P450s that have appeared since the 1993 P450 nomenclature update.
      Part C covering CYP10 to CYP69 
      Animal P450 names continue at CYP301 in this file
      Lower eukaryote names continue at CYP501-699 in this file
      Lower eukaryote names have used up all 3 digit names and now
      Continue at CYP5001.

      ALL Drosophila melanogaster P450S ARE NOW INCLUDED

      This includes list references that were incomplete and duplications of 
      sequences that were already in the update.  If a sequence is assigned an 
      accession number that was not in the old update it is included in this list.  
      Some expressed sequence tags (ESTs) are also included from humans.

      This list last revised Aug. 24, 2009 (adding in all new fungal CYP names)
      This list was last revised on Dec. 31, 2007. 
      Added all Neurospora P450s see 527A1-553A1
      Added CYP51 Trypanosoma brucei
      Added Fugu P450s, added CYP505A3 added CYP18 Spodoptera
      Added all human genes and pseudogenes
      Added 104 Anopheles genes
      Revised May 13, 2003 named all remaining Dictyostelium P450 genes
      Many sequences have been added without updating this list (May 11, 2005)
      Added names for Nectria haematococca (158 genes/pseudogenes) Feb. 16, 2006
      Added all Phanerochaete chrysosporium (white rot fungi) genes Aug. 29, 2007
      Revised Jun 22, 2010
      Compiled by David R. Nelson

There are 80 C. elegans P450s listed here, surpassing the known mouse and human 
complements.  The C. elegans genome is now about 90% finished sequence and 9% 
unfinished (one strand or one chemistry).  About 1Mb is not cloned at three 
telomeres and two internal sites.  A special issue of Science appeared in Dec. 98 even though the genome is not completely done.  The amount of sequence in the Blast searchable database at Washington Univ. is 140Mb, more than the 100Mb size of the genome.  Therefore, we can guess that this set includes all the P450 genes in C. elegans, but the distrubution is not even. Most P450 genes (43 genes) are on chromosome V. see additional info on C. elegans P450s see this list. To see the actual sequences go to the C. elegans sequence file.  So far we are missing CYP11A, CYP11B, CYP17, CYP19, CYP21, CYP24 and CYP27A and CYP27B.  Does C. elegans make steroids? The present evidence would suggest not. Does C. elegans have 
mitochondrial P450s?  There is one probable mitochondrial P450 in C. elegans on 
cosmid ZK177 named CYP44. It was thought to be incomplete but now a full length sequence
has been assembled from the genomic sequence.

10A Subfamily

11A Subfamily

11B Subfamily

12A Subfamily

12B Subfamily

13A Subfamily

13B Subfamily

14A Subfamily

16A Subfamily

17A Subfamily

18A Subfamily

19A Subfamily

21A Subfamily

22A Subfamily

23A Subfamily

24A Subfamily

25A Subfamily

26A Subfamily

27A Subfamily

27B Subfamily

28A Subfamily

29A Subfamily

30A Subfamily

31A Subfamily

32A Subfamily

33A Subfamily

33B Subfamily

33C Subfamily

33D Subfamily

33E Subfamily

34A Subfamily

35A Subfamily

35B Subfamily

35C Subfamily

35D Subfamily

36A Subfamily

37A Subfamily

37B Subfamily

40A Subfamily

41A Subfamily

42A Subfamily

43A Subfamily

44A Subfamily

45A Subfamily

46A Subfamily

51A Subfamily

52A Subfamily

52B Subfamily

52C Subfamily

52D Subfamily

52E Subfamily

52F Subfamily

53A Subfamily

53B Subfamily

54A Subfamily

55A Subfamily

56A Subfamily

57A Subfamily

58A Subfamily

59A Subfamily

60A Subfamily

60B Subfamily

61A Subfamily

62A Subfamily

63A Subfamily

64A Subfamily

65A Subfamily

66A Subfamily

67A Subfamily

10A Subfamily

CYP10A1     Lymnaea stagnalis (pond snail)
            GenEMBL S46130 (1870bp) PIR JX0225 (545 amino acids)
            Teunissen,Y., Geraerts,W.P., van Heerikhuizen,H., Planta,R.J.
            and Joosse,J. 
            Molecular cloning of a cDNA encoding a member of a novel
            cytochrome P450 family in the mollusc Lymnaea stagnalis.
            J. Biochem. 112, 249-252 (1992)
            Mitochondrial clan

CYP10A2     Biomphalaria glabrata (bloodfluke planorb, carries schistosomiasis)
            ESTs EV821686, EV821681, EV817279
            Probable mitochondrial P450


CYP10A3   Lottia gigantea (owl limpet)
          JGI Protein ID:233081
          53% to CYP10A1

CYP10B1    Capitella capitata (Gallery worm, polychaete worm, annelid)
           JGI Protein ID:143013 
           46% to CYP10A1

CYP10B2    Capitella capitata (Gallery worm, polychaete worm, annelid)
           JGI Protein ID:134490
           87% to CYP10B1, 47% to CYP10A1

CYP10C1    Helobdella robusta (leech, annelid worm)
           JGI Protein ID:67702 
           48% to CYP10B2, 41% to CYP10A1

11A Subfamily

CYP11A1     human
            PIR A48733 (239 amino acids)
            Matteson, K.J., Chung, B.C., Urdea, M.S. and Miller, W.L.
            Study of cholesterol side-chain cleavage (20,22 desmolase)
            deficiency causing congenital lipoid adrenal hyperplasia
            using bovine-sequence P450scc oligodeoxyribonucleotide
            Endocrinology 118, 1296-1305 (1986)

CYP11A1     human
            GenEMBL M14565
            Chung BC, Matteson KJ, Voutilainen R, Mohandas TK, Miller WL. (1986)
            Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, 
            assignment of the gene to chromosome 15, and expression in the 
            placenta. Proc Natl Acad Sci U S A. 83, 8962-8966.
            First complete human CYP11A1 cDNA

CYP11A1     Pan troglodytes (chimp)

CYP11A1     Papio hamadryas ursinus (chacma baboon)

CYP11A1     Macaca fasicularis (cynomolgus monkey)

CYP11A1     rabbit
            GenEMBL S59219 (1336bp) PIR A49189 (445 amino acids)
            Yang,X., Iwamoto,K., Wang,M., Artwhol,J., Mason,J.I. and 
            Inherited congenital adrenal hyperplasia in the rabbit is caused by
            a deletion in the gene encoding cytochrome P450 cholesterol side
            chain cleavage enzyme.
            Endocrinol. 132, 1977-1982 (1993)

CYP11A1     bovine
            PIR A42033 (18 amino acids)
            Pikuleva, I.A., Lapko, A.G., Chashchin, V.L.
            Functional reconstitution of cytochrome P-450-scc with hemin
            activated with Woodward's reagent K. Formation of a
            hemeprotein cross-link.
            J. Biol. Chem. 267, 1438-1442 (1992)

CYP11A1     Bos taurus (cow)
            See cattle page for details

CYP11A1     Sus scrofa (pig)
            GenEMBL X13768 (see also NM_214427)
            Mulheron GW, Stone RT, Miller WL, Wise T. (1989)
            Nucleotide sequence of cytochrome P-450 cholesterol side-chain 
            cleavage cDNA isolated from porcine testis.
            Nucleic Acids Res. 17, 1773

CYP11A1     Sus scrofa (pig)
            GenEMBL L34259 (2376bp), NM_214427
            Urban,R.J., Shupnik,M.A. and Bodenburg,Y.H.
            Insulin-like growth factor-I increases expression of the porcine
            P-450 cholesterol side chain cleavage gene through a GC-rich domain.
            J. Biol. Chem. 269, 25761-25769 (1994)

CYP11A1     Equus caballus (horse)

CYP11A1       goat
            GenEMBL D50058 (1825bp)
            Okuyama,E., Okazaki,T., Furukawa,A., Wu,R.-F. and Ichikawa,Y.
            Molecular cloning and nucleotide sequences of cDNA clones of sheep 
and goat 
            adrenolcortical cytochrome P450scc.
            unpublished (1995)

CYP11A1       sheep
            GenEMBL D50057 (1825bp)
            Okuyama,E., Okazaki,T., Furukawa,A., Wu,R.-F. and Ichikawa,Y.
            Molecular cloning and nucleotide sequences of cDNA clones of sheep 
and goat 
            adrenolcortical cytochrome P450scc.
            unpublished (1995)

CYP11A1     bovine
            PIR S29644 (21 amino acids)
            Tsujita, M. and Ichikawa, Y.
            Substrate-binding region of cytochrome P-450(scc) (P-450
            XIA1). Identification and primary structure of the
            cholesterol binding region in cytochrome P-450(scc).
            Biochim. Biophys. Acta 1161, 124-130 (1993)

CYP11A1   Canis familiaris (dog)
          79% to CYP11A1 human

Cyp11a1     mouse
            GenEMBL J05511, NM_019779, AF195119
            Rice,D.A., Kirkman,M.S., Aitkin,L.D., Mouw,A.R., Schimmer,B.P. and
            Analysis of the promoter region of the gene encoding mouse
            cholesterol side-chain cleavage enzyme
            J. Biol. Chem. 265, 11713-11720 (1990)

CYP11A1    Gallus gallus (chicken)

CYP11A1   Taeniopygia guttata (zebrafinch)
          NP_001120846 NM_001127374 
          76% to CYP11A1 Gallus gallus (chicken)
          chrUn:142405603-142406467 frag 1 and 2 below
          chrUn:111324326-111324517 frag 3 below

CYP11-like fragments from zebrafinch genome
          60% to CYP11B1 human, 56% to CYP11A1 human
          Note: 11A1 gene is mostly missing from the genome assembly in zebrafinch
          and these seqs match the known mRNA for CYP11A1

CYP11A1    Alligator mississippiensis (American alligator)

CYP11A1     Xenopus tropicalis 
            CX377330.2 CX940317 cannot extend in ESTdb
            22200_prot scaffold_62:97483-110117 model short at N-term
            53% to CYP11A1 human 62% to 11A1 Fugu
            propose a GC boundary at the end exon 1 to preserve length

CYP11A1    Xenopus laevis (African clawed frog)
           ESTs CK799174.1 DR729422.1 DR729360.1 CN322906.1

CYP11A1     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP11A1     Oncorhynchus mykiss (rainbow trout)
            GenEMBL S57305 (1789bp) Swiss Q07217 (514 amino acids)
            PIR S32197 (514 amino acids)
            Takahashi,M., Tanaka,M., Sakai,N., Adachi,S., Miller,W.L. 
            and Nagahama,Y.
            Rainbow trout ovarian cholesterol side-chain cleavage
            cytochrome P450 (P450scc).  cDNA cloning and mRNA expression 
            during oogenesis.
            FEBS Lett. 319, 45-48 (1993)

CYP11A1     Fugu rubripes (pufferfish)
            No accession number
            82% to 11A1 trout, GC boundary at GIFNQ
            note: intron exon boundaries are the same for CYP11A, B and C

CYP11A1    Tetraodon nigroviridis (Green puffer)
           93% to CYP11A1 fugu

CYP11A1     Dasyatis americana (southern stingray)
            GenEMBL U63299(4619bp)
            Nunez,B.S. and Trant,J.M.
            Isolation of the cDNA encoding the interrenal form of cholesterol
            side chain cleavage cytochrome P450 of the southern stingray
            (Dasyatis americana).
            unpublished (1996)

CYP11A2     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP11A2     Fundulus heteroclitus (mummichog)
            78% to zebrafish CYP11A2, only 67% to zebrafisn CYP11A1

11B Subfamily

CYP11B1     human
            GenEMBL J05140 M32863 (1482bp) M32878 (2633bp) M32879 (1155bp)
            Mornet,E., Dupont,J., Vitek,A. and White,P.C.
            Characterization of two genes encoding human steroid 11-beta-
            hydroxylase (P-450-11-beta).
            J. Biol. Chem. 264, 20961-20967 (1989)

CYP11B1     human
            GenEMBL D16155 (156bp)
            Naiki,Y., Shizuta,Y., Kawamoto,T., Yasushiro,M., Miyahara,K., 
            Toda,K., Tadao,O. and Imura,H.
            A nonsense mutation (TGG(116Arg)-TAG(stop)) in CYP11B1 
            causes steroid 11beta-hydroxylase deficiency.
            J. Clin. Endocrinol. Metab. 77, 1677-1682 (1993)

CYP11B1     human 
            GenEMBL D10169 D90428 (2085bp)
            Kawamoto,T., Mitsuuchi,Y., Toda,K., Yokoyama,Y., Miyahara,K., 
            Miura,S., Ohnishi,T., Ichikawa,Y., Nakao,K., Imura,H., Ulick,S. 
            and Shizuta,Y.
            Role of steroid 11beta-hydroxylase and steroid 18-hydroxylase in the 
            biosynthesis of glucocorticoids and mineralocorticoids in humans.
            Proc. Natl. Acad. Sci. USA 89, 1458-1462 (1992)

CYP11B1     human
            PIR S29068 (30 amino acids)
            Kawamoto, T., Mitsuuchi, Y., Toda, K., Miyahara, K.,
            Yokoyama, Y., Nakao, K., Hosoda, K., Yamamoto, Y., Imura,
            H. and Shizuta, Y.
            Cloning of cDNA and genomic DNA for human cytochrome P-450
            FEBS Lett. 269, 345-349 (1990)

CYP11B1     Pan troglodytes (chimp)
            UCSC genome browser 141679462-141681482 (-) strand
            (N-term is in a seq gap), 3 aa diffs to human

CYP11B1     Papio hamadryas ursinus (chacma baboon)
            GenEMBL U52085(228bp)
            Hampf,M., Swart,A. and Swart,P.
            Expression of Papio ursinus steroid 11beta hydroxylase
            unpublished (1996)

CYP11B1     Papio hamadryas ursinus (chacma baboon)

CYP11B1   Canis familiaris (dog)
          73% to human 11B2, 72% to human 11B1

Cyp11b1     mouse
            PIR A41552 (500 amino acids)
            Domalik, L.J., Chaplin, D.D., Kirkman, M.S., Wu, R.C., Liu,
            W., Howard, T.A., Seldin, M.F., Parker, K.L.
            Different isozymes of mouse 11beta-hydroxylase produce
            mineralocorticoids and glucocorticoids.
            Mol. Endocrinol.  5, 1853-1861 (1991)

Cyp11b1     mouse
            PIR A32210 (42 amino acids)
            Mouw, A.R., Rice, D.A., Meade, J.C., Chua, S.C., White, P.C.,
            Schimmer, B.P. and Parker, K.L.
            Structural and functional analysis of the promoter region of
            the gene encoding mouse steroid 11beta-hydroxylase.
            J. Biol. Chem. 264, 1305-1309 (1989)

Cyp11b1     mouse
            GenEMBL J04451
            80% to mouse 11B2 64% to human 11B1 and 11B2 80% to 11B1 rat 
            78% to 11B2 rat. sequence below is from Ensembl mouse version 3 
15.75000001-76000000 mouse chr 15 add 75 million to get global location
304174 FNYTIE 304157 (?)
303858 SWDFISEYG 303826 (?)
301313 MLLLHH 301182 (?0)
300923 VLKSFHVETQEK 300888

CYP11B1    Mesocricetus auratus (hamster)
           SwissProt P97720

CYP11B1     rat
            GenEMBL D10107 (1528bp) S58847
            PIR B46040 (499 amino acids)
            Matsukawa,N., Nonaka,Y., Higaki,J., Nagano,M., Mikami,H.,
            Ogihara,T. and Okamoto,M.
            Dahl's salt-resistant normotensive rat has mutations in 
            cytochrome P450 (11 beta), but the salt-sensitive hypertensive
            rat does not.
            J. Biol. Chem. 268, 9117-9121 (1993)
            Note: only 1 amino acid difference with 11B1 at position 84
            E (normal) changed to G (seen in 11B2 and 11B3)
            D10107 has five differences with D11354

CYP11B1     rat
            GenEMBL S58858 (330bp) PIR JX0251(499 amino acids)
            Nomura,M., Morohashi, K.-i., Kirita, S., Nonaka, Y.,
            Okamoto,M., Nawata,H. and Omura,T.
            Three forms of rat CYP11B genes: 11 beta-hydroxylase gene,
            aldosterone synthase gene, and a novel gene.
            J. Biochem. 113, 144-152 (1993)
            Note: Fig. 3 has 6 errors. 1,2) aldo-46 amino acids 2 and 3 are
            incorrectly translated gctctc = AL not HS. 3) 11B3 codon at 559-561
            incorrectly translated gac = D not N. 4,5,6) 11beta-62, 11B1 
            and 11B3 codon at 964-966 tcc = Ser not Pro.

CYP11B1     rat
            GenEMBL S58849, D14086 to D14091 PIR A46039 (499 amino acids)
            Mukai,K., Imai,M., Shimada,H. and Ishimura,Y.
            Isolation and characterization of rat CYP11B genes involved
            in late steps of mineralo- and glucocorticoid syntheses.
            J. Biol. Chem. 268, 9130-9137 (1993)

CYP11B1     rat
            GenEMBL S63899 (596bp)
            Mukai,K., Imai,M., Shimada,H., Okada,Y., Ogishima,T. and
            Structural differences in 5'-flanking regions of rat cytochrome
            P-450aldo and P-450(11) beta genes
            Biochem. Biophys. Res. Commun. 180, 1187-1193 (1991)

CYP11B1     rat
            GenEMBL D11354 (1528bp) PIR A46040 (499 amino acids)
            Matsukawa,N., Nonaka,Y., Higaki,J., Nagano,M., Mikami,H.,
            Ogihara,T. and Okamoto,M.
            Dahl's salt-resistant normotensive rat has mutations in 
            cytochrome P450 (11 beta), but the salt-sensitive hypertensive
            rat does not.
            J. Biol. Chem. 268, 9117-9121 (1993)
            Note: This sequence is the wild type DS rat sequence.  The mutant 
            DR rat has five amino acids differences accession number D10107

CYP11B1     Cavia porcellus (guinea pig)
            GenEMBL Z69785(2028bp)
            Bulow,H.E., Mobius,K., Bahr,V. and Bernhardt,R.
            Molecular cloning and functional expression of the cytochrome P450
            11B-hydroxylase of the guinea pig.
            Biochem. Biophys. Res. Commun. 221, 304-312 (1996)

CYP11B1     bovine
            PIR JX0151 (503 amino acids)
            Kirita, S., Hashimoto, T., Kitajima, M., Honda, S.,
            Morohashi, K. and Omura, T.
            Structural analysis of multiple bovine P-450(11beta) genes
            and their promoter activities.
            J. Biochem. 108, 1030-1041 (1990)

CYP11B1     Bos taurus (cow)
            See cattle page for details

CYP11B1     pig
            GenEMBL D38590(1671bp)
            Sun,T., Zhao,Y., Nonaka,Y. and Okamoto,M.
            Cloning and expression of cytochrome P450(11 beta) of porcine
            adrenal cortex.
            J. Steroid Biochem. Mol. Biol. 52, 227-232 (1995)

CYP11B1     sheep
            GenEMBL L34337 (1639bp)
            Boon,W.C., Roche,P.J., Hammond,V.E., Jeyaseelan,K.,
            Crawford,R.J. and Coghlan,J.P.
            Cloning and expression analysis of a cytochrome P450-11-beta
            cDNA in sheep.
            unpublished (1994)

CYP11B1     Ovis aries (sheep)
            GenEMBL L28716 (2300bp)
            Anwar,A., Jeyaseelan,K. and Coghlan,J.P.
            Molecular cloning and characterization of the ovine CYP11B1 
            Biochem. Mol. Biol. Int. 33, 1169-1178 (1994)

