWGPDADEFIPERFSPERSAGRHPFAFLT  183306

183305  FSGGSRNCI (1)

183216  GSRYAMISMKIMMVYLLKNFRFKTKIREEDIRYKFDALLRIEGGHLVQIEKRA*  183055

>CYP325Q2 1.187_2 AAGE01120855 54% to 1.187_2 AAGE02009773. 1 21377- 224872 (+)

1243 MWFFTVALVSICVLMVIRWLQKRRRDFAKHVPWVRPYLPVLGNGLLFIGKDDVQRFWNMQKMFDRKE  1443

1444 NLFRFYLGPNTVFGTNDPGTAQQILTDPNCMDKPYVYDYFLADCGVFAAK (1) 1593

2350 TSVWKSQRKALNPTSNVRVLQGYIPTFCRINSAMIKRLENVPAGKTINFMDYASRLAVELVCA

TTLGFDINQFDDPDGFAHNMER (2)

VFYVASRRMLNVHLQLDTVYRWTKDYREERALREKMESYAMK (0)

IYESAERRFSSPPEDDEDQEQEKSRILVHQLFVNKHRKFAKM

EILHNIYTIIAAGTDTTANAVSYTCLQLAMHPEQQERLYNEINDIFPNSEPIITLEALKC

LPYLDMVLKEALRLYPAAWIVMRENTDDVIIDGLRIPKGNKFAVNIYSMQRRVDVWG

PDANLFNPERFGAERSATRHRYAFLPFSGGRRDCL ()

GARYAMISMKIMMVHLVKHFRFTTTMREEDINFRFDALLRIIGGHQLQIEKR*

>CYP325R1 1.174_1 AAGE01132222

MLLVLAIVLVLLLILLVDSTLKHHVGKFARSLESVSPNYPLLGSATVFLGHSEERRFENFMNMLRQVDRIGKGWLGPQLM

FYVAHPELVQKVLTDPNCSEKPFFYEFSRLTHGLFSAKYSIWKPNRKALNPTMNVKMLNSFVPIFERFSRSMVEKLKCYP

EGTPVDILDFTTECALEMVCGTTLGTALKKGSGKRKFLESMQTFISRVATRTLSVSLYNESFYRLTRAYNEEENARKYCL

DFAKCIIEERQQVLVTEPQSKNSDENEDDDGYQIRRPKLFIDQVLSGNNTEADISTQNLSEQILTIMAAGYDTSANMVAH

SCLFLAIFPELQEKVAQEIQTVLPDCEQELTAETLKDLPYLDKFFKECLRLTPVGSTIARVNMTDIELDGCRIPKGNIFI

FNFYVLHRRKDIWGPYAEQFDPENFSPERSKGRHPFAFLPFSGGSRNCIGARYAMISNKIMIIHLVRNFRMSTKIRFEDL

KYRINVTLNLAFKHLITLEARR.

>CYP325S1 1.6_1 AAGE01025218 AAGE02000568.1 (2773-4912 plus strand)