CYP11B1     Ovis ammon (sheep)
            GenEMBL L47569(9027bp)
            Anwar,A., Jeyaseelan,K. and Coghlan,J.P.
            Characterization of an ovine 11-beta hydroxylase (cyp11b) gene.
            unpublished (1995)

CYP11B1     Xenopus tropicalis 
            54949_prot X. tropicalis predicted protein from UCSC browser
            trace archive 483095886 413360250 242989364 mate = 242988788
            584719101 584719005 234592190
            50% to 11B2 human 49% to 11B1
            scaffold_8238:179-3044 UCSC browser
            387238891 419638572 mate = 419631756
            93% to X. laevis CYP11B1, 76% to CYP11B2 Rana catesbeiana D10984
            NOTE: last exon corrected 8/29/2012

CYP11B1    Xenopus laevis (African clawed frog)
           SwissProt Q71ME8 extended with ESTs CF522102.1 CB559154.1
           Missing 143 aa at C-term

CYP11B1X    Danio rerio (zebrafish) 
            See zebrafish pages for seq
            Name revised to CYP11C1

CYP11B1X    Takifugu rubripes (fugu, Japanese pufferfish)
            Scaffold_9267 Length = 9352 
            cyp11 like N-TERMINAL exons 1 and 2
            Name revised to CYP11C1

CYP11B1X  Tetraodon nigroviridis (Green puffer)
          90% to CYP11B1 fugu
          Name revised to CYP11C1

CYP11B1v1X  Oncorhynchus mykiss (rainbow trout)
            Name revised to CYP11C1v1

CYP11B1v2X  Oncorhynchus mykiss (rainbow trout)
            Name revised to CYP11C1v2

CYP11B2     human
            GenEMBL J05140 M32864 (1809bp) M32880 (3088bp) M32881 (1101bp)
            Mornet,E., Dupont,J., Vitek,A. and White,P.C.
            Characterization of two genes encoding human steroid 11-beta-
            hydroxylase (P-450-11-beta).
            J. Biol. Chem. 264, 20961-20967 (1989)

CYP11B2     human
            GenEMBL D90429 D10170 (2114bp)
            Kawamoto,T., Mitsuuchi,Y., Toda,K., Yokoyama,Y., Miyahara,K., 
            Miura,S., Ohnishi,T., Ichikawa,Y., Nakao,K., Imura,H., Ulick,S. 
            and Shizuta,Y.
            Role of steroid 11beta-hydroxylase and steroid 18-hydroxylase in the 
            biosynthesis of glucocorticoids and mineralocorticoids in humans.
            Proc. Natl. Acad. Sci. USA 89, 1458-1462 (1992)

CYP11B2     human 
            GenEMBL D13752(6910bp)
            Kawamoto,T., Mitsuuchi,Y., Ohnishi,T., Ichikawa,Y., Yokoyama,Y.,
            Sumimoto,H., Toda,K., Miyahara,K., Kuribayashi,I., Nakao,K.,
            Hosoda,K., Yamamoto,Y., Imura,H. and Shizuta,Y.
            Cloning and expression of a cDNA for human cytochrome P-450aldo as
            related to primary aldosteronism.
            Biochem. Biophys. Res. Commun. 173 (1), 309-316 (1990)

CYP11B2     human
            GenEMBL S77398 S77401 S77403 S77406 S77409 (genomic sequences)
            Shizuta,Y., Kawamoto,T., Mitsuuchi,Y., Miyahara,K., Rosler,A.,
            Ulick,S. and Imura,H.
            Inborn errors of aldosterone biosynthesis in humans.
            Steroids 60 (1), 15-21 (1995)

CYP11B2     Pan troglodytes (chimpanzee)
            96% to human

CYP11B2     Bos taurus (cow)
            See cattle page for details

CYP11B2     Sus scrofa (pig) 
            ESTs CV872108.1, BI341717.1  
            93% to 11B1 pig

CYP11B2   Canis familiaris (dog)
          XM_846295.1 in a seq gap in the genome

CYP11B2     rat
            GenEMBL S58859 (353bp) PIR JX0252 (500 amino acids)
            Nomura,M., Morohashi, K.-i., Kirita, S., Nonaka, Y.,
            Okamoto,M., Nawata,H. and Omura,T.
            Three forms of rat CYP11B genes: 11 beta-hydroxylase gene,
            aldosterone synthase gene, and a novel gene.
            J. Biochem. 113, 144-152 (1993)

CYP11B2     rat
            GenEMBL S58850 D14092 to D14097
            PIR B46039 (500 amino acids)
            Mukai,K., Imai,M., Shimada,H. and Ishimura,Y.
            Isolation and characterization of rat CYP11B genes involved
            in late steps of mineralo- and glucocorticoid syntheses.
            J. Biol. Chem. 268, 9130-9137 (1993)

CYP11B2     rat
            GenEMBL S63898 (594bp)
            Mukai,K., Imai,M., Shimada,H., Okada,Y., Ogishima,T. and Ishimura,Y.
            Structural differences in 5'-flanking regions of rat cytochrome
            P-450aldo and P-450(11) beta genes.
            Biochem. Biophys. Res. Commun. 180, 1187-1193 (1991)

CYP11B2     rat
            GenEMBL S64136 (3001bp) PIR JN0615 (506 amino acids)
            GenEMBL U14908 (3000bp)
            Zhou,M. and Gomez-Sanchez,C.E.
            Cloning and expression of a rat cytochrome P-450 11
            beta-hydroxylase/aldosterone synthase (CYP11B2) cDNA variant.
            Biochem. Biophys. Res. Commun. 194, 112-117 (1993)
            Erratum: Biochem. Biophys. Res. Commun. 196, 1018 (1993)

CYP11B2     rat
            PIR A34281 (20 amino acids) Swiss P30099 (510 amino acids)
            Ogishima, T., Mitani, F., Ishimura, Y.
            Isolation of aldosterone synthase cytochrome P-450 from zona
            glomerulosa mitochondria of rat adrenal cortex.
            J. Biol. Chem.  264, 10935-10938 (1989)
            Note: sequence is from N-terminal after signal sequence

CYP11B2     rat
            Swiss P30099 (510 amino acids) GenEMBL D00567 (2824bp)
            Swiss P30100 (500 amino acids) GenEMBL D00568 (2705bp)
            Matsukawa,N., Nonaka,Y., Ying,Z., Higaki,J., Ogihara,T. and
            Molecular cloning and expression of cDNAs encoding rat aldosterone
            synthase: variants of cytochrome P-450 11beta
            Biochem. Biophys. Res. Commun. 169, 245-252 (1990)

CYP11B2     hamster
            GenEMBL S73810 (1503bp)
            LeHoux,J.G., Mason,J.I., Bernard,H., Ducharme,L., LeHoux,J.,
            Veronneau,S. and Lefebvre,A.
            The presence of two cytochrome P450 aldosterone synthase mRNAs in
            the hamster adrenal.
            J. Steroid Biochem. Mol. Biol. 49, 131-137 (1994)

CYP11B2     Cavia porcellus (domestic guinea pig)
            GenEMBL   AF018569
            Buelow,H.E. and Bernhardt,R.
            Molecular Cloning and Functional Expression of the Guinea Pig
            Aldosterone Synthase.

CYP11B2     Rana catesbeiana (bullfrog)
            GenEMBL D10984 (1919bp)
            Nonaka,Y., Takemori,H., Halder,S.K., Sun,T., Ohta,M., Hatano,O., 
            Takakusa,A. and Okamoto,M.
            Frog Cytochrome P-450 (11 beta, aldo), a single enzyme involved in 
            the final steps 
            of glucocorticoid and mineralocorticoid biosynthesis.
            Eur. J. Biochem. 229, 249-256 (1995)

Cyp11b2     mouse
            GenEMBL S85260 (2804bp)
            Domalik,L.J., Chaplin,D.D., Kirkman,M.S., Wu,R.C., Liu,W.W.,
            Howard,T.A., Seldin,M.F. and Parker,K.L.
            Different isozymes of mouse 11 beta-hydroxylase produce
            mineralocorticoids and glucocorticoids.
            Mol. Endocrinol. 5, 1853-1861 (1991)

Cyp11b2     mouse
            genEMBL S85260 
            68% to human 11B2 67% to human 11b1 94% to 11B2 rat 81% to 11B1 rat
            sequence below is from Ensembl mouse version 3
15.75000001-76000000 mouse chr 15 add 75million to get global location
318761 DVQQSLFNYTIE 318606 (?)
318003 NSMELTAGSVDT 317848 (?)

CYP11B3     rat
            PIR JX0253 (498 amino acids)
            Nomura,M., Morohashi, K.-i., Kirita, S., Nonaka, Y.,
            Okamoto,M., Nawata,H. and Omura,T.
            Three forms of rat CYP11B genes: 11 beta-hydroxylase gene,
            aldosterone synthase gene, and a novel gene.
            J. Biochem. 113, 144-152 (1993)

CYP11B3     rat
            GenEMBL U14907 (1497bp)
            Zhou,M., Gomez-Sanchez,E.P., Foecking,M. and Gomez-Sanchez,C.E.
            Cloning of the cytochrome P-450 CYP11B3 complementary DNA in the

CYP11B3     rat
            GenEMBL S59144 D14098 to D14103
            Mukai,K., Imai,M., Shimada,H. and Ishimura,Y.
            Isolation and characterization of rat CYP11B genes involved
            in late steps of mineralo- and glucocorticoid syntheses.
            J. Biol. Chem. 268, 9130-9137 (1993)
            Note: only one amino acid difference with Nomura's 11B3

CYP11B3     rat
            GenEMBL U17082(1497bp)
            Mellon,S.H., Bair,S.R. and Monis,H.
            P450c11B3 mRNA, transcribed from a third P450c11 gene, is expressed
            in a tissue-specific, developmentally, and hormonally regulated
            fashion in the rodent adrenal and encodes a protein with both
            11-hydroxylase and 18-hydroxylase activities.
            J. Biol. Chem. 270, 1643-1649 (1995)

Note Genbank has a seq from rat named CYP11B4 D14108
     This is part of the CYP11B8P pseudogene (see below)

CYP11B4     cattle 
            Kirita et al. 1990 J. Biochem (Tokyo) 108, 1030-1041.
            Listed in 1996 nomenclature update
            As having the same coding region sequence
            But different flanking regions

CYP11B5P    cattle
            GenEMBL JU0316
            Kirita et al. 1990 J. Biochem (Tokyo) 108, 1030-1041.
            CB11beta-1 pseudogene

CYP11B6P    cattle
            GenEMBL JU0317
            Kirita et al. 1990 J. Biochem (Tokyo) 108, 1030-1041.
            CB11beta-3 pseudogene

CYP11B7P    cattle
            GenEMBL JU0318, D00458, D00459
            Hashimoto et al. 1989 J. Biochem (Tokyo) 105, 676-679.
            LambdaB11beta(15-1) and (15-2)
            Kirita et al. 1990 J. Biochem (Tokyo) 108, 1030-1041.
            CB11beta-21 pseudogene

CYP11B8P    rat pseudogene
            GenEMBL D14104 to D14108
            Mukai,K., Imai,M., Shimada,H. and Ishimura,Y.
            Isolation and characterization of rat CYP11B genes involved
            in late steps of mineralo- and glucocorticoid syntheses.
            J. Biol. Chem. 268, 9130-9137 (1993)
            Note: authors call this sequence 11B4

CYP11C1     Danio rerio (zebrafish) 
            See zebrafish pages for seq
            Name revised to CYP11C1

CYP11C1     Takifugu rubripes (fugu, Japanese pufferfish)
            Scaffold_9267 Length = 9352 
            cyp11 like N-TERMINAL exons 1 and 2
            Name revised from CYP11B1

CYP11C1   Tetraodon nigroviridis (Green puffer)
          90% to CYP11B1 fugu
          Name revised from CYP11B1

CYP11C1v1  Oncorhynchus mykiss (rainbow trout)
            Name revised from CYP11B1v1

CYP11C1v2   Oncorhynchus mykiss (rainbow trout)
            Name revised from CYP11B1v2

12A Subfamily

CYP12A1       Musca domestica (housefly)
            GenEMBL U86618
            Rene Feyereisen

CYP12A2       Musca domestica (housefly)
            GenEMBL U94698
            Rene Feyereisen

CYP12A3       Musca domestica (housefly)
            GenEMBL U94699
            Rene Feyereisen

cyp12a4 Drosophila melanogaster
            GenEMBL AC006091 85973-87865 also AC015190 AC008141
            chromosome 3 clone BACR48G05 (D475)

Cyp12a4     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

cyp12a5 Drosophila melanogaster
              GenEMBL AC006091 83449-85296 also AC015190 AC008141 
              chromosome 3 clone BACR48G05 (D475)
              76% identical to other AC006091 SEQ. 58% TO 12A1, 12A2

Cyp12a5     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP12A6     Drosophila wassermani
            no accession number
            Tina Yee and Phil Danielson
            59% to 12A2 56% to 12A1
            N-terminal does not match known P450 sequences may be in error

CYP12A7     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            revised to full length June 27, 2005
            Clone name Lc_CYP12A2 
            59% to 12A5 

CYP12A8     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            Clone name Lc_CYP12A1 
            60% to 12A5 67% to 12A7 (365 aa)

CYP12A9     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            Revised seq Dec 12, 2007
            Old Clone name Lc_CYP12A3 
            New clone name Luce0104J9 (408 aa)
            74% identical to Musca Domestica CYP12A2
            only 1 aa diff to earlier shorter version

CYP12A10    Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            Clone name Lc_CYP12A4 
            57% to 12A4 65% to 129A9 (126 aa)

CYP12A11    Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Luce0102F03
            62% identical to CYP12A2 and 57% identical to Dm CYP12a5, 
            63% to 12A7, 72% to 12A8 partial seq, 64% to 12A9 partial, 
            67% to 12A10 partial seq.

12B Subfamily

CYP12B1     Drosophila acanthoptera
            no accession number
            Phil Danielson
            submitted to nomenclature committee

Cyp12b2     Drosophila melanogaster
            GenEMBL AC018326 7227-9141 also AC004345 AC004657
            77% identical to 12b1

Cyp12b2     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp12c1     Drosophila melanogaster
            GenEMBL AC009385 comp(57935-59646) also AC012807

Cyp12c1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP12C2     Bactrocera orientalis (oriental fruit fly)
            No accession number
            Yong Huang
            Submitted to nomenclature committee March 16, 2012
            54% to Cyp12c1 Drosophila melanogaster

Cyp12d1     Drosophila melanogaster
            GenEMBL AC008187 comp(84371-86114)

Cyp12d1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP12D2     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Lce0054K20 
            53% identity to Dm CYP12d1 
            probable ortholog of Cyp12d1

Cyp12e1     Drosophila melanogaster
            GenEMBL AC018294 2070-3932

Cyp12e1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP12F1     Anopheles gambiae (malaria vector)
            No accession number
            Submitted by Rene Feyereisen July 5, 2002
            Low 40% range with other CYP12s 60% to 12F2

CYP12F1     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPl3r4

CYP12F2     Anopheles gambiae (malaria vector)
            No accession number
            Submitted by Rene Feyereisen July 5, 2002
            Low 40% range with other CYP12s 60% to 12F1

CYP12F2     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPl3r3

CYP12F3     Anopheles gambiae (malaria vector)
            No accession number
            Submitted by Rene Feyereisen July 5, 2002
            Low 40% range with other CYP12s 60% to 12F2

CYP12F3     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPl3r2

CYP12F4     Anopheles gambiae (malaria vector)
            No accession number
            Submitted by Rene Feyereisen July 5, 2002
            Low 40% range with other CYP12s 55% to 12F2

CYP12F4     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPl3r1

CYP12F5     Aedes aegypti (yellow fever mosquito)

CYP12F6     Aedes aegypti (yellow fever mosquito)

CYP12F7     Aedes aegypti (yellow fever mosquito)

CYP12F8     Aedes aegypti (yellow fever mosquito)

CYP12F9    Culex_quinquefasciatus (southern house mosquito)
           No accession number
           Osamu Komagata
           submitted to nomenclature committee 7/25/07
           sequence 15
           68% to 12F7 Aedes, 60% to 12F2

CYP12F9    Culex pipiens

CYP12F10   Culex pipiens

CYP12F11   Culex pipiens

CYP12F12   Culex pipiens

CYP12F13   Culex pipiens

CYP12F14   Culex pipiens

CYP12G1     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            Clone name Lc_CYP12C 
            51% to 12C1 (310 aa)

CYP12H1     Tribolium castaneum (red flour beetle)
            GenEMBL XP_966937, DT790363.1 EST
            37% to 12c1, 38% to 12A4 mito clan, 42% to 12F2

CYP12H2 part 1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 11
           47% to CYP12H1 Tribolium castaneum

CYP12H2 part 2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 27
           48% to CYP12H1 Tribolium castaneum
           C-helix to middle

CYP12H3    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011

CYP12H3    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           100% to CYP12H3 Leptinotarsa
           partial seq.

CYP12J1     Leptinotarsa decemlineata (Colorado potato beetle)
            No accession number
            Jianhua Zhang
            Submitted to nomenclature committee April 2, 2006
            Clone name P12F5113
            59 amino acids from heme to end
            42% to 12A4, 57% to CYP12H1 XP_966937 
            5 aa diffs to CYP12J2
            58% to XM_961844.1 PREDICTED: Tribolium castaneum 
            37% to 12c1, 38% to 12A4, 42% to 12f2

CYP12J2     Leptinotarsa decemlineata (Colorado potato beetle)
            No accession number
            Jianhua Zhang
            Submitted to nomenclature committee April 2, 2006
            Clone name P12F231134
            59 amino acids from heme to end
            43% to 12A4, 57% to CYP12H1 XP_966937 91% to 12J1

CYP12J3     Ips pini (pine engraver, bark beetle)
            No accession number
            Pamela Sandstrom
            Submitted to nomenclature committee on April 26, 2006
            Full length sequence
            60% to 12J1 Colorado potato beetle (C-term piece)
            44% to 12H1 Tribolium castaneum
            clone name EST 28H12

CYP12J4    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 7
           90% to CYP12J1 Leptinotarsa decemlineata
           heme region

CYP12J5 part 1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 1
           80% to CYP12J4 Leptinotarsa decemlineata
           PKG to PERF region

CYP12J5 part 2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 31
           80% to CYP12J4 Leptinotarsa decemlineata

CYP12K1    Nasonia vitripennis (jewel wasp)
           See wasp page

CYP12K1    Linepithema humile (argentine ant)
           No accession number
CYP12K1    Solenopsis invicta (fire ant)
           See Solenopsis page
           69% to CYP12K1 Linepithema humile

CYP12K1     Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            66% to CYP12K1 Linepithema humile

CYP12K2     Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            56% to CYP12K1 Linepithema humile

CYP12L1     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Luce0117K18 
            46% identical to M. domestica CYP12A2

CYP12M1    Chironomus tentans (aquatic midge)
           No accession number
           Kun Yan Zhu
           Submitted to nomenclature committee May 31, 2011
           45% to CYP12F2 Culex pipiens

CYP12N1     Bactrocera orientalis (oriental fruit fly)
            No accession number
            Yong Huang
            Submitted to nomenclature committee March 16, 2012
            52% to Cyp12e1 Drosophila pseudoobscura

13B Subfamily

CYP13B1    Caenorhabditis elegans (nematode worm)
           GenEMBL Z54269 (19692bp) and Z92827 (C29F7)
           F02C12.5 also C29F7 has the end of this sequence
           Formerly CYP16A1 but renamed after full length sequence 
           sorted with CYP13

CYP13B2    Caenorhabditis elegans (nematode worm)
           GenEMBL  Z81565

CYP13B2    Caenorhabditis briggsae ortholog
           XP_002645617.1 76% TO CYP13B2 70% to CYP13B1 

CYP13B4    Caenorhabditis briggsae 
           XP_002645615.1 chrX:17263374-17267448 (+)

14A Subfamily

CYP14A1    Caenorhabditis elegans (nematode worm)
            GenEMBL Z50742 (20856bp)
            Wilson,R., Ainscough,R., Anderson,K., Baynes,C., Berks,M.,
            Bonfield,J., Burton,J., Connell,M., Copsey,T., Cooper,J.,
            Coulson,A., Craxton,M., Dear,S., Du,Z., Durbin,R., Favello,A.,
            Fulton,L., Gardner,A., Green,P., Hawkins,T., Hillier,L., Jier,M.,
            Johnston,L., Jones,M., Kershaw,J., Kirsten,J., Laister,N.,
            Latreille,P., Lightning,J., Lloyd,C., McMurray,A., Mortimore,B.,
            O'Callaghan,M., Parsons,J., Percy,C., Rifken,L., Roopra,A.,
            Saunders,D., Shownkeen,R., Smaldon,N., Smith,A., Sonnhammer,E.,
            Staden,R., Sulston,J., Thierry-Mieg,J., Thomas,K., Vaudin,M.,
            Vaughan,K., Waterston,R., Watson,A., Weinstock,L.,
            Wilkinson-Sproat,J. and Wohldman,P.
            2.2 Mb of contiguous nucleotide sequence from chromosome III of C.
            Nature 368 (6466), 32-38 (1994)

CYP14A1     Caenorhabditis briggsae ortholog
            XP_002645575.1 85% to CYP14A1 

CYP14A2    Caenorhabditis elegans (nematode worm)
            GenEMBL Z50742 (20856bp)
            see CYP14A1 for reference.

CYP14A3    Caenorhabditis elegans (nematode worm)
            GenEMBL Z50742 (20856bp)
            see CYP14A1 for reference.

CYP14A4    Caenorhabditis elegans (nematode worm)
            GenEMBL Z50742 (20856bp) Z70212(R04D3.1 continuation of Z50742)
            see CYP14A1 for reference.
            after K09A11.5
            partial sequence at end of cosmid continues on cosmid R04D3

CYP14A4    Caenorhabditis briggsae ortholog
           XP_002645581.1 X - 17002025-17004199

CYP14A5     Caenorhabditis elegans (nematode worm)
            GenEMBL U64847

CYP14A6    Caenorhabditis briggsae 
           XP_002636088.1 V + 4415831-4417561

CYP14A6-de6b    Caenorhabditis briggsae 
                V + 4420005-4420127

CYP14A7P    Caenorhabditis briggsae 
            XP_002645576.1 X - 16978293-16979463

CYP14A8P     Caenorhabditis briggsae 
             XP_002645579.1 X - 16995892-16996323

CYP14A9 Caenorhabditis briggsae XP_002645579.1 X - 16996539-16998309

CYP14A10    Caenorhabditis briggsae 
            XP_002645580.1 X - 16999284-17001021

CYP15A1     Diploptera punctata (cockroach)
            GenEMBL AY509244
            Helvig,C., Koener,J.F., Unnithan,G.C. and Feyereisen,R.
            CYP15A1, the cytochrome P450 that catalyzes epoxidation of methyl
            farnesoate to juvenile hormone III in cockroach corpora allata

CYP15A1     Tribolium castaneum (red flour beetle)
            GenEMBL XP_970303
            44% to CYP15B1 Anopheles, 48% to CYP15B1 Aedes
            note: CYP15A1, B1 and C1 are all probably orthologs.  
            Each species seems to have only a single CYP15.

CYP15A1     Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            59% to CYP15A1 Tribolium castaneum

CYP15A1     Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph15, 49% to 15A1 Tribolium
            Pediculus genome site

CYP15A1    Apis mellifera (honeybee)

CYP15A1    Nasonia vitripennis (jewel wasp)
           See wasp page

CYP15A1    Linepithema humile (argentine ant)
           No accession number
CYP15A1    Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           73% to CYP15A1 Linepithema humile

CYP15A1    Solenopsis invicta (fire ant)
           See Solenopsis page
           72% to CYP15A1 Linepithema humile

CYP15A1    Pogonomyrmex barbatus (seed-harvester ant)
           No accession number
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           75% to CYP15A1 Linepithema humile

CYP15A1    Reticulitermes flavipes (termite)
           No accession number
           Michael Scharf
           Submitted to nomenclature committee Feb. 19, 2009
           Clone name RfCyp15A1-2
           69% to Diploptera punctata CYP15A1
           58% to CYP15A1 Tribolium, 48% to 15B1 Anopheles

CYP15A1    Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           53% to CYP15A1 Pediculus humanus, C-term

CYP15A1    Coptotermes formosanus (Formosan subterranean termite)
           No accession number 
           Matt Tarver
           Submitted to nomenclature committee Sept. 8, 2011
           93% to CYP15A1 Reticulitermes flavipes

CYP15A1    Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           3 disconnected pieces 60% to CYP15A1 Acyrthosiphon pisum

CYP15A1    Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           49% to CYP15A1 Tribolium, 51% to CYP15A1 Diploptera puncatata
           52% to CYP15A1 Reticulitermes flavipes
           CYP2 clan

CYP15A2P   Acyrthosiphon pisum (pea aphid)
           LOC100169165  whose N-term 100 or so aa are wrong
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           49% to CYP15A1 Tribolium
           87% to CYP15A1 aphid
           missing N-term exon, revised middle
           Since the rest of the protein is so conserved (87%), the N-term exon 
           seems to be gone.  Therefore this is probably a pseudogene.
           CYP2 clan

CYP15A3P   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           44% to CYP15A1 Tribolium, 79% to CYP15A1 aphid
           middle region revised
           missing N-term exon
           Since the rest of the protein is so conserved (79%), the N-term exon 
           seems to be gone.  Therefore this is probably a pseudogene.
           CYP2 clan

CYP15B1     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPj2l3
            47% identical to 15A1, though this is probably the ortholog of CYP15A1

CYP15B1    Aedes aegypti (yellow fever mosquito)

CYP15B1    Culex pipiens quinquefasciatus (southern house mosquito)
           72% to CYP15B1 Aedes aegypti

CYP15B1    Culex pipiens

CYP15C1    Bombyx mori (silkworm)
           BAAB01071346.1 BAAB01157546.1 BAAB01036905.1 BAAB01022841.1 
           40% to CYP15
           note: CYP15A1, B1 and C1 are all probably orthologs.  Each species
           seems to only have a single CYP15.  (not found in Drosophila)
           See silkworm page for sequence

CYP15C1    Heliconius melpomene (common postman butterfly)
           No accession number
           Ritika Chauhan and Richard ffrench-Constant
           Submitted to nomenclature committee June 2, 2011

CYP15C1    Plutella xylostella 
           Gene number CCG011481.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           60% to CYP15C1 Bombyx mori

CYP15D1X   Daphnia pulex (water flea)
           renamed CYP370A1

CYP15D2X   Daphnia pulex (water flea)
           renamed CYP370A2

CYP15D3PX  Daphnia pulex (water flea)
           renamed CYP370A3P

CYP15D4X   Daphnia pulex (water flea)
           renamed CYP370A4

CYP15D5X   Daphnia pulex (water flea)
           renamed CYP370A5

CYP15D6X   Daphnia pulex (water flea)
           renamed CYP370A6

CYP15D7X   Daphnia pulex (water flea)
           renamed CYP370A7

CYP15D8X   Daphnia pulex (water flea)
           renamed CYP370A8

CYP15D9X   Daphnia pulex (water flea)
           renamed CYP370A9

CYP15D10X  Daphnia pulex (water flea)
           renamed CYP370A10

CYP15D11X  Daphnia pulex (water flea)
           renamed CYP370A11

CYP15D12X  Daphnia pulex (water flea)
           renamed CYP370A12

CYP15D13X  Daphnia pulex (water flea)
           renamed CYP370A13

CYP15E1X   Daphnia pulex (water flea)
           renamed CYP370B1

CYP15E2X   Daphnia pulex (water flea)
           renamed CYP370B2

CYP15F1    Reticulitermes flavipes (termite)
           No accession number
           Michael Scharf
           Submitted to nomenclature committee Feb. 19, 2009
           Clone name RfCyp15A1-1
           43% to CYP15A1 Tribolium, 38% TO CYP15B1 Anopheles

CYP15F1    Coptotermes formosanus (Formosan subterranean termite)
           No accession number 
           Matt Tarver
           Submitted to nomenclature committee Sept. 8, 2011
           83% to CYP15F1 Reticulitermes flavipes
           presumed ortholog

CYP15F2    Coptotermes formosanus (Formosan subterranean termite)
           No accession number
           Zhou Xue-hai
           Submitted to nomenclature committee March 30, 2013
           54% to CYP15F1 Coptotermes formosanus
           53% to CYP15F1 Reticulitermes flavipes

16A Subfamily

CYP16A1X    Caenorhabditis elegans (nematode worm)
            GenEMBL Z54269 
            number retired
            This sequence is now CYP13B1

CYP16A1   Tetraodon nigroviridis (Green puffer)
          EMBL CAAE01014752; GenPept CAG04908.1 
          CYP26 clan new P450 family in vertebrates
          NEARBY SEQS: (seq -1) 5-hydroxytryptamine receptor 4-like (HTR4)
          (seq +1) dual specificity phosphatase 4 (dusp4)
          That is unmarked from 15.72-15.835 Mb Ensembl numbering
          21.42-21.52 Mb on Zv8 UCSC browser (blastx shows no P450 in this region)
          Danio has lost this gene

CYP16A1    Takifugu rubripes (fugu)
           Fugu also has this gene next to HTR4
           88% to Tetraodon nigroviridis

CYP16A1    Oryzias latipes 
           EST AM345752.1 N-term 148 aa
           Genomic region between DUSP4 and HTR4

CYP16A1     Gasterosteus aculeatus (three-spined stickleback)
            chrXIV:9154271-9168725 UCSC browser

CYP16A1   Squalus acanthias (dogfish) Dogfish Shark 
          Rectal Gland EST EG360444.1
          51% to Tetraodon CYP26 seq N-term

CYP16B1   Branchiostoma floridae (amphioxus)
          EST FE555348, 
          In genome near HTR4
          note this gene has one extra intron in exon 6
          45% to stickleback CYP16A1

CYP16C1    Saccoglossus kowalevskii
           ESTS FF475723.1, FF439894.1, FF465259.1
           CYP26 clan
           beach area of Waquoit Pond near Woods Hole, MA
           45% to CYP16B1 branchiostoma

CYP16D1   Nematostella vectensis (starlet sea anemone, Cnidarian)
          ABAV01025394 C-term exon
          ESTs FC299001.1, FC299002.1
          45% to CYP16C1 Saccoglossus kowalevskii,
          42% to Branchistoma CYP16B1, 40% to CYP16A1 fish

CYP16E1   Molgula tectiformis (anural ascidian)
          ESTs CJ343788.1, CJ333781.1
          43% to CYP16G1, 42% to CYP16A1 fugu

CYP16F1   Strongylocentrotus purpuratus (purple sea urchin)
          EST BG786093, N-term from UCSC Browser
          80% to CYP16F2, 48% to CYP16C1



CYP16F2   Paracentrotus lividus (sea urchin)
          EST AM505877.1
          80% to CYP16F1, 46% to CYP16C1, 44% to CYP16D1

CYP16G1   Ciona intestinalis 
          SEQUENCE 180 on the sea squirt page
          45% to CYP16B1, 45% to CYP16E1 

CYP16G2   Ciona savignyi
          paired_scaffold_186 ortholog of seq 180 
          70% to CYP16G1

17A Subfamily

CYP17       human
            GenEMBL M14564
            Chung,B.C., Picado-Leonard,J., Haniu,M., Bienkowski,M., Hall,P.F.,
            Shively,J.E. and Miller,W.L. (1987)
            Cytochrome P450c17 (steroid 17 alpha-hydroxylase/17,20 lyase):
            cloning of human adrenal and testis cDNAs indicates the same gene
            is expressed in both tissues
            Proc. Natl. Acad. Sci. U.S.A. 84, 407-411.
            First human CYP17A1 cDNA

CYP17       human
            GenEMBL M19489
            Picado-Leonard J, Miller WL. (1987) Cloning and sequence of the human 
            gene for P450c17 (steroid 17 alpha-hydroxylase/17,20 lyase): 
            similarity with the gene for P450c21.
            DNA. 6. 439-448.
            First human CYP17A1 gene

CYP17       human
            GenEMBL NM_000102

CYP17       human EST
            GenEMBL Z19875 (235bp)
            UK-HGMP (United Kingdom human genome mapping project)
            covers amino acids 270-348 when translating the complementary
            strand.  The fragment goes through at least 6 frame shifts.
            sequence ID AAAAWEO

CYP17       human EST
            GenEMBL Z20209 (248bp)
            UK-HGMP (United Kingdom human genome mapping project)
            covers amino acids 265-349 when translating the complementary
            strand.  The fragment goes through at least 8 frame shifts.
            sequence ID AAABPSZ

CYP17       human
            GenEMBL S85459 (556bp)
            Biason,A., Mantero,F., Scaroni,C., Simpson,E.R. and Waterman,M.R.
            Deletion within the CYP17 gene together with insertion of foreign
            DNA is the cause of combined complete 17
            alpha-hydroxylase/17,20-lyase deficiency in an Italian patient
            Mol. Endocrinol. 5, 2037-2045 (1991)

CYP17A1     Pan troglodytes (chimp)

CYP17A1     Macaca mulatta (rhesus monkey)

CYP17A1     Macaca fasicularis (cynomolgus monkey)
            Yasuhiro Uno
            Submitted to nomenclature committee 1/11/2005
            Clone name mfCYP17A1
            94% to human, missing first 9 aa

CYP17A1     Papio hamadryas ursinus (chacma baboon)
            AY034635, AF297650

CYP17A1   Papio cynocephalus (yellow baboon)

CYP17A1     Canis familiaris (dog)
            78% to CYP17A1 human

CYP17       rat
            PIR A31359 (507 amino acids)
            Namiki, M., Kitamura, M., Buczko, E. and Dufau, M.L.
            Rat testis P-450-17-alpha cDNA: the deduced amino acid
            sequence, expression and secondary structural configuration.
            Biochem. Biophys. Res. Commun. 157, 705-712 (1988)

CYP17       rat
            PIR D41425 (16 amino acids)
            Imaoka, S., Kamataki, T. and Funae, Y.
            Purification and characterization of six cytochromes P-450
            from hepatic microsomes of immature female rats.
            J. Biochem. 102, 843-851 (1987)

CYP17       rat
            GenEMBL S50146 Z11902 (3345bp)
            PIR S20655 (97 amino acids) 
            Nason,T.F., Han,X.G. and Hall,P.F.
            Cyclic AMP regulates expression of the rat gene for steroid
            17 alpha-hydroxylase/C17-20 lyase P-450 (CYP17) in rat Leydig
            Biochim. Biophys Acta 1171, 73-80 (1992)
            Note: have not been able to download S50146 from GCG or NCBI.

CYP17       rat
            GenEMBL X69816 (7556bp)
            Givens,C.R., Zhang,P., Bair,S.R. and Mellon,S.H.
            Transcriptional regulation of rat cytochrome P450c17 expression in
            mouse Leydig MA-10 and adrenal Y-1 cells: identification of a
            single protein that mediates both basal and cAMP-induced activities.
            DNA Cell Biol. 13, 1087-1098 (1994)

CYP17       rat
            PIR S24316 (97 amino acids)
            Zhang, P., Nason, T.F., Han, X.G. and Hall, P.F.
            Gene for 17-alpha-hydroxylase/C(17-20) lyase P-450: complete
            nucleotide sequence of the porcine gene and 5' upstream
            sequence of the rat gene.
            Biochim. Biophys. Acta 1131, 345-348 (1992)

Cyp17       mouse
            genEMBL M64863 AC079419.1 Mm.1262

CYP17       hamster
            no accession number
            Cloutier,M., Fleury,A., Courtemanche,J., Ducharme,L.
            Mason,J.I. and Lehoux,J.G.
            Cloning and expression of hamster adrenal cytochrome P450c17 cDNA.
            Ann. N.Y. Acad. Sci. 774, 294-296 (1995)

CYP17       Cavia (guinea pig)
            GenEMBL S75277(1732bp)
            Tremblay,Y., Fleury,A., Beaudoin,C., Vallee,M. and Belanger,A.
            Molecular cloning and expression of guinea pig cytochrome P450c17
            cDNA (steroid 17 alpha-hydroxylase/17,20 lyase): tissue
            distribution, regulation, and substrate specificity of the
            expressed enzyme.
            DNA Cell Biol. 13 (12), 1199-1212 (1994)

CYP17       Cavia porcellus (guinea pig)
            PIR S52756 (508 amino acids)
            Huang,Y., Voigt,J.M. and Colby,H.D.