MLLIPVLLLIAIFSATWVLIILYIKRNRAFARSLTLHPPKVYFLGMDLTMAVEDEVQRFESVWRMFLSHDRMFKHLLGPI

MGIGISHPDLMHKVLSHPDCLEKPFFYNFVQLEHGIFSAEYKLWKGQRKALNPTFNMKILNSFISIFEDCSSRMVADLFK

CANGETVDMFQFTSKCTLEMVCATTLGSNVLEREGSDEFLRNMEGLFELVGKRMLSVELFLDSIYRLTSYYRKEMKIRKK

IEEFSGNIIREKRREHMFCLNQQHLHNASTPKEDEDDIRKPQIFIDQLLSLSNSSRPFTDEEILHNVLTIMIAGNDTSGL

GVAHACLFLAIYPNIQQKVYDEVMKHFPPDGPNDRISLDADFLRQLEYTEMFLKEVLRHCPVAPTVARQNLKELELDGVR

IPAGNTLSFSFFALHRRKDIWGPDAEKFDPENFAPERCEKRHPYAFMPFSSGSRNCIGGRYAMISMKVMIVYIVRNFSLK

TNLRHSHLRYKFGMTLKLPFAHAIQVYKRNIEQ* 

>CYP325S2 1.6_2 AAGE01062475 AAGE02000569.1

33986  MCLYLLVSTFVLAFVWICESLRRKNAFAKNLPMAKPIKSFLGVDYSIMDMSDEERFEVMN  34165

34166  DCFARFDRLFVFYTGPLLVLAVSHPDLVQKLLSHPDCLEKPYFYDFVKFEQGIFSAK  34336

34872  KLWKGQRKALNPTFNLRILHSFFPIFDECSKKLVQELKKLPKGETVNLFRYTSHCALEMV  35051

35052  CGTTLGSDVLEREGKDEFLCALEE (2)

       IFGLVSRRMLSVHLYSDL  35231

35232  IYMMTPAYWKEQFARNKLRSFAMK (0) 35303

49327  ILQEKKETARDTKTNGTDLDSEPETEEFKKPQIFIDQLLSISDISRSFTDEEILCNVLVI  49506

49507  MIA (0) 49515

49575  GNDTSGLAVAYGCLFLAMFPQIQERVYAEIMEHFPSDEMEITADSLRLLEYTERFLKETL  49754

49755  RHCPVAANIARENMKDIELDGVMIPAGTKFTVSFWALHRRADMWGPEVHSFDPDHFLPER  49934

49935  CRDRNPNAYMPFSTGARNCI (1) 49994

50199  GRYAMLSTKVMLIHILKNFKITTKLRFEDMRYKFGMTLKMSTDHLVQLERRF*  50357

>CYP325S3 1.6_6 AAGE01064173 100% to htm file

MFLFLLLVCAILAFFAIRDHLRKTQAFAENLPIVVPEKSFLGINYDLLGLNDEERFELVNRIFLQQDRLFRMSIGPMLIL

GVSHPDLVQKLLSHPDCLEKPFFYDFVKYDQGIFSAKFKLWKSQRKALNPTFNLRILHSFVPIFEKCSKKLVSELEKCKD

GDTVNMFKYTSRCALEMVCGTTLGSDVLQRDGKEVFLTSLEELFLLVSRRMLSMHLYSDLIYMMTPHYWKELIHRKRCKA

FTKKILQEKKEARRYGATPESTPDSDPEADDFKKPQIFIDQLLSTSESSRPFTDEEIFHNVFVIMVAGNDTSGLATAYAC

LFLGMYPHIQEKVYAEVMEHFPNEDVEMTGDSLKQLEYTEMFLKEVLRHCPVAANIARQCIKDIEIDGTRVPAGNLFIFT

FWAMHRRKDIWGPDADKFDPDNFLPERVQARNPNAYMPFSSGSRNCIGGRYAMISIKVMLVYLLRRFKLHTNLKHEDLRY

KFGITLRLSTSHMVQLERRKC.

>CYP325T1 1.6_8 AAGE02000570.1  first of five P450 on this contig

Same as AAGE01024167b made correctons 5/21/06, Exon 2 continues on AAGE02000569

6015  MDLFLLLLTGPLAIVFLIFLYVRVLQYINRFANSVPFGGMSRYPLFINDWKLLRASPVQKFEILAE  5818

5817  TFAQHDRLFRVWFGPRMAFATCHPDVIQAILTHPECVDKPFFYRFARLDHGLLVGR  (1) 5650

68488  GHLWRRQRKQLNPTFNLRILTSFLPIFEKCCQQMVNCLEPFANGDRIDILQHTTRCTLNMI  68306

68305  LQTSLDTDSLSNEESASLVKHIKR  (2) 68234

68177  FFFISTNRVLNLHHYWEPVYRLTKNFAMESESYGVILGATRK (0)  68052

67661  ILNIKKNEMKDKPLNENDLEYKKPRIYMDQLLKLSDTMSDKEIMHNVCTMIAA  (0) 67503

67443  GNDTSGQLMAYACLLLGMYPHIQEKVYSEIIELIPLTRKESISVEQLKTLTYTEMFMFEC  67264

67263  LRLCPIAPNIARLNMTPIELEGITIPAGHIFFISFYSLHRRKDIWGPDAEQFDPERFSPE  67084

67083  RSVGRHLYAFLPFSGGSRNCIGWRYAMMSMKLMLVYLLREYRFRTDLKLSDLKFKFDMML  66904

66903  VLVFEHWVKIEKRRYNC* 66850

>CYP325T2 1.738_4 AAGE01054827

MLIPLLTLFVCLLILVVVIINFVNTVQAKYGFAKNLPTVTRADESIVKLLWRLVRASDVDKFNRVVEAFSLPYRLWKVWL

GPVVCLGVCHPDLVQIVLTHPDCLEKPFIYRFIRINRGLLVAEAELWKRHRKVLNSAFNLRILHGFIPIFEKCCSRMVSD

LKQMKDGETFDVMRFTARCTLEMVFETSLGTGCLPPSESDCLIRHIKRFFNIASSRFLNVHLHYEPIFRLTQRSKKETES

LHYCNTVVKQLLTEKRQNVTKTPETPDDEFGKPRIFVDQLLRLGNSFSETDIIHNVFTMIIAGNDTSGQLMAYACLFLGM

YPHIQEKVHAEIVEIIPRHHNEPISPEKLKSLAYTEMFLNECLRLCPTAPNIVRQNMAPITLDETRIPAGNLLAISLFAY

HRRKDIWGPDADEFDPDRFSAERSAGRHPFAFLPFSGGSRNCIGWRYAMISMKLMLVYLLREFKIKTDIRHQDMAFRFNA

ALVLAGKH.