CYP17       pig
            GenEMBL Z11854 to Z11856 GenEMBL S40341 (1858bp)
            PIR S24233 (501 amino acids) PIR S30074 (501 amino acids)
            Zhang,P. Nason,T.F., Han,X.G. and Hall,P.F.
            Gene for 17 alpha-hydroxylasae/C(17-20) lyase P-450: complete
            nucleotide sequence of the porcine gene and 5' upstream sequence of
            the rat gene.
            Biochim. Biophys. Acta 1131, 345-348 (1992)

CYP17A1     Capra hircus (goat)

CYP17       Sus scrofa (pig)
            GenEMBL U41519 to U41525 
            Conley,A.J., Graham-Lorence,S.E., Kagimoto,M., Lorence,M.C.,
            Murry,B.A., Oka,K., Sanders,D. and Mason,J.I.
            Nucleotide sequence of a cDNA encoding porcine testis 17
            alpha-hydroxylase cytochrome P-450.
            Biochim. Biophys. Acta 1130, 75-77 (1992)

CYP17       bovine
            GenEMBL M64646 (1725bp)
            Zuber,M.X., John,M.E., Okamura,T., Simpson,E.R. and Waterman,M.R.
            Bovine adrenocortical cytochrome P-450-17-alpha: Regulation of gene
            expression by ACTH and elucidation of primary sequence
            J. Biol. Chem. 261, 2475-2482 (1986)

CYP17A1     Bos taurus (cow)
            See cattle page for details

CYP17       Ovis aries (sheep)
            GenEMBL L40335 (1728bp)
            Murry,B.A., Swart,P. and Mason,J.I.
            Cloning and expression of ovine cytochrome P-450 17-alpha
            hydroxylase/c17-20 lyase.
            Unpublished (1995)

CYP17       Equus caballus (horse)
            GenEMBL D30688(1906bp) D13818 
            Hasegawa,T., Mukoyama,H., Yoshida,S. and Takahashi,M.
            Molecular cloning and nucleotide sequence of equine testicular
            cytochrome P-450 steroid 17alpha-hydroxylase/C17,20-lyase messenger
            ribonucleic acid.
            Biol. Reprod. Mono. 1, 615-622 (1995)

CYP17       Equus caballus (horse)
            GenEMBL D88184(6217bp)
            Exon/Intron structure of Equine P450c17.
            unpublished (1996)

CYP17A1     Gallus gallus (chicken)

CYP17A1     Coturnix japonica (Japanese quail)

CYP17A1    Alligator mississippiensis (American alligator)

CYP17A1     Xenopus tropicalis 
            CX931022 DR883840.1 CX957932.1 
            50% to CYP17A1 human

CYP17    Xenopus laevis (African clawed frog)
         AF325435 AW639059 bl78a09.w1 AW634003 bl14g07.w1 AW638539 bl71c05.w1
         AW639868 bl88e07.w1 AW640378 bl94e08.w1 AW640811 bl99b10.w1
         BE131888 db39e04.y1 BE131756 db35g03.y1 BG363813 dc94b02.y1
         BE027018 db35h02.x1 BF048873 db80d06.y1 BE027013 db35g03.x11871
         SwissProt Q9DDJ5, Q5BL89

CYP17A1     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP17A1     Fugu rubripes (pufferfish)
            LPC12298.x1 Scaffold_2373
            80% to Oryzias latipes 17, 79% to trout 17 73% to catfish 
            61% to dogfish 48% to other CYP17 from Fugu

CYP17A1     Tetraodon nigroviridis (Green puffer)
            lower case is from fugu, 
            ~91% to fugu CYP17A1
rrgdaefeamlhysqgivdtvakdslvdifpclq (0)

CYP17A1-de6b7b8b   Tetraodon nigroviridis (Green puffer)
            downstream of CYP17A1

CYP17       Oncorhynchus mykiss (rainbow trout)
            GenEMBL S50356
            Sakai,N., Tanaka,M., Adachi,S., Miller,W.L. and Nagahama,Y.
            Rainbow trout cytochrome P-450c17 (17 alpha-hydroxylase/17-20
            lyase) cDNA cloning, enzymatic properties and temporal pattern of 
            ovarian P-450c17 mRNA expression during oogenesis.
            FEBS Lett. 301, 60-64 (1992)
            Identical to X65800

CYP17       Oncorhynchus mykiss (rainbow trout)
            GenEMBL X65800 (2287bp) Swiss P30437 (514 amino acids)
            Sakai,N., Tanaka,M., Adachi,S., Miller,W.L. and Nagahama,Y.
            Rainbow trout cytochrome P-450c17 (17
            alpha-hydroxylase/17,20-lyase). cDNA cloning, enzymatic properties
            and temporal pattern of ovarian P-450c17 mRNA expression during
            FEBS Lett. 301, 60-64 (1992)
            Identical to S50356

CYP17       Oryzias latipes (medaka)
            GenEMBL D87121(2421bp)
            Kobayashi,D., Matsuyama,M., Tanaka,M., Fukada,S. and Nagahama,Y.
            Structural analysis of medaka P-450c17 and expression in the
            ovarian follicle.
            unpublished (1996)

CYP17       Oryzias latipes (medaka)
            GenEMBL D87122(2302bp)
            Kobayashi,D., Tanaka,M., Fukada,S. and Nagahama,Y.
            Presence of a Novel Cytochrome P-450c17 Transcripts in Medaka
            unpublished (1996)
            note: this sequence is missing exon 6
            otherwise identical to D87121

CYP17       Squalus acanthias (dogfish)
            GenEMBL S77384 (1964bp)
            Isolation and characterization of the cDNA encoding the spiny 
            dogfish shark
            (Squalus acanthias) form of cytochrome P450c17
             J. Exp. Zool. 272, 25-33 (1995)

CYP17       Ictalurus punctatus (channel catfish)
            GenEMBL AF063837
            Trant,J.M., Berard,C., Byrne,B.J. and Wunder,J.
            Isolation and heterologous expression of the cDNA encoding the
            cytochrome P450 17-hydroxylase from the channel catfish (Ictalurus
            Unpublished (1998)

CYP17A2     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP17A2     Fugu rubripes (pufferfish)
            No accession number
            50% to Oryzias latipes 17, 48% to trout 17 50% to catfish 
            49% to dogfish 48% to other CYP17 from Fugu

CYP17 fragment a Fugu rubripes (pufferfish)
                 No accession number
Fc:c028I22x2 LPC.10549.x2 Length = 1007 61% to 17A1 Fugu

CYP17 fragment b Fugu rubripes (pufferfish)
                 No accession number
Fc:c028I22x1 LPC.10549.x1 Length = 894 
78% to Fc:c028I22x2 65% to 17A1 Fugu

Note: CYP17A2.1, .2 and .3 could be assmbled into a complete sequence
84% to CYP17A2 fugu

CYP17A2.1   Tetraodon nigroviridis (Green puffer)
            84% to CYP17A2 N-term, lower case is fugu seq.
vlaavdslceellsmegrgfdpapavtravtnvvcmlvfsatyrhgdselqevlryndgi 2240
vqtiaggglvdiypwmk (0)

CYP17A2.2   Tetraodon nigroviridis (Green puffer)
            .1 and .2 are 473 kb apart, 82% to CYP17A2, I-helix to K-helix
lower case is fugu seq.

CYP17A2.3   Tetraodon nigroviridis (Green puffer)
            C-term, lower case is fugu seq. 88% to CYP17A2 fugu

CYP17A2.4P   Tetraodon nigroviridis (Green puffer)
             aa 104-224 pseudogene fragment around C-helix to mid

18A Subfamily

Cyp18a1     Drosophila melanogaster
            GenEMBL S66112 (63bp)
            Hurban,P. and Thummel,C. 
            Isolation and characterization of fifteen ecdysone-inducible 
            drosophila genes reveal unexpected complexities in ecdysone regulation.
            Molec. Cell Biol. 13, 7101-7111 (1993)
            Note: very short ecdysone inducible fragment in the heme binding
            region about 2/3 of amino acids are identical to 2D sequences. 
            called Eig 17-1
            dimethylnitrosamine demethylase 

Cyp18a1     Drosophila melanogaster
            GenEMBL U44753(2539bp)
            Bassett,M.H, Waterman,M.R., McCarthy,J.L. and Sliter,T.J.
            Cloning and characterization of CYP18 in Drosophila melanogaster:
            identification of an insect member of a new cytochrome P450 family.
            unpublished (1996)
            complete sequence from the Eig 17-1 fragment

Cyp18a1     Drosophila melanogaster
            GenEMBL AC012164 114600-117669 also AC015216

Cyp18a1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP18A1     Spodoptera littoralis (cotton leafworm)
            No accession number 
            Lyndsay Davies
            Submitted to nomenclature committee 2/22/02
            61% identical to CYP18 from Drosophila
            since there is only one CYP18 seq in Drosophila this new sequence 
            will be called CYP18 without a subfamily or number like CYP18A1.
            If more CYP18s are found in a single species this may have to change.

CYP18A1     Spodoptera littoralis (cotton leafworm)
            No accession umber
            Martine Maibeche
            Submitted to nomenclature committee Jan. 20, 2012
            99% to CYP18A1 Spodoptera littoralis AM086639, 2 aa diffs

CYP18A1     Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            84% to CYP18A1 Spodoptera littoralis

CYP18A1    Plutella xylostella 
           Gene number CCG012412.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           87% to CYP18A1 Spodoptera littoralis AM086639

CYP18A1    Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP18A1     Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            60% to 18A1 Drosophila melanogaster.  

CYP18A1    Linepithema humile (argentine ant)
           No accession number
CYP18A1    Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           60% to CYP18A1 Apis mellifera

CYP18A1    Solenopsis invicta (fire ant)
           See Solenopsis page
           58% to CYP18A1 Apis mellifera

CYP18A1    Pogonomyrmex barbatus (seed-harvester ant)
           No accession number
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           51% to CYP18A1 Apis mellifera

CYP18A1    Bombyx mori (silkworm)
           AU005208 EST BAAB01190855.1 BAAB01187772.1
           60% to CYP18A1 Drosophila
           See silkworm page for sequence

CYP18A1     Tribolium castaneum (red flour beetle)
            GenEMBL XP_968393
            58% to 18A1 Drosophila melanogaster

CYP18A1    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee Dec. 10, 2010 revised Nov. 22 2011
           CYP2 clan
           Clone name seq 44
           61% to CYP18A1 Tribolium castaneum
           complete sequence

CYP18A1     Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            76% to CYP18A1 Tribolium castaneum

CYP18A1    Aedes aegypti (yellow fever mosquito)

CYP18A1    Culex pipiens

CYP18A1     Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph18, 56% to 18A1 Apis
            Pediculus genome site

CYP18A1    Nasonia vitripennis (jewel wasp)
           See wasp page

CYP18A1    Laodephgax striatellus (small brown planthopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee June 22, 2011
           Clone name scaffold30421 
           77% to CYP18A1 Pediculus humanus
           note: species corrected from Sogatella frucifera 
           (white-backed plant hopper)

CYP18A1    Laodelphax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 6, 2011
           Complete seq. 65% to CYP18A1 Pediculus humanus

CYP18A1    Daphnia pulex (water flea)

CYP18A1    Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig12849 282aa
           58% TO CYP18A1, in the CYP2 clan

CYP18A1    Trialeurodes vaporariourum (whitefly)

CYP18A1    Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           26 hydroxylase (not a Halloween gene)
           CYP2 clan

CYP18A1    Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           3 disconnected pieces 58-59% to CYP18A1 Apis or Nasonia

CYP18B1    Bombyx mori (silkworm)
           BAAB01081335.1 BAAB01007952.1
           BAAB01142048.1 BAAB01138082.1 BAAB01045663.1
           39% to CYP18A1 Bombyx
           See silkworm page for sequence

CYP18B1    Plutella xylostella 
           Gene number CCG012411.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           53% to CYP18B1 Bombyx mori

CYP18B2    Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP18B3    Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           56% to CYP18B1 Bombyx mori

CYP18C1    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

19A Subfamily

CYP19       human
            GenEMBL S52034 (142bp) S52789 (106bp) S52793 (149bp)
            S52794 (125bp)
            A unique aromatase (P-450AROM) mRNA formed by alternative
            use of tissue-specific exons 1 in human skin fibroblasts.
            Biochem. Biophys. Res. Commun. 189, 1001-1007 (1992)

CYP19       human
            GenEMBL D14473 (295bp) S59092 S59095 S59171
            Toda,K and Shizuta,Y.
            Molecular cloning of a cDNA showing alternative splicing of
            the 5'-untranslated sequence of mRNA for human aromatase P-450.
            Eur. J. Biochem. 213, 383-389 (1993)

CYP19       human
            GenEMBL D13391 (2238bp)
            Katsumi,T. and Shizuta,Y.
            Identification and characterization of cis-acting regulatory 
elements for 
            the expression of the human aromatase cytochrome P-450 gene.
            J. Biol. Chem. 269, 8099-8107 (1994)

CYP19       human
            GenEMBL D21240 (794bp) D21241 (3231bp)
            Harada,N., Utsumi,T. and Takagi,Y.
            Tissue-specific expression of the human aromatase cytochrome P-450
            gene by alternative use of multiple exons 1 and promoters, and
            switching of tissue-specific exons 1 in carcinogenesis.
            Proc. Natl. Acad. Sci. U.S.A. 90 (23), 11312-11316 (1993)

CYP19       human
            GenEMBL X55983 (669bp)
            Toda,K., Miyahara,K., Kawamoto,T., Ikeda,H., Sagara,Y. and
            Characterization of a cis-acting regulatory element involved in 
            aromatase P-450 gene expression.
            Eur, J. Biochem. 205, 303-309 (1992)
            exon 1

CYP19       human
            GenEMBL S71536 (792bp)
            Toda,K., Simpson,E.R., Mendelson,C.R., Shizuta,Y. and Kilgore,M.W.
            Expression of the gene encoding aromatase cytochrome P450 (CYP19)
            in fetal tissues
            Mol. Endocrinol. 8, 210-217 (1994)

CYP19       human
            GenEMBL M32245 (840bp)
            Harada,N., Yamada,K., Saito,K., Kibe,N., Dohmae,S. and Takagi,Y.
            Structural characterization of the human estrogen synthetase
            (aromatase) gene.
            Biochem. Biophys. Res. Commun. 166, 365-372 (1990)

CYP19       human
            GenEMBL D29757 (875bp) PIR PC2041 (45 amino acids)
            Honda,S.-I., Harada,N. and Takagi,Y.
            Novel exon 1 of the aromatase gene specific for aromatase 
            in human brain.
            Biochem. Biophys. Res. Commun. 198, 1153-1160 (1994)

CYP19       human
            GenEMBL M22246 (2966bp)
            Cloning of a complete cDNA encoding human aromatase: immunochemical
            identification and sequence analysis
            Biochem. Biophys. Res. Commun. 156, 725-732 (1988)

CYP19       human
            GenEMBL L21982 (1166bp)
            Mahendroo,M.S., Mendelson,C.R. and Simpson,E.R.
            Tissue-specific and hormonally-controlled alternative promoters
            regulate aromatase cytochrome P450 gene expression in human adipose
            J. Biol. Chem. 268, 19463-19470 (1993)

CYP19       human
            GenEMBL S85356 (1384bp)
            Means,G.D., Kilgore,M.W., Mahendroo,M.S., Mendelson,C.R. and
            Tissue-specific promoters regulate aromatase cytochrome P450 gene
            expression in human ovary and fetal tissues.
            Mol. Endocrinol. 5, 2005-2013 (1991)

CYP19       human
            GenEMBL S96437 (971bp)
            Kilgore,M.W., Means,G.D., Mendelson,C.R. and Simpson,E.R.
            Alternative promotion of aromatase P-450 expression in the human 
            Mol. Cell. Endocrinol. 83, R9-R16 (1992)

CYP19       human
            PIR A40542 (48 amino acids)
            Mahendroo, M.S., Means, G.D., Mendelson, C.R. and Simpson, E.R.
            Tissue-specific expression of human P-450-AROM. The promoter
            responsible for expression in adipose tissue is different
            from that utilized in placenta.
            J. Biol. Chem. 266, 11276-11281 (1991)

CYP19A1     Pan troglodytes (chimpanzee)
            99% (2 aa diffs) to human 

CYP19A1     Macaca fascicularis (cynomolgus monkey)

CYP19       Macaca fuscata (Japanese macaque)
            GenEMBL S79807(369bp)
            Yamada-Mouri,N., Hirata,S., Hayashi,M. and Kato,J.
            Analysis of the expression and the first exon of aromatase mRNA in
            monkey brain.
            J. Steroid Biochem. Mol. Biol. 55 (1), 17-23 (1995)

CYP19       rat
            GenEMBL S59505 (639bp)
            Fitzpatrick,S.L. and Richards,J.S.
            cis-acting elements of the rat aromatase promoter required for
            adenosine 3',5'-monophosphate induction in ovarian granulosa cells
            and constitutive expression in R2C Leydig cells.
            Molec. Endocrinol. 7, 341-354 (1993)
            Note: promoter

CYP19       rat
            GenEMBL Z11815 (590bp)
            Hickey,G.J., Krasnow,J.S., Beattie,W.G. and Richards,J.S.
            Aromatase cytochrome P450 in rat ovarian granulosa cells before and
            after luteinization: Adenosine 3',5'-monophosphate-dependent and
            independent regulation. Cloning and sequencing of rat aromatase
            cDNA and 5' genomic DNA
            Mol. Endocrinol. 4, 3-12 (1990)

CYP19A1     Mesocricetus auratus (hamster)
            Genpept AAK57023

CYP19       Oryctolagus cuniculus (rabbit)
            GenEMBL Z68271(1783bp)
            Delarue,B., Mittre,H., Feral,C., Benhaim,A. and Leymarie,P.
            Rapid sequencing of rabbit aromatase cDNA using RACE PCR without
            C. R. Acad. Sci. III, Sci. Vie 319, 663-670 (1996)

CYP19       Oryctolagus cuniculus (rabbit)
            GenEMBL Z70302(1455bp)
            Delarue,B., Mittre,H. and Leymarie,P.
            Expression des transcrits codant pour l'aromatase de lapin dans
            differents tissus.
            unpublished (1996)

Cyp19       mouse
            Swiss P28649 (503 amino acids) GenEMBL D00659 (2420bp)
            Terashima,M., Toda,K., Kawamoto,T., Kuribayashi,I., Ogawa,Y.,
            Maeda,T. and Shizuta,Y.
            Isolation of a full-length cDNA encoding mouse aromatase P450
            Arch. Biochem. Biophys. 285, 231-237 (1991)

CYP19      pig
           no accession number
           Corbin, C.J., Khalil, M.W. and Conley, A.J.
           Functional ovarian and placental isoforms od porcine aromatase.
           Mol. Cell. Endocrinol. 113, 29-37 (1995)

CYP19       Sus scrofa (pig)
            GenEMBL L15471 (454bp)
            Ko,Y., Choi,I., Green,M.L., Simmen,F.A. and Simmen,R.C.
            Transient expression of the cytochrome P450 aromatase gene in
            elongating porcine blastocysts is correlated with uterine
            insulin-like growth factor levels during peri-implantation
            Mol. Reprod. Dev. 37 (1), 1-11 (1994)
            Note: This is only a fragment of 80 amino acids, including
            helix K and the EXXR conserved sequence.