>CYP325U1 1.6_4 AAGE01001298 AAGE02000570 second of five P450s on this contig EST EB094187.1

16107  MVLLLISFLIVLTLLKLVHRNNHRFAKDLPSVEPCYPLLGNALMFVGKSPEQKFENLARGFLQN 15916

15915  DRLFKLWFGPKLTLGTSHPELVQKIVNHPDCIERPLFFYKQLRMTQGLLVAR (1) 15760

15697  YGLWKQQRKALNSTFNLKILHSFIPIFEECSRKLVNRLQNHVGCSKPINLAQFVSQCTLEMVC  15509

15508  GTTLGMEHLQQESGSRFLHHIERVMDIMGERILSIPMQITALYFFTPMFWQEMHSLKMNRQYAAE (0)  15314

15260  IIDEGRRKMKANEQSNTIDEDQDGYHKPQIFLDQILSANRAGKPFDDEEIQHNVRTMIAA (0) 15081

8219   GNDTSALAISHCCLWLAMYPEIQERVYCEIKEHFPYPDSEITPEGLKNLIYTEMCIKETL  8040

8039   RLTGPAPNIARETLADVELDGLIVPKGTTIILSLYALHRRQDVWGPQADRFDPDNFDEDK  7860

7859   CRTRPAGVFIPFSTGPRDCI (1)

       GRYAMISMKIMIMYILRNFKLITQLKPEQLRYKFGPTLKLACDHMIQLEKRVD*  7581

>CYP325V1 1.6_3 AAGE01001298 AAGE02000570.1 Third of five P450s on this contig

40534  MITVLLFLVLFVVFIVVKYVKYERSFSFAKNIPSVEPAYPIVGNALQFVGKNGEELFKKF  40355

40354  ADMLNHPAKLFQMRMGVLRLFCTNDPDVAQKILTQCLEKPFLYDFFKLDYGLFSAH  (1) 40187

40119  YIWKNQRKSLNPTFNQKILNGFLPIFDQCAQNLVKRLQSCTDGDSVKITDCHLRCTLEML  39940

39939  CRTTFGVDINNNPNAFKLTALINE  (2) 39868

39801  IFHLASKRILRVHLYGEKIYRLTSDYRKDVKLRKEAYYYADK  (0) 39676

27232  IIQEVINRRNKEAPTLDNSDPECDGYRKPQIFIEQLLNQQENNNFTEIEIIHNVYTMIVA  (0) 27053

26986  GSDTTGNQLGYISLMLAFFPELQEKVYREVMEVFPG  26879

26878  EIEFTVDNLRQLEYTEMFIKECLRLLPIGPHVMRFTTADTELEGVSIPKGNILAVSIFNM  26699

26698  HRRKDIWGPNADQFDPENFSAERSKGRHPFAYVPFSGGNRNCI (1) 26570

26509  GSRYAMYSMKIVLVHLLRHFKIHTRRRFEDIRFEFEALLKMSIEPEVSLEKRVPVTIKRSN*  26324

>CYP325W1 1.6_9 494087031

MLITEFLILFLIVLVFIKLIKPLIQFRSIPYVRPWYPLVGNVFLFLGKTGEQLFDQMNCMFAQHDRLFLLWFGIRPVVGV

SHPELIRKVLTSRACLEKPFFYRFSRIDQGLWAAKSLWRSQRKALNATFSPSILKNFIPTFETFSKQLVDKLHQYEGSTI

DILPITSACTLRMIGRTTMGIDENDEMEIAKFVSNMDKITEVVSNRFLSVHLHSEQIYRMTQLYERETQYRKECSNYTMK

VLKERKRKVYMELPGLQKVFIDQLLDECALGRSFSDTEIMQNVYTMLAAGSETTARSISYACLLLAIYPDIQEKVYAEIM

SLLSDDIHPLTTATLAELTYMEAFLKECHRLYPVAPYIARESTESIELDGVCFPKGSVFIFNFFALHRSSAVWGIDSEQF

NPERFLNEQNGEHHAFGYLPFSGGQRNCIGQRYAMMSLKVMLIYLIRYFRMETHLRQEDLRFSFGMMLELSTECLVRFNK

R.

>CYP325X1 1.17_1 AAGE01111617  AAGE02009113.1 AAGE02009114.

33020  MYLLVFFGTIATLGTLWYWTYRWQFKFADKWPSVRPRYAIVGNALIMLWKNDVQRFQEIK  33199

33200  RVFSECDRILTAWAGPKMFLITSHPDIVHQILSSPDCLERPFLYRFAGFTQGIFTAK  (1) 33370

33414  LPVWKDNRKRLNSTFNQRIVHGFVPYFVKCCEKMTKSLLECADGETVNIQKYTAVC  33605

33606  ALEMAAGTTLGGDVLQQGDGKEEFKRGLDL  (2) 33695

33761  AFNGASRRMVTVPFYSDLIYQMTHHYKELMEGRRIICDFFTK (0)  33886

8595  LLIERKKFLLDHSKNTDVDTEEEYNKPKILVDQLLGVSHDGRQFNDIQIRDNVYAVITGA  8774

8775  TDTTSLATAHACLFLSFYPDIQERLHAELAEVFPGNIADYTPENIKKLTYLDMFINEVQR  8954

8955  HCTVVPYVARENTAEIEIDGVKVPPGNIFIMSLYAMHKRPDIWGPDAEKFDPENFTEERI  9134

9135  KDRHPAAFLPYSAGSKNCL (1)  9191

      GWRYAIFGMKLIM  9288

9289  IHLVRNFHFSSKIKHEDMQFRHDLTLKLPFQHLVQLKKRNPGKILTMVE  9435

>CYP325X2 1.170_2 AAGE01026029  AAGE02009114.1 EST DV278487.1 use this seq

17904  MLFLILTVTVSILGAILYWNFRARYRFSDKWPTLKPVYPILGNGPVVMGKNEVDRFEIIR  18083

18084  DVCYSAERILKIWAGPKLLLLTSHPDLIQQILTSPVCLEKPYLYHFAGFEEGLFTAK  (1) 18254

36838  YHVWKPARKRLNPAFNLRIIHGFVPIMARCAQKMAARLNKYPDGATVDIIKYTNMCTLEMI  37020

37021  CGTTMGSDVLNRDGKEEFKRGLDG (2)

       AFNGAAWRMMNVHLYP  37200

37201  DIIYKMTRYHKELTEARKIVCDFFTK (0) 37278

37823  LIVEKKQILQQKRLNNDEKNNNDEEENEADNHKPKILVDLLLSNSSDGKPFTESQITDNV  38002

38003  YAVITG (0) 38020

38170  AVDTTALITAHACLFMSFYPEIQERVFAEINQYFPVGSDDQEVTHEQFRQLTYTEMFLNE  38349

38350  VQRHWTPVPLIARENMAEFEIDGVKVPPGHVFGLSLHALHMRKDVWGPDADRFDPENFSE  38529

38530  ERAKNRHPFAFLPFSGGTRICL (1)

       GWRYASFSMKAVMVHLVK  38709

38710  NFKFSSKIKPEDIRFKHDLTMKLPFEHLVQITKRNPVAN * 38829

>CYP325X3P AAGE02009114.1 NEW SEQ EXON 1

72029  MLLVLSVFVVILCCVLFVSHRRKYKFADAVPSLQPVYPLLGNADIMWKSDTERFETIVK  72205

72206  IFSEHDRMVKVWAGPQMLLFTCHPDLVQQILSSSDCLEKPFLYSFAGFERGLFTSK (1)  72373

>CYP325X4 1.17_4 AAGE01001451  use this seq AAGE02009115.1 (+) 11116-41002

MLLAVTVIVGLITIWLLLSQRRRYRFADSLPQLKPWFPVVGNGALMFGKSDVDRFDVLVKIFRDYDRMVRVWAGPKMLLF

TSHPDLVQQLLTSPACLEKPFLYSFAGFEQGLFTSKYKLWRSMRKRLNSSFNLRILHGFIPVFVQCARKMVEDLNENPDG

TVVSMHKFTSVCTLEMACGTTLGSDITRREGKEEFVHGLDIAFGEAARRMVSVHLYPNIVYHLTKYHRELVQARGVVCDF

FSRLVTERRNTMSLNCNKKTNEEELDFDRKPKILIDQLLSVNRDGKSFSDTEIEDNIYAVITGANDTSGLLIAHACLFLC

FYKDIEEKLFTEIMEFMPNEEFEINPESLKQLSYLEKFLKECLRHCPVAPNISRENMSEIEIDGMKVPPGNIFIMNFYAL

HRRKDIWGPDADKFDPEQFSEERSRNRHPFAYLPFSGGNRICIGWRYAMFSMKVMLIYLIRNFQFETEIRPEQVRYRHDL

TMKLPFEHMIKVTRRKLEGSTVMSDILKHPELVPKEGRE.

>CYP325Y1 1.197_1 AAGE01071933 AAEG02010177 52053-67182 (+)

MFLILLGIIGALLAWQYLKLLLAGSYATKIESFRPSYPVLGHLTLFWGKNSCEAFSSATRLFATVDRLGKVMLGPKPLIV

VHHPEVMQQVLSRHDLYDKPFFYDFLRLGSGLITERSGERWLQARKLLNPTFNTRMLTGFLPIMDSEARRLSNGLEPLAD

GKTEIDIFKYISSCTLSMVFSTTMGQNGKEIPGQQDYVRSLEDLMNAVGERIMNVNHFIGPIYRFSKAYRVHQKASEVCN

GFTHRIVQKRRFEIQKLGENFHQKDEYIKQSLNALDQIITIKKQDGSGFSDTEVNEHLYSLIGAANDTSALTAAYTCLYL

AMYPEIQNKVVNEMNQVFYSPEVEVNLETLKQLEYTEMVIKEILRLFPAVPLGARQTANEIVLDGIRIPKDQIIVYSLYT

LHRRKDIWGPDPDQFDPERFLSEAIQARHPFAYLPFSGGLRNCIGHRYAMNSMRIMLLRILQKFEIRTNMKPMELKLKFE

ITLKLDGPHRVWLVKRNK. 