CYP19      Sus scrofa (pig)
            GenEMBL U52141(1133bp)
            Choi,I., Collante,W., Simmen,R.C.M. and Simmen,F.A.
            Molecular cloning of multiple forms of cytochrome p450 aromatase
            and their developmental expression in porcine blastocysts,
            endometrium, and placenta.
            Unpublished (1997)

CYP19      Sus scrofa (pig)
            GenEMBL U52142(1584bp)
            Choi,I., Collante,W., Simmen,R.C.M. and Simmen,F.A.
            Molecular cloning of multiple forms of cytochrome p450 aromatase
            and their developmental expression in porcine blastocysts,
            endometrium, and placenta.
            Unpublished (1997)

CYP19      Sus scrofa (pig)
            GenEMBL U37309 (417bp)
            Choi,I., Simmen,R.C. and Simmen,F.A.
            Molecular cloning of cytochrome P450 aromatase complementary
            deoxyribonucleic acid from periimplantation porcine and equine
            blastocysts identifies multiple novel 5'-untranslated exons
            expressed in embryos, endometrium, and placenta.
            Endocrinology 137 (4), 1457-1467 (1996)

CYP19      Sus scrofa (pig)
            GenEMBL U37311(2470bp) 
            Choi,I., Simmen,R.C. and Simmen,F.A.
            Molecular cloning of cytochrome P450 aromatase complementary
            deoxyribonucleic acid from periimplantation porcine and equine
            blastocysts identifies multiple novel 5'-untranslated exons
            expressed in embryos, endometrium, and placenta.
            Endocrinology 137 (4), 1457-1467 (1996)

CYP19      Sus scrofa (pig)
            GenEMBL U57510
            Choi,I., Collante,W., Simmen,R.C.M., Troyer,D. and Simmen,F.A.
            Molecular cloning and structural characterization of porcine
            cytochrome p450 aromatase chromosomal genes: evidence for the
            existence of multiple, closely related genes that encode
            developmental and tissue-specific isoforms of aromatase.
            unpublished (1997)

CYP19      Sus scrofa (pig)
            GenEMBL U57517(287bp) U57518(287bp) U57519(358bp) 
            Choi,I., Collante,W., Simmen,R.C.M., Troyer,D. and Simmen,F.A.
            Molecular cloning and structural characterization of porcine
            cytochrome p450 aromatase chromosomal genes: evidence for the
            existence of multiple, closely related genes that encode
            developmental and tissue-specific isoforms of aromatase.
            unpublished (1997)

CYP19       Sus scrofa (pig)
            GenEMBL U57520(517bp) U57521(495bp)
            Choi,I., Collante,W., Simmen,R.C.M., Troyer,D. and Simmen,F.A.
            Molecular cloning and structural characterization of porcine
            cytochrome p450 aromatase chromosomal genes: evidence for the
            existence of multiple, closely related genes that encode
            developmental and tissue-specific isoforms of aromatase.
            unpublished (1997)

CYP19A1     Sus scrofa (pig)

CYP19A2     Sus scrofa (pig)
            Choi,I., Troyer,D.L., Cornwell,D.L., Kirby-Dobbels,K.R.,
            Collante,W.R. and Simmen,F.A.
            Closely related genes encode developmental and tissue isoforms of
            porcine cytochrome P450 aromatase
            DNA Cell Biol. 16 (6), 769-777 (1997)
            86% to CYP19A3 pig

CYP19A3     Sus scrofa (pig)
            Choi,I., Troyer,D.L., Cornwell,D.L., Kirby-Dobbels,K.R.,
            Collante,W.R. and Simmen,F.A.
            Closely related genes encode developmental and tissue isoforms of
            porcine cytochrome P450 aromatase
            DNA Cell Biol. 16 (6), 769-777 (1997)
            86% to CYP19A2 pig

CYP19A1     Capra hircus (goat)

CYP19A1    Ovis aries (sheep)

CYP19       bovine
            GenEMBL S66248 (2104bp)
            Hinshelwood,M.M., Corbin,C.J., Tsang,P.C. and Simpson,E.R.
            Isolation and characterization of a cDNA insert encoding bovine 
            cytochrome P450.
            Endocrinology 133, 1971-1977 (1993)
            Note two amino acid differences with Z32741

CYP19       bovine
            GenEMBL M64646 (1725bp)
            Zuber,M.X., John,M.E., Okamura,T., Simpson,E.R. and Waterman,M.R.
            Bovine adrenocortical cytochrome P-450-17-alpha: Regulation of gene
            expression by ACTH and elucidation of primary sequence.
            J. Biol. Chem. 261, 2475-2482 (1986)

CYP19       bovine
            GenEMBL Z32741 (4226bp) PIR S44210 (503 amino acids)
            Vanselow,J. and Furbass,R.
            Aromatase cytochrome P450 gene and pseudogene
            unpublished (1994)

CYP19       bovine
            GenEMBL Z69241 to Z69250 (genomic sequences)
            Furbass,R. and Vanselow,J.
            unpublished (1996)

CYP19P      bovine
            GenEMBL Z32813 (1006bp)
            Vanselow,J. and Furbass,R.
            Aromatase cytochrome P450 gene and pseudogene
            unpublished (1994)

CYP19A1     Bos taurus (cow)
            See cattle page for details

CYP19       Equus caballus (horse)
            GenEMBL U37313 (458bp)
            Choi,I., Simmen,R.C. and Simmen,F.A.
            Molecular cloning of cytochrome P450 aromatase complementary
            deoxyribonucleic acid from periimplantation porcine and equine
            blastocysts identifies multiple novel 5'-untranslated exons
            expressed in embryos, endometrium, and placenta.
            Endocrinology 137 (4), 1457-1467 (1996)

CYP19A1     Equus caballus (horse)

CYP19A1     Canis familiaris (dog)
            86% to CYP19A1 human (called family 17 in Genbank)

CYP19A1     Lagenorhynchus acutus (Atlantic white-sided dolphin)
            Wilson,J.Y., McArthur,A.G. and Stegeman,J.J.
            Characterization of a cetacean aromatase (CYP19) and the phylogeny
            and functional conservation of vertebrate aromatase
            Gen. Comp. Endocrinol. 140 (1), 74-83 (2005)

CYP19       chicken (three different strains of chicken)
            GenEMBL M73277 to M73285, M73286 to M73294
            M73295 to M73303
            PIR A41063 (495 amino acids)
            Matsumine,H., Herbst,M., Ou,S.-H.I., Wilson,J.D. and 
            Aromatase mRNA in the extragonadal tissues of chickens with 
            the henny-feathering trait is derived from a distinctive
            promoter structure that contains a segment of a retroviral
            long terminal repeat.
            J. Biol. Chem. 266, 19900-19907 (1991)

CYP19       Coturnix coturnix japonica (Japanese quail)
            GenEMBL S46949 (692bp) PIR A48977(230 amino acids)
            Harada,N., Yamada,K., Foidart,A. and Balthazart,J.
            Regulation of aromatase cytochrome P-450 (estrogen synthetase)
            transcripts in the quail brain by testosterone.
            Brain Res. Mol. Brain Res. 15, 19-26 (1992)
            Note: only three amino acid differences with chicken.

CYP19      Coturnix coturnix (quail)
            GenEMBL D50336(4351bp)
            Kudo,T., Yamamoto,H., Sato,S. and Sutou,S.
            Comparison of 5' upstream regions of chicken and quail aromatase
            Unpublished (1995)

CYP19       Poephila guttata (zebra finch)
            GenEMBL S75898(3188bp)
            Shen,P., Campagnoni,C.W., Kampf,K., Schlinger,B.A., Arnold,A.P. and
            Isolation and characterization of a zebra finch aromatase cDNA: in
            situ hybridization reveals high aromatase expression in brain
            Brain Res. Mol. Brain Res. 24 (1-4), 227-237 (1994)

CYP19A1     Alligator mississippiensis (American alligator)

CYP19A1     Xenopus tropicalis 
            CX885719.1 CX885718.2 DN051995.1
            best match in human = CYP19 71%, CYP19 ortholog
            5697_prot from UCSC browser scaffold_27:1527865-1546466

CYP19A1    Xenopus laevis (African clawed frog)
           AB031278, SwissProt Q9IBE6 100%, 
           SwissProt Q68FK0 3 aa diffs
           93% to CYP19A1 X. tropicalis

CYP19       Ictalurus punctatus (channel catfish)
            GenEMBL S75715(2102bp)
            Isolation and characterization of the cDNA encoding the channel
            catfish (Ictalurus punctatus) form of cytochrome P450arom
            Gen. Comp. Endocrinol. 95 (2), 155-168 (1994)

CYP19       Onchorynchus mykiss (rainbow trout)
            Tanaka, M., Telecky, T.M., Fukada, S., Adachi,S., Chen, S. and 
Nagahama, Y.
             Cloning and sequence analysis of the cDNA encoding P-450 aromatase 
             (P450arom) from a rainbow trout (Onchorynchus mykiss) ovary, 
             between the amount of P450arom mRNA and the production of 
             in the ovary.
             J. Mol. Endocrin. 8, 53-61 (1992)

CYP19      Carassius auratus (goldfish)
            GenEMBL U18974(2939bp)
            Gelinas,D.M., Pitoc,G.A. and Callard,G.V.
            Isolation of goldfish brain aromatase cDNA and analysis of
            expression during the reproductive cycle and after steroid
            treatment in vivo.
            unpublished (1996)

CYP19       Oryzias latipes (medaka)
            GenEMBL D82968(1851bp)
            Tanaka,M., Fukada,S., Matsuyama,M. and Nagahama,Y.
            Structure and promoter analysis of the cytochrome P-450 aromatase
            gene of the teleost fish, medaka (Oryzias latipes)
            J. Biochem. 117 (4), 719-725 (1995)

CYP19      Tilapia nilotica (Cichlid fish)
            GenEMBL U72071(1804bp)
            Chang,X.T., Kobayashi,T., Nakamura,M., Kajura,H. and Nagahama,Y.
            Isolation and characterization of cDNA encoding the tilapia
            (Oreochromis niloticus) cytochrome P450 aromatase (P450arom):
            Changes in P450arom mRNA, protein and enzyme activity in ovarian
            follicles during oogenesis.
            J. Mol. Endocrinol. (1996) In press

CYP19     Haplochromis burtoni (cichlid fish)
            GenEMBL AF114716
            Aromatase expression during social change in the cichlid fish,
            Haplochromis burtoni.

CYP19       Paralichthys olivaceus (Japanese Flounder)
            GenEMBL AB017182
            Kitano,T., Takamune,K., Kobayashi,T., Nagahama,Y. and Abe,S.
            Suppression of P450 Aromatase (P450arom) Gene Expression in
            Sex-Reversed Males Produced by Rearing Genetically Female Larvae at
            High Water Temperature during a period of Sex Differentiation in
            Japanese Flounder (Paralichthys olivaceus)
            Unpublished (1998)

CYP19A1     Danio rerio (zebrafish)
            GenEMBL AF183906
            Chiang,E.F.L., Yan,Y.L., Guiguen,Y., Postlethwait,J. and Chung,B.C.
            Two Cyp19 (P450 Aromatase) Genes on Duplicated Zebrafish
            Chromosomes Are Expressed in Ovary or Brain
            Mol. Biol. Evol. 18 (4), 542-550 (2001)
            Called CYP19a expressed in ovary

CYP19A1     Fugu rubripes (pufferfish)
            No accession number
            65% to AF183906 ovary form of CYP19 from Zebrafish
            60% to AF183908 brain form of CYP19 from Zebrafish
            61% to other Fugu CYP19
            this is probably the ovary form

CYP19A1     Tetraodon nigroviridis (Green puffer)
            90% to fugu CYP19A1

CYP19A1v1   Fundulus heteroclitus, ovarian

CYP19A1v2   Fundulus heteroclitus, ovarian

CYP19A2     Fugu rubripes (pufferfish)
            No accession number
            65% to both brain and ovary forms of CYP19 from Zebrafish
            61% to other Fugu CYP19
            this is probably the brain form

CYP19A2     Tetraodon nigroviridis (Green puffer)
            88% to fugu CYP19A2

CYP19A2     Danio rerio (zebrafish)
            GenEMBL AF183908
            Chiang,E.F.L., Yan,Y.L., Guiguen,Y., Postlethwait,J. and Chung,B.C.
            Two Cyp19 (P450 Aromatase) Genes on Duplicated Zebrafish
            Chromosomes Are Expressed in Ovary or Brain
            Mol. Biol. Evol. 18 (4), 542-550 (2001)
            Called CYP19b expressed in brain

CYP19A2v1   Fundulus heteroclitus, brain

CYP19A2v2   Fundulus heteroclitus, brain

CYP19A2v1   Oncorhynchus mykiss (rainbow trout)
            Called CYP19b (brain form)
            Alt. splice form P450aromB-I

CYP19A2v2   Oncorhynchus mykiss (rainbow trout)
            Called CYP19b (brain form)
            Alt. splice form P450aromB-II, short at N-term

CYP19      Trachemys scripta (red-eared slider turtle)
           Temperature-dependent sex determination: the interplay of steroid 
           and temperature.
           Zool. Sci. 13, 1-13 (1996)

CYP91B1v1    Branchiostoma floridae (lancelet, amphioxus)
             Adjacent to EXOC6
             37% to CYP91A1 human, 37% to zebrafish CYP19A2
             39% to CYP19C3 Branchiostoma belcheri
3113 GQVSPAHVQHCVLE 3072 dup exon 7
3024 ERGEVSPAHVQQCVLEMVL 2968 dup exon 7
2925 ERGEVSPAHVQQCVLEMVL 2869 dup exon 7
2826 ERGEVSPAHVQQCVLEMVL 2770 dup exon 7
2727 ERGEVSPAHVQQCVLEMVL 2671 dup exon 7

CYP19B1v1-de1b2b3b    Branchiostoma floridae (lancelet, amphioxus)
      pseudogene fragment upstream of Cyp19B1v1

CYP91C1   Branchiostoma floridae (lancelet, amphioxus)
          CYP19C1 and CYP19C2 are syntenic with CYP2U1 of medaka
          39% to CYP19A1 human

CYP19C2   Branchiostoma floridae (lancelet, amphioxus)
          CYP19C1 and CYP19C2 are syntenic with CYP2U1 of medaka
          39% to CYP19A1 human

CYP19C2-de1b2b3b    Branchiostoma floridae (lancelet, amphioxus)
Second gene in the region 
3 aa diffs to CYP19C2

CYP91C3 Branchiostoma belcheri (lancelet, amphioxus)
        CYP19 mRNA for cytochrome P450 aromatase, complete cds. ACCESSION   
        87% to CYP19C1 and CYP19C2 of Branchiostoma floridae
        41% to CYP19A1 human, 39% to CYP91B1v1 Branchiostoma floridae

CYP20      human
           GenEMBL AC011737.8 chromosome 2 clone RP11-33N4, 
           AC011737.8 chr 2 (missing exons 12,13) 
           AC080075.2 (missing exons 1,7,8)
TLVLYALGVVLQDPNTWPSPHK (2) genomic seq stops here the rest is cDNA
FDPDRFDDELVMKTFSSLGFSGTQECPELR (2) intron site based on fish genomic DNA

CYP20A1    Pan troglodytes (chimpanzee)
           99% (4 aa diffs) to human 

CYP20      mouse
           GenEMBL AK020848 adult retina cDNA plus ESTs for C-term

Cyp20a1  rat 

CYP20A1     Bos taurus (cow)
            See cattle page for details

CYP20A1   Sus scrofa (miniature pig) 
          no accession number
          Haitao Shang
          Submitted to nomenclature committee May 23, 2007
          partial sequence
          92% to human 20A1, full seq. is not known
          Ortholog of human CYP20A1

CYP20A1   Sus scrofa (pig)
          DT324969.1, BG894896.1, BI336725.1, BP449309.1
          Trace file gnl|ti|861177001
          lower case = cow seq.
KQYEDALMQLESILKKI ikerkgrnfsqhifidslvqgnlndqqiledtmifsla

CYP20A1     Canis familiaris (dog)

CYP20       Gallus gallus (chicken)
BU454844 603215388F1 CSEQRBN14 Gallus gallus cDNA clone ChEST201o21 5'.
BU111630 603125978F1 CSEQCHL13 Gallus gallus cDNA clone ChEST95k19 5'
BU356654 603474052F1 CSEQCHN70 Gallus gallus cDNA

CYP20   Xenopus laevis (African clawed frog)
        BC044111.1 mRNA, complete cds, SwissProt Q7ZXU7
        BJ037591.1 NIBB Mochii normalized Xenopus neurula library Xenopus laevis 
        cDNA clone XL040p15 5'
        BQ725586 BQ725586.1 AGENCOURT_8103453 NICHD XGC Emb2 Xenopus laevis cDNA 
        95% identical to X. tropicalis seq. 74% to chicken

CYP20A1   Xenopus tropicalis
          DR851274.1 CX431022.2 CF240500.1 DT417160.1
          From JGI blast server http://aluminum.jgi-
          And from Sanger       
          AL848968.1 Xenopus tropicalis EST, clone TEgg007o12 5'
          AL870093 AL870093.1 Xenopus tropicalis EST, clone TEgg120l22 5'
          60% to Fugu CYP20, 70% to human CYP20, 62% to zebrafish, 
          30% to ciona CYP20 like seq, 72% to chicken CYP20
tlvlyalgvvlqdntawplayr () from X. laevis

CYP20      Fugu rubripes (pufferfish)
           No accession number
           59% TO CYP20 human

CYP20A1   Tetraodon nigroviridis (Green puffer)
          87% to CYP20A1 fugu

CYP20 Danio rerio (zebrafish)
      Assembled CYP20 from zebrafish ESTs 
      BQ259821 faa04d08.y1 zebrafish fin day3 regeneration
      BM185037 fv16g05.x2 zebrafish adult brain
      BG985721 2543 NICHD Zebrafish normalized I
      BM070720 fu98e06.y1 zebrafish adult brain cDNA
      CA472036 AGENCOURT_10739799 NCI_CGAP_ZKid1 cDNA (kidney?)
      BI981894 fu52c12.y1 zebrafish adult brain Danio rerio cDNA

CYP20 Danio rerio (zebrafish)
      ctg10765  genomic contig CYP20 74% to fugu 
15738 IWSEIGKGYLDGSLEKSSSRKAHYES (1?) 15815 AC boundary istead of AG

CYP20      Oryzias latipes (medaka fish)
BJ524824.1 MF01SSB cDNA Oryzias latipes cDNA
BJ003683.1 BJ003683 MF01SSA cDNA Oryzias latipes cDNA
About 26 aa missing at end

CYP20      Salmo salar (Atlantic salmon)
           GenEMBL CA063128.1 ssalrgb509318 mixed_tissue Salmo salar cDNA.
           GenEMBL CB516811.1 ssalrgb509318_rev mixed_tissue Salmo salar cDNA.
           GenEMBL CB513409.1 ssalrgb531212_rev mixed_tissue Salmo salar cDNA.
           BG935303.1 SL1-0624 Atlantic Salmon liver Salmo salar cDNA clone SL1-0624
18 amino acids missing here

CYP20   Ciona intestinalis
        SEQUENCE 186, 187 CYP20 ortholog 
        29% to fugu CYP20 CYS = HIS

CYP20  Ciona savignyi 
       sequence for CYP20 ortholog 
       72% to C. intestinalis seq 186

CYP20    Halocynthia roretzi (tunicate, Urochordate)
         51% to CYP20 in Ciona

CYP20    Molgula tectiformis (tailless ascidian, tunicate, Urochordate) 
         CJ366548.1 EST 

CYP20    Branchiostoma floridae (amphioxus)
         There are 8 CYP20s in amphioxus (see the amphioxus page)

CYP20   Saccoglossus kowalevskii  (Acorn worm, hemichordate)
        FF488963, FF488605, FF525072, FF503042, FF480950, FF429742
        38% to Paracentrotus lividus, 30% to CYP20 human
        33% to sponge CYP38A1

CYP20A2   Saccoglossus kowalevskii  (Acorn worm, hemichordate)
          45% to CYP20A1 Saccoglossus
          N-term region

CYP20   Strongylocentrotus purpuratus (purple sea urchin)
        GenEMBL XM_787803.1, XM_793215.1
        AAGJ02125342.1 (middle piece, two exons that were missing)
        85% to Paracentrotus lividus
        37% to CYP20 Saccoglossus kowalevskii (acorn worm)
        35% to sponge CYP38A1

CYP20    Paracentrotus lividus (common urchin, Deuterostomes)
         AM536943, AM531351, AM584793,
         AM534834, AM554260
         85% to CYP20 Strongylocentrotus purpuratus
         32% to human CYP20 (best match in human) first 11 aa identical
         37% to sponge CYP38A1
         CYP20 has a highly conserved N-terminal

CYP20    Rhipicephalus appendiculatus (brown ear tick, arthropod, arachnid, 
         35% to CYP20 Danio, 39% to CYP20 human

CYP20    Ixodes scapularis (blacklegged tick, arthropod, arachnid, ecdysozoa)
         N and C-term with a gap in the middle


CYP20    Amblyomma cajennense (tick)
         EC780049.1 EST

CYP20    Helobdella robusta (leech, annelid worm)
         JGI gene model fgenesh4_pg.C_scaffold_12000405 [Helro1:168041]
         28% to CYP20 Saccoglossus kowalevskii, 
         29% to Strongylocentrotus purpuratus CYP20, 
         30% to Paracentrotus lividus CYP20
         33% to Amphioxus CYP20
3747833 KPKEEIWLSV 3747862

CYP20    Haementeria depressa (leech, annelid worm)
         CN807321.1 EST
         67% to CYP20 Helobdella robusta

CYP20    Hirudo medicinalis (medical leech, annelid worm)
         EY484183.1 EST

CYP20    Eisenia fetida (earthworm, annelid worm)
         EH670454.1, EH670439.1 ESTs

CYP20A1  Capitella sp. I (polychaete worm, annelid)
         JGI gene model e_gw1.28.81.1 [Capca1:145552]  
         + e_gw1.28.94.1 [Capca1:145544]
         And Capca1/scaffold_28:374918-376952
         upstream region with N-term
         45% to Amphioxus CYP20, 41% to Strongylocentrotus purpuratus CYP20
         34% to Helobdella robusta CYP20