>CYP325Y2v1 1.197_2  AAGE01004336 AAEG02010177 74557-88950 (+)

MLLVLLAVVGVLLLFQYIKLLLSNGYADKIPPLQPVYPLVGHIPLFLGKNTHQAFDVVVKLLGSVERMGKLMLGPKPLIT

ISHPDLMQQVLTRNDLYDKPFLYEFLRLGNGLITERSGERWLQTRKLLGPTFNTSMLTSFLSTMDARTMKMVSKLQSLAD

GHSEIDIYPFLLTCTLEIAISTTMGRMDDEMPGQQDYIRNLEMLVKNAIGTRIVNINLWLFYQFSKAYEVEERARKICYD

FTNKIIEQRRLELHSLPKDAAVDDEYIKKRMNTLDQILTAQKSDGTTFSNTDLIYQLFTIISADTSALTVSYTCLYLAMN

PHIQDTVKSEMDQVFYSPDVEINLDTLKQMEYTEMAIKEALRICPTAPFAARQTSSEILLDGITVPKGEIIFIDLYNLHR

HKEFWGPDPDRYDPERFRPEAVQQRHPFAFLPFSGGSRNCIGHRYAMNAMKIMLLRLLQNFEVRTNLKQEDFKFRFEITA

KLEGPHSVWLVKRNKGL.

>CYP325Y2v2 AAGE02033152.1  Length=5210 allele of 1.197_2 about 8-10 aa diffs

934   SGERWLQTRKLLGPTFNTSMLTSFLSTMDARTMKMVSKLQSLADGHSEIDIYPYVLTCTL  1113

1114  EIAISTTMGRMDDEMPGQQDYIRNLEI (2)1227

1256  IMNAIGTRIVNINLWLFYQFSKAYEVEERARKICYDFTNK (0)  1375

1431  IIEQRRLELHSLPKDAAVDDEYIKKRMNTLDQILTAQKSDGTTFSNTDLIYQLFTIISA  () 1607

1672  DTSALTVSYTCLYLGMNPHIQDKVKSEMDQVFYSPDVEINLDTLKQLEYTEMAIKEAL  1845

1846  RICPTAPFAGRQTSSEILLDGITVPKGEIIFIDLYNLHRHKEFWGPDPDRYDPERFRPEA  2025

2026  VQQRHPFAFLPFSGGSRNCIGHRYAMNAMKIMLLRLLQNFEVRTNLKQEDFKFRFEITAK  2205

2206  LEGPHSVWLVKRNK  2247

>CYP325Y3 1.197_3 AAGE01005370 AAGE02010179.1  9041-10304 (+) partial

4098 MFVFLLGVVCALLVFQYLKLLRAGSYATKIETLRPVYPVLGHIPLFGGKNSHESFCTLRRLLNS  4289

4290 VDRIGKFVVGPKPFIVIQHPELMQQVLCCNELYDKPFLYDFFRLGNGILTER (1) 4445

3009 SGERWLQARKLVNPAFNTRMLTAFLPIMDSEAKSLCDKLEPLADGNTEIDIF 2857

2856 SHLSSCTLSTTFGTTMGQNAKEIPEQHDYIRNVEI (2)

     FLKAVG 2677

2676 ERLVNVYYFIEPIYKLSKAYKIHDEARRICNEFTHRIVSKRRFEIQSLGEDFQQKDEYI 2500

2499 KQHLNALDQIITMKRPDGTGFSDLEVNEHLYTLIGA (0) 2392

2330 GTDTSALNVAYTCLYLAMYPEVQEKVLTEINQVFYSPEVEVNIENLKQLEYTEMVIK 2160

2159 EILRLFPAVPLGARQTMSAIELDGIRIPKDQIIIFSMFTLHRRKDIWGPDPEQFDPERFR 1980

1979 PEAIEARHPFAYLPFSGGLRNCIGHRYAMNVMRIILLRIMQKFEIQTNMKPTDLKLKFEV 1800

1799 TLKLDGPHRVWLVRRNK* 1746

>CYP325Z1 1.467_1 AAGE01124926

MAVILAFLLFTTFFFMLVLIRRYVIDNLYALKIPTVSPVQPVIGHAGIFMRKNTHQMFWLFVKCYQEVDRLAKLRFGPIP

VLLVNHPELIQQLMIRPELYDKPFFYEYMGLGKGLITEQSEIWRRSRKLLNPAFSTRILNEFVPIMDSRARKMVKSLAVL

ADDKTEFDILPITAQCTLEMVFSTTMGCKMEERPGEREYVRCLEGLMTCIGERILNIDRYLGPVYRFTKAYQVDKVCRDT

CNGFTEKIIQERKREMANINNNIIDERMSAAEIDDGRVKSMNFLDQILTIQRPDGTNFVDDEVSDHLYSIVGAVGNETST

LTISYTCLFLAMDHQIQAKVCSEIKQVFPSHHTEVTPEALKQLIYTEMALKETLRLCPAVPFAARSNVKPIELDGIHIPQ

RQIFCFNFFALHRRKDFWGDEPEQFDPNRFSPENSRNRHPYAYLPFSGGFRNCIGGRYAINSLKIMLLRILQNFHMDTSL

KREDMRFRWAITMKLVGPHAVRLTKRDLYQQNPPSAVHL.

>CYP325AA1 1.105_1 AAGE01008633 AAGE02006231.1

94074  MEITQVLSWIVVGLLLITYIAHKWKYRNLRMIPGTNPDYPVLGNIPLFLKGGNAYMKVFD  93895

93894  KEHRMSKIWLGPVPLINVQHPELVQKVLNECIDKPFAYDFMELGQGLVSER  (1) 93742

93680  YGQRWREHRKTLSPLFNTKILHSFIPIFERATSDVMKRLEVVCDGRDFDLLEYTSSCSAKM  93498

93497  VHGTMVDTLSVSEEIIHSLITNLDI (2) 93423

86605  ILDAVGKRILNGVYALKTLYKMSSVYRDEWRSRKICYETVNDVRTTRHSMANC (1) 86447

86352  TEADLKNPSKSKAFLERLLTIQHKGRSFTDDEIINHAYTMLVA  (0) 86224

86154  GYETTALQLTNVCMMLAMHPDIQERVASEIKTIFPSLDMEILPEALK  86014

86013  DLPYLDMTINETMRLYPVVPLIARQSNSSLELDKVNIPTGTNFIVHIGALHRRKDVWGEE  85834

85833  VLDFNPDNFLPEKVERRHPYAFIPLSAGPRVCIGNRYAMLSLKVFLIRLLQRYRLSTKLT  85654

85653  RKDLKFKFQVTLKLKIPYTVQMERRNLYGEDSTVNCTK  85540

 

 

Mito clan (10 seqs)

 

>CYP12F5 1.47_1 AAGE01014703 100% to CYP12Fb

MQLKSVSRVFTFNSNCFNRTFSIVPTRNYGVQTAPASEGSDPEWDNAKPYESIPRMTLMESVKNFFPG

GRYHNVSITEMHRLFQEDYGDLIRFPGILGRKDTVMTYRPDDFEKLFRTEGTWPNRRGLD

TFVHYRKNVRPDVFKGVGGLVTE

QGESWQKFRTIVNPVLLQPKTVRLYVDKLDEVTREFMNI

MLKIRDNKNEMPADFNQWLNRWALEVTGVISVDSRLGVLDAEESEEAKRIVK

LTKELFELVYQLDIRPSIWMYYKTSKYHRLMKVFDELTAIAMAKVDEAVVRLEKNPTTNTDAQSVLEK

LLKIDRDVAIIMSFDMVLAGIDTTTSAIIGILYCLANHPEKQAKLREELRGILPTKNSSL

TPDNMLNLPYLRACIKEGMRLFPPIGGNIRAAGKDIVLQGYRIPKGTDVAMGSMVAQQSD

RFVPRAKEFLPERWLKTKEPGCPHAKDAHPFVYLPFGNGPRTCVGRRLAMMEMEILIARI

TRLFEYRWNYGDLNIQTTLVNTPVNDLKFQMMEVDS*

>CYP12F6 1.47_2 CYP12F new AAGE01025257 AAGE02003131.1

26817  MQSKGRSVVLKATLDHYSGRYVTIDRCYGIQVAPSSEGRDPEWDNAKPYEQIPRMTFFQA  26996

26997  LKNFVPE (1) 27017

27079  GRYHNVSATEMHRLFQQDFGDLVRFPGILGRKDTVMTFQPDDF  27207

27208  EKVFRTEGPWPNRRGLASFVHYRKEVRPEVFKGLGGLVSEQGENWQKFRSIVNPVLLQPK  27387

27388  TVRSYVGKLDEISREFMNI  (2) 27444

27509  MLKIRDDKNELPADFSQWLIRWSLESTGVLSVDSRLGVLDEQESDKARQIV (0)  27658

27726  LTKELFELVYQLDILPSIWVYYKTPKYHRLMKVFDELTSIAMAKVDEAVLRLEKNPSTTS  27905

27906  DAQSVLEKLLKIDRNVAIVMSFDMILAGVDT  (0) 27998

28055  TTSAIIGILYHLARHPEKQAKLREELLTIMPKKDTSLTPDNMQKLPYLRAFIKEGIRLFP  28234

28235  PIVGNLRAAGKDIVLQGYRIPKG (0) 28302

28369  TDIGMGSMVAQQSDRFVPRAKEFLPERWLKTKEPGCPHAKDAHPFVYLPFGNGPRTCVRR  28548

28549  RLAMLEMEILIARITRLFEYRWNNGDLKIQTTLVNTPVNDLKFQMVEVDD*  28701

>CYP12F7 1.47_3 AAGE01039158.1 100% to CYP12Fa

MLRKAVKVNNSVVVSSVRFRSTQAQAAVANGAAAHEARDSEWDNALPFSKIPGPNVFQMLKSFAPGRYHNANLPTMHRLF

REDYGELVRMPGLFGRRDVLLSFRPDDYETLFRNEGQWPIRRGIDTFAYYRQKVRPDVFKGLGGLVTEQGENWQTFRTAV

NPVMLQPKTVKLYVDKLDAVAQEFMKMMVRIRDDKNELPGDFSQWLNRWALETMGVLALDTRLGVLDESESEEAKSIVDN

IRQFFELTYQLDVLPSVWKYYKTPTFHKLMSVLDVLTSIVMAKVDDAVIRLEKNPSAPSDTQSVLEKLLKVDRHVAIVMA

FDMLLAGVDTTSSGTTGILYLLATNPDKQAKLREELRTVLPKKDSPLTAENMRNLPYLRACIEEGLRLCPPTAGNVRAAG

KDLVLQGYQIPKGTDVAMASMILNQEETYVKRAKEFLPERWLKEDGYPNAKDAHPFLYLPFGFGARTCIGRRLAMLEMEM

IVSRITRQFDYRWNYGELEVRASLINVPINELRFQMTELDD.