CYP20A1P    Capitella sp. I  (polychaete worm, annelid, Lophotrochozoa)
            JGI gene model fgenesh1_pg.C_scaffold_1378000002 [Capca1:185650]               
            51% to the N-term and 
            72% to the C-term of the whole gene in Capitella
            & = frameshift
(deletion of 179 aa)

CYP20    Lottia gigantea 
         37% to CYP20 Danio
         EST FC700835.1

CYP20    Aplysia californica (Califonia sea hare,mollusc, Lophotrochozoa)
         EB277115.1, EB214176.1, EB282241.1

CYP20    Crassostrea virginica (Oyster, mollusc, Lophotrochozoa)
         EH649216.1 N-term

CYP20    Mytilus californianus (mussel, mollusc, Lophotrochozoa)
         ES406577.1 EST

CYP20    Nematostella vectensis (starlet sea anemone, Cnidarian)
         matches genomic seq NZ_ABAV01008690.1 and ABAV01008690.1
         40% to human
         31% to CYP20 HUMAN
         missing N-term
      LRSLFDRP (1) 14639

CYP20    Hydra magnipapillata (hydra, Cnidarian)
         BP508840 BP508840 ESTs
         ABRM01022129.1 ABRM01019337.1 genomic
         36% to CYP20 C-term


CYP20/CYP38A1   Suberite domuncula (sponge)
             GenEMBL Y17816 (1789bp)
             Mueller,W.E.G., Wiens,M., Batel,R., Steffen,R., Borojevic,R. and
             Establishment of a primary cell culture from a sponge: Primmorphs
             from Suberites domuncula
             Mar. Ecol. Prog. Ser. In press
             Name change to CYP20 is recommended

CYP20    Schmidtea mediterranea (freshwater planarian) 
         34% to Paracentrotus lividus
         33% to Strongylocentrotus purpuratus
         32% to Saccoglossus kowalevskii
         25% to human CYP20
         from SmedGD database
         Missing first exon

21A Subfamily

CYP21A1P    human
            GenEMBL M13935 (3206bp)
            White,P.C., New,M.I. and Dupont,B.
            Structure of human steroid 21-hydroxylase genes.
            Proc. Natl. Acad. Sci. U.S.A. 83, 5111-5115 (1986)
            97% to 21A2 NT_033167.1|Hs6_33343
327654 FLLHHPE 327634
327292 PLALPHRTTRPS 327257

CYP21A1P    human with congenital adrenal hyperplasia
            GenEMBL M26857 (4034bp) X05445
            Rodrigues,N.R., Dunham,I., Yu,C.Y., Carroll,M.C.,
            Porter,R.R. and Campbell,R.D.
            Molecular characterization of the HLA-linked steroid
            21-hydroxylase B gene from an individual with congenital
            adrenal hyperplasia.
            EMBO J. 6, 1653-1661 (1987)

CYP21A1P    human
            GenEMBL S60612 (426bp)
            Collier,S., Tassabehji,M. and Strachan,T. 
            A de novo pathological point mutation at the 21-hydroxylase locus:
            implications for gene conversion in the human genome.
            Nature Genetics 3, 260-265 (1993)

CYP21A1     Canis familiaris (dog)
            GenEMBL AB039881

CYP21A2     human
            GenEMBL M21544 M21545 M21547 to M21550 M23224 M23225
            M31022 M31023 (ten segments)
            Globerman,H., Amor-Gueret,M., Parker,K.L., New,M.I. and White,P.C.
            Nonsense mutation causing steroid 21-hydroxylase deficiency
            J. Clin. Invest. 82, 139-144 (1988)

CYP21A2     human
            GenEMBL M12792 M23280 (5141bp)
            Higashi,Y., Tanae,A., Inoue,H., Hiromasa,T., and 
            Aberrant splicing and missense mutations cause steroid 21-
            hydroxylase [P-450(C21)] deficiency in humans: possible gene
            conversion products.
            Proc. Natl. Acad.Sci USA 85, 7486-7490 (1988)

CYP21A2     human
            GenEMBL X54940
            Partanen,J. and Campbell,R.D.
            Rapid characterisation of mutant P450c21 Genes by PCR
            unpublished (1993)

CYP21A2     human
            GenEMBL X58898 to X58908 PIR S26485 (97 amino acids)
            PIR S26484 (371 amino acids) PIR S29670 (495 amino acids)
            PIR S29671 (372 amino acids) PIR S26584 (371 amino acids)
            PIR S29673 (372 amino acids)
            Helmberg,A., Tabarelli,M., Dobler,G. and Kofler,R.
            Identification of molecular defects causing congenital adrenal
            hyperplasia by cloning of PCR-amplified 21-hydroxylase genes
            unpublished (1992)

CYP21A2     human with congenital adrenal hyperplasia
            GenEMBL M28548 (4044bp) X05449
            Rodrigues,N.R., Dunham,I., Yu,C.Y., Carroll,M.C.,
            Porter,R.R. and Campbell,R.D.
            Molecular characterization of the HLA-linked steroid
            21-hydroxylase B gene from an individual with congenital
            adrenal hyperplasia.
            EMBO J. 6, 1653-1661 (1987)
            Note: mutant gene, 2 amino acid differences

CYP21A2     human with congenital adrenal hyperplasia
            GenEMBL M26856 X05448 (4042bp)
            Rodrigues,N.R., Dunham,I., Yu,C.Y., Carroll,M.C.,
            Porter,R.R. and Campbell,R.D.
            Molecular characterization of the HLA-linked steroid
            21-hydroxylase B gene from an individual with congenital
            adrenal hyperplasia.
            EMBO J. 6, 1653-1661 (1987)
            Note: normal gene

CYP21A2     Pan troglodytes (chimpanzee)
            99% (5 aa diffs) to human

CYP21A2     Papio hamadryas ursinus (chacma baboon)

CYP21A1     Bos taurus (cattle)
            GenEMBL M11267, M13545
            Chung BC, Matteson KJ, Miller WL. (1986) Structure of a bovine gene 
            for P-450c21 (steroid 21-hydroxylase) defines a novel cytochrome P-450 
            gene family. Proc Natl Acad Sci U S A. 83, 4243-4247.
            First cattle CYP21A1 gene

CYP21A1     Bos taurus (cow)
            See cattle page for details

CYP21A1     pig 
            S53049 M83939 

CYP21       rat
            GenEMBL U56853(1964bp)
            Zhou,M.Y., Vila,M.C., Gomez-Sanchez,E.P. and Gomez-Sanchez,C.E.
            Cloning of two alternatively spliced 21-hydroxylase cDNAs in the
            rat adrenal.
            unpublished (1996)

CYP21       rat
            GenEMBL U56854
            alternatively spliced form

Cyp21       mouse
            genEMBL AF049850 Mm.18845

Cyp21a2-ps  mouse
            GenEMBL AF030001
Gap 30 aa missing

CYP21       pig
            GenEMBL S53049 M83939 (4792bp) Swiss Q02390 (492 amino acids)
            PIR S28169 (492 amino acids)
            Burghelle-Mayeur,C., Geffrotin,C. and Vaiman,M.
            Sequences of the swine 21-hydroxylase gene (Cyp21) and 
            a portion of the opposite-strand overlapping gene of unkown
            function previously described in human.
            Biochim. Biophys. Acta 1171, 153-161 (1992)

CYP21       sheep
            PIR A43349 (497 amino acids) B43349 (479 amino acids)
            Crawford, R.J., Hammond, V.E., Connell, J.M. and Coghlan, J.P.
            The structure and activity of two cytochrome P450c21 proteins
            encoded in the ovine adrenal cortex.
            J. Biol. Chem. 267, 16212-16218 (1992)
            B43349 is truncated early after alternate splicing

CYP21A1     Ovis aries (sheep) 
            Called P450C21C (intact functional)

CYP21A1_v1  Ovis aries (sheep) 
            Called P450C21D (truncated by alt. splicing, no activity)

CYP21A1     Gallus gallus (chicken)
            43% to CYP21A2 human, 45% to 21A1 cattle
            between CENPA and TNXB, not in the genome assembly

CYP21A1P    Gallus gallus (chicken)
            This gene is next to C4 as in humans = pseudogene

CYP21A1P    Taeniopygia guttata (zebrafinch)
            Ensemble peptide ENSTGUP00000003346_part 
            This is the first bird CYP21 found

CYP21A1P    Taeniopygia guttata (zebrafinch) 

CYP21A1     Anolis carolinensis (green anole lizard) 
            Ensemble peptide ENSACAP00000013728 
            45% to CYP21A2 human
            44% to CYP21A1 chicken, between CENPA and TNXB

CYP21A1     Xenopus tropicalis (Western clawed frog)
            50686_prot scaffold_1026:150552-153289
            41% to human CYP21A2, 
            45% to Fugu CYP21, 46% to zebrafish CYP21

CYP21A1    Xenopus laevis (African clawed frog)
           SwissProt Q6AX26 85% to X. tropicalis
           This seq is missing N-term
           note: X. tropicalis is missing PERF motif = PENS

CYP21A1     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP21A1    Fugu rubripes (pufferfish)
           Scaffold_15 complete gene 11 exons 
           = LDZ12559.x1 LPC12755.x1 
           revised seq. changed N-term
           42% to CYP21 human over 455 amino acids
           this is the first fish CYP21 sequence found

CYP21A1   Tetraodon nigroviridis (Green puffer)
          GenEMBL AL281449.1 C0BG094DE12LP1 G Tetraodon nigroviridis 
          genomic clone 094J24 T7.Length = 895
          AL233853.1 C0BG007BE04XD1 G Tetraodon nigroviridis 
          genomic clone 007I08 T7.Length = 1079
          88% to CYP21A1 fugu
          N-term similar to Micropogonias undulatus EU673090

CYP21A1    Oncorhynchus mykiss (rainbow trout)

22A Subfamily

CYP22A1     Caenorhabditis elegans (nematode worm)
            GenEMBL U39648 (28581 bp) AF407572, NM_171699, NM_171698
            cosmid T13C5.1
            Jia,K., Albert,P.S. and Riddle,D.L.
            DAF-9, a cytochrome P450 regulating C. elegans larval development
            and adult longevity
            Development 129 (1), 221-231 (2002)
            daf-9 mutant This gene may be in the pathway to 
            synthesize a ligand for DAF-12, a nuclear receptor.  
            Daf-9 has a role in larval development.
            DAF comes from abnormal DAuer Formation

CYP22A1    Caenorhabditis briggsae ortholog
           XP_002644834.1 77% to CYP22A1

CYP22A2    Caenorhabditis briggsae 

23A Subfamily

CYP23A1     Caenorhabditis elegans (nematode worm)
            GenEMBL U39472 (42282 bp)
            see CYP14A1 for reference
            cosmid B0304.3

CYP23A1     Caenorhabditis briggsae ortholog
            XP_002630091.1 86% to CYP23A1

24A Subfamily

CYP24       rat
            GenEMBL L04608 to L04619, S52625 to S52636
            Ohyama,Y., Noshiro,M., Eggertsen,G., Gotoh,O., Kato,Y.,
            Bjorkhem,I. and Okuda,K.
            Structural characterization of the gene encoding rat
            25-hydroxyvitamin D3 24-hydroxylase.
            Biochemistry 32, 76-82 (1993)

CYP24       rat
            GenEMBL Z28351 (1419bp)
            Hahn,C.N., Kerry,D.M., Omdahl,J.L. and May,B.K.
            Identification of a vitamin D responsive element in the promoter of 
            gene for the rat 25-hydroxyvitamin D3 24-hydroxylase
            Nuc. Acids Res. 22, 2410-2416 (1994)

CYP24       rat
            GenEMBL X59506 (3209bp)
            Ohyama,Y., Noshiro,M. and Okuda,K.
            Cloning and expression of cDNA encoding 25-hydroxyvitamin D3 24- 
            FEBS Lett. 278, 195-198 (1991)

CYP24       rat
            GenEMBL D17792 (?bp)
            Ohyama, Y., Ozono,K., Uchida,M., Shinki,T., Kato,S., Suda,T., 
            Noshiro,M. and Kato,Y.
            Identification of a vitamin D-responsive element in the 5'-flanking 
region of the rat 
            25-hydroxyvitamin D3 24-hydroxylase gene.
            J. Biol. Chem. 269, 10545-10550 (1994)

CYP24        rat
            GenEMBL U03112 (?bp)
            Zierold,C., Darwish,H.M. and DeLuca,H.F.
            Identification of a vitamin D-response element in the rat calcidiol 
            (25-hydroxyvitamin D3) 24-hydroxylase gene.
            Proc. Natl. Acad.Sci. USA 91, 900-902 (1994)

CYP24       human 
            GenEMBL S67623 (776bp)
            Labuda,M., Lemieux,N., Tihy,F., Prinster,C. and Glorieux,F.H.
            Human 25-hydroxyvitamin D 24-hydroxylase cytochrome P450
            subunit maps to a different chromosomal location than that of
            pseudovitamin D-deficient rickets. 
            J. Bone Miner. Res. 8, 1397-1406 (1993)

CYP24       human
            GenEMBL L13286 (3254bp)
            Chen,K.-S., Prahl,J.M. and DeLuca,H.F.
            Isolation and expression of 1,25-dihydroxyvitamin D3
            24-hydroxylase cDNA.
            Proc. Natl. Acad. Sci. USA 90, 4543-4547 (1993)

CYP24       human

CYP24A1     Pan troglodytes (chimpanzee)
            XM_001154704 end in a seq gap
            96% to CYP24A1 human

CYP24A1     Bos taurus (cow)
            See cattle page for details
5573 HLALCW (0) 5602

CYP24A1      pig 

CYP24A1     Ovis aries (sheep)
            EF635857 (partial)

CYP24A1     Canis familiaris (dog)
            88% to CYP24A1 human

Cyp24        mouse
             GenEMBL D89669, AC084066.1, Mm.6575 

CYP24A1    Gallus gallus (chicken)

CYP24A1     Xenopus tropicalis (Western clawed frog)
            DT404490 Cannot extend in ESTdb
            26514_prot scaffold_125:1595529-1618234 UCSC browser (errors in model)
            67% to CYP24A1 human

CYP24A1     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP24       Fugu rubripes (pufferfish)
            No accession number

CYP24A1   Tetraodon nigroviridis (Green puffer)
          95% to fugu CYP24A1

CYP24A1    Oncorhynchus mykiss (rainbow trout)

25A Subfamily

CYP25A1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z66495 ( 40145bp)
            see CYP14A1 for reference
            cosmid C36A4.1

CYP25A2     Caenorhabditis elegans (nematode worm)
            GenEMBL Z66495 ( 40145bp)
            see CYP14A1 for reference
            cosmid C36A4.2

CYP25A3     Caenorhabditis elegans (nematode worm)
            GenEMBL Z66495 ( 40145bp)
            see CYP14A1 for reference
            cosmid C36A4.3

CYP25A4       Caenorhabditis elegans (nematode worm)
            GenEMBL Z66495 ( 40145bp)
            see CYP14A1 for reference
            cosmid C36A4.6

CYP25A5       Caenorhabditis elegans (nematode worm)
            GenEMBL AF038613
            see CYP14A1 for reference

CYP25A6P       Caenorhabditis elegans (nematode worm)
            GenEMBL U50072
            missing C-terminal

CYP25A7     Caenorhabditis briggsae 
            XP_002641045.1 III - 2035411-2049578

CYP25A8    Caenorhabditis briggsae 
           III + 2052466-2056810

26A Subfamily

Cyp26a1       mouse
            No accession number
            Jim Ray
            submitted to nomenclature committee
            Note: new family in mammals, homolog to human ESTs R51129 and R21282

Cyp26a1      mouse
            No accession number
            Martin Petkovich
            submitted to nomenclature committee
            Note: new family in mammals, homolog to human ESTs R51129 and R21282

Cyp26a1     mouse
            GenEMBL Y12657
            Fujii, H., Sato, T., Kaneko, S., Gotoh, O., Fujii-Kiriyama, Y., 
Osawa, K., 
            Kato, S. and Hamada, H.
            Metabolic inactivation of retinoic acid by a novel P450 
differentially expressed in 
            developing mouse embryos.
            EMBO J. 16, 4163-4173 (1997)
            Note: new family in mammals, homolog to human ESTs R51129 and R21282

Cyp26a1     mouse
            GenEMBL Y12657 NM_007811 EST AA239785
            no UNIGENE entry 

Cyp26a1  rat 

CYP26A1     human
            GenEMBL NM_000783
            White,J.A., Beckett-Jones,B., Guo,Y.D., Dilworth,F.J., Bonasoro,J.,
            Jones,G. and Petkovich,M.
            cDNA cloning of human retinoic acid-metabolizing enzyme (hP450RAI)
            identifies a novel family of cytochromes P450
            J. Biol. Chem. 272 (30), 18538-18541 (1997)
            Note: new family in mammals, equal to human ESTs R51129 and R21282

CYP26A1     human

CYP26A1     Pan troglodytes (chimp)
            XM_001147866.1 3 aa diffs to human

CYP26A1     Bos taurus (cow)
            See cattle page for details

CYP26A1   Sus scrofa (miniature pig) 
          no accession number
          Haitao Shang
          Submitted to nomenclature committee May 23, 2007
          partial sequence
          92% to human 26A1, full seq. constructed from ESTs
          Ortholog of human CYP26A1

CYP26A1   Sus scrofa (pig) 
          Pig ESTs CN161524.1, CN162920.1, CF179212.1, DY434075.1, 
          CF180567.1, CN165481.1, 
          93% to human 26A1

CYP26A1     Canis familiaris (dog)

CYP26A1    Gallus gallus (chicken)

CYP26A1     Xenopus tropicalis (Western clawed frog)
            NM_001016147.2 (seq gap) CX456558.2 CX423895.2 CX424757.1
            69% to human CYP26A1

CYP26A1a   Xenopus laevis (African clawed frog)
           GenEMBL AF057566
           Hollemann,T., Chen,Y., Grunz,H. and Pieler,T.
           Regionalized metabolic activity establishes boundaries of retinoic
           acid signalling.
           EMBO J. 17, 7361-7372 (1998)

CYP26A1a   Xenopus laevis (African clawed frog)
           BG553607 df04c02.seq 15 BG555211 de99c02.x1 BG486543 dd01g02.x1 
           BE191823 db83b11.x1 AW198806 da06g04.x1 AW639706 bl86a09.w1 AW641576 
           cm08h09.w1 AW766054 da81f06.y1 BG161868 df69e06.x1 BE188917 db61c05.x1 
           AW460650 da29g11.x1 AW767659 da77a02.x1 AW640733 bl98d01.w1 AW199734 
           da06g04.y1 AW595907 da29g11.y2 AI031132   BE506442 db83b11.y1 BG038344 
           dg34a01.y1 BG486410 dc93f02.x1 AF057566   BG578446 de99c02.y1
           SwissProt CP26A

CYP26A1b   Xenopus laevis (African clawed frog)
           AW765767 da77a02.y1 1-204 BE189825 88% 42-271
           AW199734 da06g04.y1 BF047649 dc80h02.y1 BF426259 df69e06.y1
           BG364937 dc93f02.y1 BG408452 dd01g02.y1
           SwissProt Q5HZS9 100% to first 202 aa then diverges
           Presumed ohnolog to CYP26A1a X. laevis
           89% to CYP26A1a X. laevis

CYP26A1     zebrafish
            GenEMBL U68234 
            White, J.A., Guo, Y.-D., Baetz, K., Beckett-Jones, B., Bonasoro, J.
            Hsu, K.E., Dilworth, F.E., Jones, G. and Petkovich, M. 
            Identification of the retinoic acid-inducible all trans retinoic 
acid 4-hydroxylase.
            J. Biol. Chem. 271, 29922-29927 (1996) 
            Note: new family in vertebrates, homolog to human ESTs R51129 and 