>CYP12F8 1.222_1 ae11  AAGE02011045.1 first exon AAGE02011046.1 exons 2-6

25298 MAGNRTVRLGCNLGQRMGLATRVTHHETEWDKALPYSKIPAPSVFKMLKNFGPG (1) 25459

2812  GRQYNAGLPEVYRFFRDNYGDLVRMPGLFGKRDMLLSFHPDDYETLFRNEGQWPLRRGLD  2991

2992  TFGYYRMHVRPDVFKGKGGLVAD  (2) 3060

3126  QGENWQKFRSTVNPVMLQPKTVKLYVNKLDKVALQLMGL (2)

      MI  3305

3306  NMRDSKNELPANFKQWINRWALESMGVLALDTRFGLLDSKQSVEAQIIVTNLQEFFELTY  3485

3486  QLDVLPSIWRYYKTASFKRLITVLDRITE (2) 3572

3632  IVKSKIEEAAARLESNPSAPSETQSVLEKLLKVDRDIAFIMACDMLMAGVDT  3787

7202  TGAGVTGILYCLATNPDKQAKLREEIRTILPNKDSALTPENMHNLPYLRACVKECIRLCP  7381

7382  PVSANVRATGKDLVLRGYQVPKG  (0) 7450

7519  TDVAMSSMILQNDERFMTRAKEFIPERWLKLDDYPSVQDAHPFLILPFGFGVRTCIGRRL  7698

7699  AMLEMEILTARITRLFEYRWNYGELKIRGNLVNMPINELKFQMTEVED*  7845

>CYP49A1 1.338_1 AAGE01096311

MVGQRIANSLLKRSAFSSAINVLPNEAAATIDPPPLADYRGHVKPYSDVPGPKELPLIGNSWRFAPLIGQYRIEDLDKVM

CDLHRHFGKIAKVGGLIGHPDLLFVFDADLIRDTFKKEEVQPHRPAMPSLRNYKSKLRKDFFGDNMGLIGVHGEKWDAFR

AQVQQVMLQPTTAKKYIAPLDEISTDFMARIHEMRDENNELPGDFLHELYKWALESIGRVALDTRLGCVSKTGNEESKRI

IDSINTFFWTVAEVELRMPIWRIYKTSAYKKYLGALDTFRELCMRHINIAMEKMNNSSEVKSEEHISIVERILQKTNNPK

IAAVLALDLIMVGVDTTSVAATSTIYQLSQNPDKQEILFNEIKRSLPTPDTKFTISMLETMPYLRACIKETLRMYPVVIG

NGRSLQSDAVIGGYHIPKGTHVIFPHLVVSNLEEYFPEPDRFLPERWLKRGELKEHAGCPHAGQKIHPYVSLPFGYGRRT

CIGRRFAECELQILLSKLFRRYHVEYNYEKLTYKVNPTYIPDKPLKFKLTERTD.

>CYP301A1 1.1181_1 AAGE01019797

MMDVDSVAVNTRLHPAPAHIQQQAPPTIKLENARPYSEVPGPKPLPILGNTWRVFPIIGQYKISDVAMISFLLHEHFGRI

VRLGGLIGRPDLLFVYDADEIEKVYRNEGPTPFRPSMPSLVKYKSELRKDFFGDLPGVVGVHGEPWREFRSRVQKPVLQL

STVRRYVTPLEQVTEEFIDRCNQMLDHNKELPDDFDNEIHKWSLECIGLVALDTRLGCLEPNLTSDSEPQQIINAAKYAL

RNVATLELKAPYWRYFPTPLWTKYVNNMDYFVKVCMKYIKSATKRMNLGEGRALDGEPSLLERVIKSQKDERLAVVMALD

LILVGIDTISMAVCSILYQLATRPAEQQKVYEELKRIMPDPKTPLTYQLLDQAHYLKAFIKEVLRVYSTVIGNGRTLQED

TVICGYRIPKGVQCVFPNLVTGTMEEYVTDAKSFKPERWLKPSQGGTGDNLHPFSTLPYGYGARMCLGRRFADLEMQILL

AKLLRSYKLEFHHKPLKYVVTFMYAPEGALKFKMTPRE. 

>CYP302A1v1 1.581_1 AY947549 AAGE02020818.1  3 aa diffs to AY947549

48630  MYLSPVISKIKSATLMTSRSCATVVLE (2)

       NVKPYNQIPG  48451

48450  PRGPFGLGNLYQYIPGI (1) 48400

48337  GKYSFDALHESGQDKYEKYGPIVRETMVPGQDIVWLYDPNDIAAVLNDKTPGIYPSRRSH  48158

48157  TALAKYRRDRPNVYRTAGLLAT (2)

       NGIEWWKIRSELQKGL  47978

47977  SSPQSVRNFLPLTDKVTREFVASMNSTEHDCVPDFMPAISRLNLE (1)

47784  LICLMAFDVRLDSFSDEQMKPNSLSSRLMESAEVTNQSILPTDQGFQLWKYFETPAYRKL  47605

47604  RKAQEFMEKTAVELVSQKLLYFDEDQQKLASGRHRSRSLLEEYLRNPNLELHDIIGMAAD  47425

47424  LLLAGVHTSSYTTAFALYHLCLNPDAQDKLYQEACRILPDPWECQIEAAALN (1)  47269

       SEASYCRAVLKESLRLNPISIGVGRILNKDATLGGYHVPKGTVVVTQN  47065

47064  LVSCRQERYFKNPTKFIPERWMRGTKEDVNPYLVLPFGHGMRSCIARRMAEQNMLVLLLR  (0) 46885

       LIRSYEIDWKGKVPMNIETKLINQPDQPIKIAFRSRKS*

>CYP302A1v2 1.4395_1 AY947550 end is missing last exon AAGE02035843.1 

3078  MYLSLVKSKIKSATLMTSRSCATVVLE (2)  2998

2930  NVKPYNQIPGPRGPFGFGNLYQYIPGI (1)  2850

2787  GKYSFDALHESGQDKYEKYGPIVRETMVPGQDIVWLYDPNDIAAVLNDKTPGIYPSRRSH  2608

2607  TALAKYRRDRPNVYRTAGLLAT (2) 2542

2479  NGIEWWKIRSELQKGLSSPQSVRNFLPLTDKVTREFVASMNSTENDCVPDFMPAISRLNL E (1) 2397

2238  LICLMAFDVRLDSFSDEQMKPNSLSSRLMESAEVTNQSILPTDQGFQLWKYF  2083

2082  ETPAYRKLRKAQEFMEKTAVELVSQKLLYFDEDQQKLATGRHRSRSLLEEYLRNPNLELH  1903

1902  DIIGMAADLLLAGVHTSSYTTAFALYHLCLNPDAQDKLYQEACRILPDPWECQIEAAALN  (1) 1723

1662  SEASYCRAVLKESLRLNPISIGVGRILNKDATLGGYHVPK  1543

1542  GTVVVTQNLVSCRQERYFKNPTKFIPERWMRETKEDVNPYLVLPFGHGMRSCIARRMAEQ  1363

1362  NMLVLLLR (0)

1276  LIRSYEIDWKGKVPMNIETKLINQPDQPIKIAFRSRKS*  1160

>CYP314A1 1.524_1 AY947552

MSVTIILFYVFITAFMLLSYNPKPRKILESIKSFLLHLVHLSKN

VVSTTIHVPPDAMQMNQAEPVYTVWDIPGPKRLPLVGTRWMYYVGRYKLNKMQDAFVD

LHKRYGNIVLEFDHVPIVNLFDRVDMEKVLKYPSKYPYRPPTEIVEYYRRSRPDRFAS

TGIVNTQGEQWHELRVKLTSGIMSRKLLQAFIPTLNEIADEFVTLIRQKRDSNDCVKD

FQDIANTVGLEIICCFVLGRRMGYMSGDKQKNEKFVKLAEAVKSTFMYISQSYYGVKL

WKYLPTKLYRDYVRCEEIIYDTIAEIVNEALAEEQEKCAADDMRGIFLNILQSEGLDK

KDKIAGIIDLIHAAIETFSNTLSFLLNNMTSHPERQARIASEFTSDTITNNDLVNAAF

TRACIKESYRISPTTPCLARILEEDFDLSGYQLKAGTVVLCHTRVACQNEQNFQQANT

FLPERWLEQVDENQNVYKLDEPGSSLVLPFGTGRRMCPGNKIIEIELTLIMAKIFQQF

KVEYHSQLDTQFQFLLAPGTPIEIIFRDRD

>CYP315A1 1.622_1 AY947551 AAGE02021700.1

141373  MKLMSSVASGKARPFQDLPGPRRFPFLGTINDIIHLGNPKT  (2) 141495

142158  LHLTISKHHIKYGPLFKIQIGNVNAVFIKDPDMMRSVFAYEGKFPKHPLPEAWTYFNEKR  142337

142338  KCKRGLFFM (2) 142364

142420  DDEEWLHYRKLLNQPLLRNTSWMIGPIKRVSDNTIKSLPHNAKHSDCKEKRFELHNV  142590

142591  ESVLYKWSIE (1)

147854  VLLSVMLGSSYNEINAIKLNELVEQFSRTVYQIFMYSSKLMAVPPEIADRLQLDAWKQ  148027

148028  FERIVPESLAI (1)

        ANKIIDISIDDIERGDGLLSKLEDCIPSR  148207

148208  DSIKRIFSDFIIAAGDT

148323  TAFATLWCLYLLAKNQAVQTMVRDETKHDFLESPLIRATVKESLRLFPIAPFIGRFLATD  148502

148503  AIIGDYCIAKN (0)

        TLALLSLYSAGRDEVNFYLPNEFLPQRWLR  148682

148683  RDDKNQSIIPFNANASLPFAIGSRSCIGRKVALIQMQYLLSK  (0) 148808

167332  ILNEYRLTVLNDEEVDAELKLVTVPNKKVKLAFHKLQ  167442