CYP26A1   Fugu rubripes (pufferfish)
          ChrUn:295602053-295604410  (-) strand UCSC browser
          Scaffold_12575 (old)
          66% to 26A1 human
          revised 5/20/2010

CYP26A1   Tetraodon nigroviridis (Green puffer)
          89% to fugu CYP26A1

CYP26B1    human
           GenEMBL AC007002
           Nelson, D.R. A second CYP26 P450 in humans and zebrafish: CYP26B1
           Archives of Biochemistry and Biophysics 371, 345-347 (1999)

CYP26B1    Pan troglodytes (chimpanzee)
           99% (2 aa diffs) to human 

CYP26B1     Bos taurus (cow)
            See cattle page for details

CYP26B1     pig 
            AK238570.1, CJ034657.1 
            aa 88-142

CYP26B1     Canis familiaris (dog)

Cyp26b1    mouse 
           GenEMBL AC022779.3 AW047279 GSS AZ741670, AZ369731, BM936625.1

Cyp26b1  rat 

CYP26B1   chicken
          missing N-term, 86% to CYP26B1 human

CYP26B1     Taeniopygia guttata (zebrafinch) 
            chr4_random:4476367-4492499 UCSC browser
aa 67-143 missing in a seq gap

CYP26B1     Xenopus tropicalis (Western clawed frog)
            CX905408.1 CX388776.2 CX940676.2 
            82% to human 26B1 

CYP26B1    Xenopus laevis (African clawed frog)
           SwissProt B5A5V8 
           97% to X. tropicalis
           missing some N-term and some C-term

CYP26B1     Danio rerio (zebrafish) 
            See zebrafish pages for seq

CYP26B1     Fugu rubripes (pufferfish)
            No accession number
            74% to 26B1 human
18119 NSIGDIHRKKRK 18154

CYP26B1   Tetraodon nigroviridis (Green puffer)
          99% to CYP26B1 fugu

CYP26C1    human 
           GenEMBL AL358613.11 May 2, 2001
           522 amino acids, 6 exons, (0) = phase 0 intron
           52% to 26B1 human, also 15 amino acid insertion in exon 5 vs. 26B1

CYP26C1    Pan troglodytes (chimpanzee)
           XM_003312686 revised
           99% (2 aa diffs) to human

CYP26C1     Bos taurus (cow)
            See cattle page for details

CYP26C1     Canis familiaris (dog)
            XM_845174.1 partial, end in a seq gap, 
            91% to human

CYP26C1     mouse 
            GenEMBL AC110212.1
            84% to 26C1 human exon 5

Cyp26c1      mouse 
             GenEMBL XM_140712.1 May 17, 2002 also AC110212.4
     ELAVELL 987

Cyp26c1  rat 

CYP26C1   chicken
          XP_421678, XM_421678.2
          70% to CYP26C1
541 HGGEA 

CYP26C1     Xenopus tropicalis (Western clawed frog)
            CX830022.1 CN120927.1 CR567555.1 CX376643.2 CR567556.1
            65% to human 26C1 
            note this seq has in insertion compared to human, but
            the insertion is supported by several ESTs and is real
            also seen in X. laevis (see below)

CYP26C1   Xenopus laevis (African clawed frog)
          BG264135 de80c01.y1 BG439345 de80c01.x1 
          67% to 26C1 human, 57% to 26B1 human, 45% to 26A1 human

CYP26C1   Xenopus laevis (African clawed frog)
          SwissProt Q2T9K4, GenEMBL BC111476
          Deleted some poor sequence at the C-term (see above)

CYP26C1     Danio rerio (zebrafish) 
            BC129131.1, NM_001029951.2
            Zv8 Chr 17 17124710-17134145 (+) strand 100%
            Note: this is revised from an earlier version

CYP26C1P    Fugu rubripes (pufferfish)
            No accession number
            Equally similar to 26B1 and 26C1 human
            But C-terminal is 68% to 26C1 while 58% to 26B1
            Lower case region very poor match may not be correct 
            exon structure here.
            Danio has cDNA for CYP26C1. It is 21 amino acids longer
            Than pufferfish genomic DNA can code for.
            Therefore, Pufferfish have either shortened CYP26C1 or they
            are now pseudogenes

CYP26C1P   Tetraodon nigroviridis (Green puffer)
           missing some seq in the middle and frameshited
           ~81% to fugu CYP26C1
           Danio has cDNA for CYP26C1. It is 21 amino acids longer
           Than pufferfish genomic DNA can code for.
           Therefore, Pufferfish have either shortened CYP26C1 or they
           are now pseudogenes

27A Subfamily

CYP27A1     human
            Swiss Q02318 (531 amino acids)
            Cali J.J., Russell D.W.
            Characterization of the human sterol-27-hydroxylase: A mitochondrial 
            that catalyzes multiple oxidation reactions in bile acid 
            J. Biol. Chem. 266, 7774-7778 (1991)

CYP27A1     human
            GenEMBL X59812 (2107bp)
            Guo,Y., Strugnell,S., Back,D.W. and Jones,G.
            Transfected human liver cytochrome P-450 hydroxylates vitamin D
            analogs at different side-chain positions
            Proc. Natl. Acad. Sci. U.S.A. 90, 8668-8672 (1993)

CYP27A1     human

CYP27A1     Pan troglodytes (chimpanzee)
            99% (3 aa diffs) to human 

CYP27A1     Macaca fasicularis (cynomolgus monkey)
            Yasuhiro Uno
            Submitted to nomenclature committee 1/11/2005
            Clone name mfCYP27A1_18D1
            100% to AB125162, 97% to human

CYP27A1     Macaca fasicularis (cynomolgus monkey)
            GenEMBL AB125162
            Kusuda,J., Osada,N., Tanuma,R., Hirata,M., Sugano,S. and
            Isolation and characterization of cDNA for macaque neurological
            disease genes
            Unpublished, partial seq

CYP27A1     Papio hamadryas (hamadryas baboon)

CYP27A1     Bos taurus (cow)
            See cattle page for details

CYP27A1   Sus scrofa (miniature pig) 
          no accession number
          Haitao Shang
          Submitted to nomenclature committee May 23, 2007
          partial sequence
          3 amino acid differences to complete seq AK232936.1
          Ortholog of human CYP27A1

CYP27A1   pig 

CYP27A1     Canis familiaris (dog)

CYP27A1     rat
            GenEMBL M73231 (2300bp)
            Shayiq,R.M. and Avadhani,N.G.
            Sequence complementarity between the 5'-terminal regions of mRNAs 
            rat mitochondrial cytochrome P-450c27/25 and a growth hormone-
            serine protease inhibitor: a possible gene overlap.
            J. Biol. Chem. 267, 2421-2428 (1992)

CYP27A1    rat
           GenEMBL U17363, U17369 to U17376 genomic sequence
           Mullick, J., Addya,S., Sucharov,C. and Avadhani,N.G.
           Localization of a transcription promoter within the second exon of
           the cytochrome P-450c27/25 gene for the expression of the major
           species of two-kilobase mRNA.
           Biochemistry 34, 13729-13742 (1995)

Cyp27a1    mouse
           GenEMBL 8 ESTs follow AI286988 AK004977.1 Mm.26793

CYP27A1     Mesocricetus auratus (hamster)

CYP27A1     rabbit
            PIR A90152 (21 amino acids)
            Dahlbaeck, H.
            Characterization of the liver mitochondrial cytochrome P-450
            catalyzing the 26-hydroxylation of 5beta-cholestane-3alpha,
            Biochem. Biophys. Res. Commun. 157, 30-36 (1988)

            PIR A90155 (21 amino acids)
            Dahlbaeck, H.
            Biochem. Biophys. Res. Commun. (1989) 159:370

CYP27A1     pig
            no accession number
            Kjell Wikvall
            77% identical to human

CYP27A1     Monodelphis domestica (gray short-tailed opossum)

CYP27A1     chicken
            COMPLETE 53% TO 27A1 human 
            N-term is long, may be in error

CYP27A1X    Xenopus tropicalis (Western clawed frog)
            See Xenopus CYP27A8, CYP27A9, CYP27A10 and CYP27A12

CYP27A1     Fugu rubripes (pufferfish)
            No accession number
            46% to 27A1 human

CYP27A1    Tetraodon nigroviridis (Green puffer)
           chr2:17054633-17057366 at UCSC browser 
           One frameshift at &
           Adjacent to BCS1L and ZNF142 as in humans
           84% to CYP27A1 fugu

CYP27A2     Fugu rubripes (pufferfish)
            chrUn:122717928-122721737 on UCSC browser
            or Scaffold_697
            41% to 27A1 mouse, 49% to 27A3 Fugu, 42% to 27A1 Fugu
            38% to 27C1 Fugu
            adjacent to MAP3K2 and SUMO1
            note: MAP3K2 is next to ERCC3 in humans that is adjacent to CYP27C1
            Fugu 27C1 is adjacent to ERCC3 
            Therefore CYP27A2 and CYP27C1 had a common origin

CYP27A2P   Tetraodon nigroviridis (freshwater pufferfish)
           GSCT00017845001_prot length=460
           chr3:953742-956387 UCSC browser
           adjacent to MAP3K2 and SUMO1
           frameshift and 11 aa deletion at &1
           frameshift at &2
           73% to CYP27A2 Fugu
           note in zebrafish, MAP3K2 is adjacent to CYP27C1, ERCC3

CYP27A3     Fugu rubripes (pufferfish)
            No accession number
            Scaffold_6002 Length = 16767 
= LGS139924.x1 57% to 27A1 I-helix
= LGS125183.x1 Cyp27a1 
First 16 aa and 49-81 supported by EST from AU050037 Paralichthys olivaceus
aa 49 on also supported by AW343479 zebrafish EST
     in pufferfish 27A3 is between EAF2 and SLC15A2
     these two genes are adjacent in humans but 27A3 is gone.

CYP27A fragment a  Fugu rubripes (pufferfish)
                   No accession number
a = exon 4 of 27A3 
LPC42076.x1 39% to 27A1 202-276 79% to LPC42075.x1 gene duplication? Exon 4

CYP27A fragment b  Fugu rubripes (pufferfish)
                   No accession number 
Similar to exon 4 of 27A3 
LPC42075.x1 35% to 27A1 79% to LPC42076.x1 gene duplication? Exon 4

CYP27A3    Tetraodon nigroviridis (freshwater pufferfish)
           chr2:18232734-18236941 UCSC browser
           between EAF2 and SLC15A2
           81% to CYP27A3 fugu

CYP27A3    Danio rerio (zebrafish)
           Zv8 chr9:22363585-22376628  100% match
           7 aa diffs from our earlier version

CYP27A3     Danio rerio (zebrafish) [older version]
            4 aa diffs to seq on chr9:16358844-16371887 UCSC browser
            EST DR721514.1, DN833321.1, DT066990.1, CD283382.1,
            CR928406.1, CD599037.1, DT059155.1
            These cover the whole seq with about 2 aa diffs
            69% to CYP27A3 Fugu probable ortholog adjacent to EAF2 in both

CYP27A3    Oryzias latipes (medaka)
           chr21:6587265-6596897 UCSC browser
           adjacent to EAF2

CYP27A3    Gasterosteus aculeatus (three-spined stickleback)
           chrUn:42545325-42552979 UCSC browser
           adjacent to EAF2
           note EAF2 and SLC15A2 are present in lizard 
           but no CYP27A3 is between them (lost on the way to tetrapods)

CYP27A3    Osmerus mordax (Rainbow Smelt)
           EL545126 EST
           75% to 27A3 zebrafish N-term

CYP27A4     Danio rerio (zebrafish)
            BX321915.3, BC055637 60% to 27A1 fugu
            Temp name CYP27A.d
            2 aa diffs to chr9:32649613-32658960 UCSC browser

CYP27A5    Danio rerio (zebrafish)
           Temp name CYP27A.c 
           100% to chr9:32660646-32665857
           59% to 27A1 fugu

CYP27A6    Danio rerio (zebrafish)
           Temp name CYP27A.b
           100% to chr9:32668191-32674283 (+)
           61% to 27A1 fugu

CYP27A7    Danio rerio (zebrafish)
           Temp name CYP27A.a 
           100% to UCSC browser chr9 32687123-32697779 (+) strand
           59% to 27A1 fugu zfishG-a34c11.p1c

CYP27A8-de4b5b   Xenopus tropicalis (Western clawed frog)
                 exons 4 and 5 only
                 scaffold_77:1644664-1645797 (-) strand UCSC browser

CYP27A8    Xenopus tropicalis (Western clawed frog)
           DR832386.1 CX969640.1 DR852196.1
           scaffold 77 1626758-1638467 (-) strand UCSC Browser
           old CYP27A1 Xenopus
           best X.tropicalis hit to CYP27A1 hum in ESTdb 
           best match in human = CYP27A1 55%, 
           probably a CYP27A1 ortholog
           scaffold_77:1626758-1638467 (-) complete in UCSC browser
           Trace archive 570051728(+), walked to 411568263(+) 494948503(+)
           54% to 27A7 zebrafish, 50% to 27A3 zebrafish, 50% to 27A1 human
           this seq is near BCS1L and ZNF142 like human CYP27A1 

CYP27A9    Xenopus tropicalis (Western clawed frog)
           AL787054.2 DT421274.1 CR427561.1 BC094536.1
           note there are three adjacent CYP27A genes in Xenopus
           50% to 27A1 human, 42% to 27B1 human and 38% to 27C1 human
           52% to 27A5 zebrafish, 51% to 27A3 zebrafish
           scaffold_77:1590575-1599619 (-) strand, 11 aa diffs in first half
           exon 6 missing in genome assembly

CYP27A10   Xenopus tropicalis (Western clawed frog)
           CX393015 DR862140.1 DN030991.1 
           49% to 27A1 human
           scaffold_31:1,728,368-1,736,213 19854_prot UCSC browser
           scaffold_77:1580461-1588306  (-) strand complete in UCSC browser
           53% to 27A7 zebrafish, 48% to 27A3 zebrafish

CYP27A11    Petromyzon marinus (Lamprey)
            Contig1559:9792-24354 at UCSC browser,  EST FD706879.1
            adjacent to RQCD1 which is near CYP27A1 human 
            (about 7 genes away)
            This is probably the ortholog of CYP27A1 
            51% to 27A3 zebrafish, 46% to 27A1 human, 48% to 27A5, 27A6 zebrafish

CYP27A12   Xenopus tropicalis (Western clawed frog)
           SwissProt B1H1B1 
           scaffold 77 1642228-1648152 (-) strand
           66% TO CYP27A8

CYP27A12   Xenopus laevis (African clawed frog)
           SwissProt Q6DE36 
           56% CYP27A13av1, 86% to CYP27A12 X. tropicalis (ortholog)

CYP27A13av1   Xenopus laevis (African clawed frog)
              SwissProt A8E5X9, GenEMBL EB474537.1
              6 aa diffs to composite 93% to CYP27A13b

CYP27A13av2   Xenopus laevis (African clawed frog)
              SwissProt Q32NH3 
              4 aa diffs to CYP27A13av1
              84% to CYP27A10 (ortholog?)

CYP27A13 composite seq.   Xenopus laevis (African clawed frog) 
            BG554727 dac30e04.y1 BG731192 dae11g03.y1
            BG345818 dg41f04.y1 BG023437 dg41f04.x1  BG348981 daa35e09.x1 
            BG552024 dae12f10.x1
            BG515454 dae07h01.y1 BG731762 dac30e04.x1
            46% to 27A1 39% to 27B1 35% to 27C1 so this is a 27A homolog

CYP27A13b   Xenopus laevis (African clawed frog)
            SwissProt A1A609 
            93% to the composite seq., 85% to CYP27A10
            presumed ohnolog to CYP27A13a

27B Subfamily

CYP27B1 rat
            GenEMBL AF000139
            St-Arnaud,R., Messerlian,S., Moir,J.M., Omdahl,J.L. and
            The 25-hydroxyvitamin D 1-alpha-hydroxylase gene maps to the
            pseudovitamin D-deficiency rickets (PDDR) disease locus
            J. Bone Miner. Res. 12, 1552-1559 (1997)
            previously named CYP40. This sequence has errors in it.

CYP27B1 rat
            GenEMBL AB001992
            Cloning and expression of rat 25-hydroxyvitamin D3-1-alpha-
hydroxylase cDNA .
            Shinki, T., Shimada, H., Wakino, S., Anazawa, H., Hayashi, M.,
            Saruta, T., DeLuca, H.F. and Suda, T.
            Proc. Natl. Acad. Sci. USA  94, 12920-12925 (1997)
            Note: this sequence has been called CYP27B1 in this paper.  The name 
CYP40 was        
            given in May 1997 based on the sequence from John Omdahl that was 
            completely accurate at the time of submission for a name.  It was 
necessary to 
            revise the name CYP40 to CYP27B1.

CYP27B1      mouse
          GenEMBL AB006034
          Takeyama, K-i., Kitanaka, S., Sato, T., Kobori, M., Yanagisawa, J. and 
Kato, S.
          25-hydroxyvitamin D3 1 alpha hydroxylase and vitamin D synthesis.
          Science 227, 1827-1830 (1997)

Cyp27b1      mouse
             GenEMBL AB006034 AC084293.2 Mm.6216

The mouse and probably rat have lost 27C1 due to a chromosome rearrangement between BIN1 and ERCC3
It seems that 27C1 was broken and lost in this event.
In fugu CYP27C1 is on the minus strand of scaffold 106 from 31916-36680 the 
neigboring gene, 2624 bp away, is ercc3 at 39305-43553 minus strand (also found in human 39kb away)
Therefore, this linkage is very old. The next gene in the series ERCC3, CYP27C1 is BIN1 in human.
In mouse chr 1 is syntenic to human chr 2 at ERCC3, but BIN1 is on chr 18, implying a chromosome break.

CYP27B1        human
           GenEMBL AB005989 cDNA sequence
           Takeyama,K., Kitanaka,S., Sato,T., Kobori,M., Yanagisawa,J. and 
           25-Hydroxyvitamin D3 1alpha-hydroxylase and vitamin D synthesis
           Science 277, 1827-1830 (1997)

CYP27B1      human
            GenEMBL AB005990 gene sequence
            Murayama,A., Kitanaka,S., Takeyama,K. and Kato,S.
            Human 25-hydroxyvitamin D3 1alpha-hydroxylase gene
            Unpublished (1997)

CYP27B1     human
            GenEMBL AB005038 cDNA sequence AB006987 gene sequence
            Monkawa,T., Yoshida,T., Wakino,S., Shinki,T., Anazawa,H.,
            Deluca,H.F., Suda,T., Hayashi,M. and Saruta,T.
            Molecular cloning of cDNA and genomic DNA for human
            25-hydroxyvitamin D3 1alpha-hydroxylase
            Biochem. Biophys. Res. Commun. 239, 527-533 (1997)

CYP27B1     human
            GenEMBL AF020192 cDNA sequence
            Fu,G.K., Lin,D., Zhang,M.Y., Bikle,D.D., Shackleton,C.H.,
            Miller,W.L. and Portale,A.A.
            Cloning of human 25-hydroxyvitamin D-1alpha-hydroxylase and
            mutations causing vitamin D-dependent rickets type 1
            Mol. Endocrinol. 11, 1961-1970 (1997)

CYP27B1     human
            GenEMBL AF0027152 gene sequence
            Fu,G.K., Portale,A.A. and Miller,W.L.
            Complete structure of the human gene for the vitamin D 1alpha-
            DNA Cell Biol. 16, 1499-1507 (1997)

CYP27B1     human

CYP27B1     Pan troglodytes (chimpanzee)
            99% (2 aa diffs) to human 

CYP27B1     Bos taurus (cow)
            See cattle page for details

CYP27B1    Equus caballus (horse)

CYP27B1     pig 

CYP27B1     Canis familiaris (dog)
            88% TO HUMAN CYP27B1

CYP27B1     Xenopus tropicalis (Western clawed frog)
            scaffold_67:1250110-1259521 in UCSC browser
            this gene is between MARCH9 and METTL1 LIKE human 27B1
            54% to human
            63% to 27B1 zebrafish, 48% to 27A3 zebrafish, 54% to 27B1 human

CYP27B1     Danio rerio (zebrafish) 
            72% TO 27B1 FUGU
379 RLHQLQ 362 ()
163 YGLLT 149 ()
338 YRFGLEG 358 ()
452 RCWDVMFEF 478 ()

CYP27B1     Fugu rubripes (pufferfish)
            No accession number
            52% to 27B1 human

CYP27B1    Tetraodon nigroviridis (freshwater pufferfish)
           93% to CYP27B1 fugu

CYP27C1     human
            GenEMBL AC027142
            BM562765 BI459427 ESTs 
            43% identical to 27A1 assembled gene
intron starting with QIH ending in VDT is from Celera's data
CRA_Gene|hCG42613 /len=10487.  This Celera sequence is still missing the C-terminal. Probable last exon is now found in AC027142.  AG Intron boundary is in the same location as CYP26B1.  Stop codon is one codon away from 26B1s stop codon.  Length is preserved from cys to intron. (n) = intron phase, 9 exons

291  41563 RSWDGLFKFS 41534 300 (1)
411 108566 LFPVLPGNGRVTQEDLVIGGYLIPKG (0) 108489 436

CYP27C1    Pan troglodytes (chimp)
           XM_525906.3 1 aa diff to human, missing the N-term

The mouse and probably rat have lost 27C1 due to a chromosome rearrangement between BIN1 and ERCC3
It seems that 27C1 was broken and lost in this event.
In fugu CYP27C1 is on the minus strand of scaffold 106 from 31916-36680 the 
neigboring gene, 2624 bp away, is ercc3 at 39305-43553 minus strand (also found in human 39kb away)
Therefore, this linkage is very old. The next gene in the series ERCC3, CYP27C1 is BIN1 in human.
In mouse chr 1 is syntenic to human chr 2 at ERCC3, but BIN1 is on chr 18, implying a chromosome break.

CYP27C1     Bos taurus (cow)
            See cattle page for details
477 TGLISA 494

CYP27C1     Canis familiaris (dog)
            XM_540989.2 revised 
            85% to CYP27C1 human

CYP27C1    Gallus gallus (chicken)
           GenEMBL BU235126 BU209688
           Partial seq missing N and C-terminals
           78% to Silurana 27C1 82% to human 27C1

CYP27C1   chicken 
          80% to human, complete

CYP27C1   Xenopus (Silurana) tropicalis (Western clawed frog)
          GenEMBL BQ392731 AL629634 AL595312 
          NM_001011341.1 CX494774.2 
          74% to human 27C1 not counting the divergent N-terminal
          87% to Xenopus laevis 27C1

CYP27C1    Xenopus tropicalis (Western clawed frog)
           scaffold_893:261736-267439 exon 3 missing in a gap and 
           last half not on this scaffold
           N-term adjacent to ERCC3 as in zebrafish and human 27C1
           scaffold_4119:30-1794 has second half of gene 100% match
           NM_001011341.1 short at N-term (58 aa) CX494774.2 68% to human
           from refseq database
           70% to 27C1 zebrafish

CYP27C1a   Xenopus laevis (African clawed frog)
           GenEMBL BJ086834 CA982419 BQ385474 BJ069739
           87% to X. tropicalis 27C1
           lower case does not match SwissProt Q4KLS4
53aa gap see Tropicalis seq and X. laevis SwissProt Q4KLS4

CYP27C1a   Xenopus laevis (African clawed frog)
           SwissProt Q4KLS4 (missing the N-term)

CYP27C1a   Xenopus laevis (African clawed frog)
           AW637606 bl60c07.w1, BE669236 dc59c04.y1
           N-term 75% to 27C1 human 

CYP27C1b   Xenopus laevis (African clawed frog)
           SwissProt Q66IQ5 
           92% to CYP27C1a Q4KLS4 (presumed ohnolog)

CYP27C1     Danio rerio (zebrafish) 
            ctg14633 zebrafish 70% TO FUGU CYP27C1
58306 EMHLALTQ (0)

CYP27C1     Fugu rubripes (pufferfish)
            chrUn:4630123-4635029 UCSC browser
            75% to 27C1 human
            adjacent to ERCC3

CYP27C1     Tetraodon nigroviridis
            chrUn_random:116718046-116719086 UCSC browser
            N-term exons 1 and 2 only, adjacent to ERCC3
            63% to Fugu CYP27C1
            rest of gene in a sequence gap

CYP27C1 mouse and rat
        Mouse is missing this sequence in blast searches.  In humans it lies between 
        BIN1 and ERCC3 on chr 2.  This region does not contain 27C1 in mouse (chr 18)
        unless there is a sequence gap.  Blast of the rat genome 
        (Rat Genome Sequencing Consortium Assembly Posted date:  Dec 4, 2002)
        also had no hits, so 27C1 may have been lost in rodent evolution.
        It is present in human, Fugu, Xenopus, Silurana (another frog) and chicken.
        The absence of 27C1 may be a useful synapomorphy for comparing rodents to other mammals.

CYP27D1    Petromyzon marinus (Lamprey)
           Contig17808:3625-10857 (-) strand
           missing N-term exon in a sequence gap
           This sequence is more like CYP27A3 or CYP27B1
           47% to CYP27A3 Fugu

Traces from next contig upstream
All of these are in a long repeat sequence
Cannot find a mate pair seq that is outside of the repeat.
1193719280, 1255501914, 1472630360, 1470299497, 1467953899, 1466704577,
1443851513, 1447257494, 1196739470, 1266761373, 1466575034
1466508070, 1266008803, 1193867804, 1443531934, 1468578376

Similar gene exon 2, trace 1467681227 Petromyzon 
(mate = 1468976488 exon 5)

CYP27E1     Branchiostoma floridae (Amphioxus) 
            40% to 27B1 Fugu, 37% to 27C1 fugu, 
            40% to 27A1 fugu (but not first exon)
            35% to 11A1 fugu, 34% to CYP24 fugu (Best match to CYP27B)

CYP27F1    Strongylocentrotus purpuratus 
           XP_790546.2 CX682858.1 EST
           CYP27B like 40% to 27A in Xenopus
           Missing C-terminal 

28A Subfamily

CYP28A1    Drosophila mettleri
             GenEMBL U89746 (1895bp)
             Danielson,P.B., MacIntyre,R.J. and Fogleman,J.C.
             Molecular cloning of a family of xenobiotic-inducible drosophilid
             cytochrome p450s: evidence for involvement in host-plant
             allelochemical resistance.
             Proc. Natl. Acad. Sci. U.S.A. 94, 10797-10802 (1997)
             note: 369mt, full length, one of 109 seqs submitted to Nomenclature 

CYP28A2    Drosophila mettleri
             GenEMBL U89747 (1764bp)
             Danielson,P.B., MacIntyre,R.J. and Fogleman,J.C.
             Molecular cloning of a family of xenobiotic-inducible drosophilid
             cytochrome p450s: evidence for involvement in host-plant
             allelochemical resistance.
             Proc. Natl. Acad. Sci. U.S.A. 94, 10797-10802 (1997)
             note: 43mt, full length, one of 109 seqs submitted to Nomenclature 

CYP28A3    Drosophila nigrospiracula (a desert dwelling Drosophilid)
             GenEMBL U91565 (451bp)
             Danielson,P.B., MacIntyre,R.J. and Fogleman,J.C.
             Molecular cloning of a family of xenobiotic-inducible drosophilid
             cytochrome p450s: evidence for involvement in host-plant
             allelochemical resistance.
             Proc. Natl. Acad. Sci. U.S.A. 94, 10797-10802 (1997)
             54 amino acids

CYP28A4      Drosophila hydei (a desert dwelling Drosophilid)
             GenEMBL U91566 (366bp)
             Danielson,P.B., MacIntyre,R.J. and Fogleman,J.C.
             Molecular cloning of a family of xenobiotic-inducible drosophilid
             cytochrome p450s: evidence for involvement in host-plant
             allelochemical resistance.
             Proc. Natl. Acad. Sci. U.S.A. 94, 10797-10802 (1997)
             54 amino acids

Cyp28a5     Drosophila melanogaster
            GenEMBL AC018242 6065-8082 also AC001660

Cyp28a5     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP28B1     Musca domestica (housefly)
            no accession number 
            Nannan Liu
            44% identical to 28A1 over 498 amino acids
            submitted to nomenclature committee 7/29/99

Cyp28c1     Drosophila melanogaster
            GenEMBL AC014191 comp(8254-10002) also AL133495

Cyp28c1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp28d1     Drosophila melanogaster
            GenEMBL AC017780 comp(28385-30262) also AC009355 AC008324 AC008327

Cyp28d1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp28d2     Drosophila melanogaster
            GenEMBL AC017780 comp(31545-33456) AC008324

CYP28E1     Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee March 17, 2005
            Clone name Lc_CYP28D 
            48% to 28D1 (148 aa)

CYP28F1     Bactrocera orientalis (oriental fruit fly)
            No accession number
            Yong Huang
            Submitted to nomenclature committee March 16, 2012
            49% to Cyp28d1 Drosophila melanogaster

29A Subfamily

CYP29A1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z69787 and AL022276 (Y102F5)
            C44C10.2 (with modifications)
            note: GeneFinder translation is incorrect in some regions.
            First exon probably ends at 11181 coding for 35 amino acids as does 
the first exon 
            of CYP29A2.  
            There is probably a sequence error in the stop codon at 11155-11157.
            2nd exon probably runs from 11227-11293.
            11400-11518 is the third exon.
            12465 to 12979 should be one exon.
            There is probably a sequence error in the stop codon at 12879-12881.
            some segments around I-helix missed by genefinder.  N-terminal of 
            genefinder translation is probably a different gene. Matches 
F23A7.3, but this gene 
            does not have a P450 sequence downstream.

CYP29A2   C. elegans
          GenEMBL Z74043
          nearly the whole gene of wEST00713, CEMSH91R, missing 5' end

CYP29A2   C. elegans
          GenEMBL Z74040
          5' end of gene from Z74043

CYP29A2   Caenorhabditis briggsae ortholog
          XP_002636467.1 V - 7235792-7237902

CYP29A3    C. elegans
           no accession number
           Y108G3 contig 541

CYP29A4    C. elegans
           GenEMBL Z99102

CYP29A4    Caenorhabditis briggsae ortholog
           XP_002637596.1 V + 11212878-11215991 

CYP29A5    Caenorhabditis briggsae 
           XP_002637200.1 V - 7589851-7591489

CYP29A6    Caenorhabditis briggsae 
           XP_002637594.1 V + 11205486-11207316
CYP29A7    Caenorhabditis briggsae 
           XP_002637595.1 V + 11208539-11210751

CYP29A8    Caenorhabditis briggsae 
           XP_002638306.1, XP_002638307.1 V + 14216296-14221511

CYP29A9    Caenorhabditis briggsae 
           XP_002645410.1 possible ortholog to CYP29A1

30A Subfamily

CYP30A1    Mercenaria mercenaria (northern quahog, a clam)
           GenEMBL AF014795 (1628bp)
           Brown, D., Clark,G.C. and Van Beneden,R.J.
           A novel cytochrome P450 from the clam, Mercenaria mercenaria

CYP30B1    Mytilus edulis (blue mussel)
           38% to CYP30A1

31A Subfamily

CYP31A1P    C. elegans
          GenEMBL Z68213
          missing 25 amino acids at C-helix plus in frame stop codon at ERK*

CYP31A2    C. elegans
          GenEMBL Z68336 and Z92789
          F22B3 and H02I12
          This gene is definitely different than CYP31A3, there are 8 amino 
acids differences 
           and the introns are divergent.

CYP31A3    C. elegans
          no accession number
          T16C6 this sequence revised according to Y17G9.contig 61
          cosmid T16C6 lies 3' of E04A4 and 5' of R11E3.  Y17G9 contig 61 covers 
          region.  E04A4 ends at 29981 of Y17G9 contig 61 R11E3 starts at 49037 
of Y17G9 
          contig 61 this sequence lies between 41545-45037

CYP31A4P     C. elegans
          no accession number
          Pseudogene related to CYP31A sequences 44849-45028 of Y17G9.contig61 
          C-TERMINAL exon  fragment,  This sequence is inside the last intron of 

CYP31A5P  C. elegans

CYP31A6   Caenorhabditis briggsae 
          XP_002634204.1 84% to CYP31A2 83% to CYP31A3

CYP31B1     Uncultured nematode from host Ips paraconfusus 
            (California fivespined ips, bark beetle)
            Dezene Huber
            Submitted to nomenclature committee May 19, 2005
            54% to CYP31A2 C. elegans over 456aa
            missing 5' end (no signal peptide) 
            nematode contamination, not an insect-like sequence

32A Subfamily

CYP32A1   C. elegans
          GenEMBL U53148

CYP32A1    Caenorhabditis briggsae ortholog
           XP_002635600.1 87% to CYP32A1

CYP32B1   C. elegans

CYP32B1   Caenorhabditis briggsae ortholog
          XP_002636022.1 79% to CYP32B1 

33A Subfamily

CYP33A1     C. elegans
          GenEMBL U55365

CYP33A1    Caenorhabditis briggsae ortholog
           XP_002648880.1 74% to CYP33A1 

33B Subfamily

CYP33B1      C. elegans
          GenEMBL U50311

CYP33B1    Caenorhabditis briggsae ortholog
           XP_002637457.1 V + 10551777-10554400

33C Subfamily

CYP33C1      Caenorhabditis elegans (nematode worm)
           GenEMBL AF039053
           C45H4.a near 35k

CYP33C2      Caenorhabditis elegans (nematode worm)
           GenEMBL AF039053
           C45H4.b near 38k
           also on Y10C10 contig 60.  Probable end of 33C2 gene is on contig 57, 
           but the intron ends of these two contigs do not overlap yet. 

CYP33C3      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016676
           F41B5.b        5k to 7k

CYP33C3     Caenorhabditis elegans (nematode worm)
          GenEMBL D35162
          EST 5 prime read with heme signature
          3 prime fragment of this clone yk18a10 = D32508 (not in coding region)
          this is a portion of clone YK824

CYP33C4      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016438
           F44C8 whole gene of EST CEL10E1

CYP33C4      Caenorhabditis elegans 
            GenEMBL M88882 (501bp)
            EST CEL10E1 
            2nd frame contains PPGP and KKYG from N-terminal region of
            many P450s.

CYP33C5      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016676

CYP33C6      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016676

CYP33C7      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016676

CYP33C8      Caenorhabditis elegans (nematode worm)
           GenEMBL AF003385

CYP33C9      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016449

CYP33C9    Caenorhabditis briggsae ortholog
           XP_002636010.1 XP_002635453.1 V - 1644227-1646905 

CYP33C10P      Caenorhabditis elegans (nematode worm)
           GenEMBL AF016676
           contains first two exons split by 3700bp and no C-terminal sequence.

CYP33C11      Caenorhabditis elegans (nematode worm)
           no accession number 
           Y49C4 contig 103

CYP32C12P   C. elegans

CYP33C13    Caenorhabditis briggsae 
            XP_002647297.1 V_random + 373194-374835

CYP33C14    Caenorhabditis briggsae 
            XP_002635535.1 V +  1982777-1985243

CYP33C15    Caenorhabditis briggsae 
            XP_002635642.1 XP_002635630.1 found in two locations 

CYP33C16P    Caenorhabditis briggsae 
             XP_002635643. XP_002635629.1 found in two locations

CYP33C17    Caenorhabditis briggsae 
            XP_002636002.1 V - 4132548-4135425

CYP33C18    Caenorhabditis briggsae 
            XP_002636007.1 V - 4148928-4150926

CYP33C19    Caenorhabditis briggsae 
            XP_002636020.1 V - 4182816-4185053

CYP33C20    Caenorhabditis briggsae 
            XP_002636021.1 V + 4185548-4187702

33D Subfamily

CYP33D1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z92804
            K05D4.4 (previously found on F10A3 and F11A5 at early stages of 

CYP33D2X     Caenorhabditis elegans (nematode worm)
            GenEMBL Z92830
            this sequence is really the same gene as CYP33D1

CYP33D3     Caenorhabditis elegans (nematode worm)
            GenEMBL Z81487 (C54E10), AL021470 (Y17D7A.4) and Z98877 (Y69H2)
            GenEMBL AL020988 (Y80D3)

CYP33D4     Caenorhabditis briggsae 
            XP_002645739.1 74% TO CYP33D3

33E Subfamily

CYP33E1     Caenorhabditis elegans (nematode worm)
            GenEMBL U61945

CYP33E2     Caenorhabditis elegans (nematode worm)
            GenEMBL U61952

CYP33E3P     Caenorhabditis elegans (nematode worm)
            GenEMBL U61952
            missing C-terminal    3' neighbor is C49C8 (with CYP33E1)

CYP33E4    Caenorhabditis briggsae 
           XP_002634663.1 XP_002634664.1 IV - 12699946-12707750

CYP33E5    Caenorhabditis briggsae 
           XP_002634646.1 IV - 12849096-12856099 

34A Subfamily

CYP34A1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z81119 and AL022301 (Y75B12)
            There are two P450s listed in this clone as one gene
            This is the first one

CYP34A2     Caenorhabditis elegans (nematode worm)
            GenEMBL Z81119 and AL022301 (Y75B12)
            There are two P450s listed in this clone as one gene
            This is the second one

CYP34A2     Caenorhabditis briggsae ortholog
            XP_002638424.1 XP_002638425.1 

CYP34A3     Caenorhabditis elegans (nematode worm)
            GenEMBL  Z81047 and AL022301 (Y75B12)

CYP34A4     Caenorhabditis elegans (nematode worm)
            GenEMBL AF068712

CYP34A4     Caenorhabditis briggsae ortholog
            XP_002636030.1 V - 4222164-4223954

CYP34A5     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A6     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A7     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A8     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A9     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A10    Caenorhabditis elegans (nematode worm)
            GenEMBL AF039050

CYP34A10    Caenorhabditis briggsae ortholog
            XP_002636034.1 V ? 4237002-4238679
CYP34A11    Caenorhabditis briggsae 
            XP_002636094.1 V ? 4432270-4434247

CYP34A12    Caenorhabditis briggsae 
            XP_002636033.1 V ? 4232695-4234460

CYP34A13P    Caenorhabditis briggsae 
             V  4231472-4232566

CYP34A14    Caenorhabditis briggsae 
            XP_002636032.1 V - 4229054-4230997

CYP34A14-de7c   Caenorhabditis briggsae 
                V  4228265-4228330

CYP34A14-de6b7b  Caenorhabditis briggsae 
                 V  4228478-4228827

CYP34A15    Caenorhabditis briggsae 
            XP_002636031.1 V - 4224268-4227419

CYP34A16    Caenorhabditis briggsae 
            XP_002636141.1 V + 4630347-4632348

35A Subfamily

CYP35A1     Caenorhabditis elegans (nematode worm)
            GenEMBL U97008
            C03G6 near 19k

CYP35A2     Caenorhabditis elegans (nematode worm)
            GenEMBL U97008
            C03G6 near 22k

CYP35A3     Caenorhabditis elegans (nematode worm)
            no accession number

CYP35A4     Caenorhabditis elegans (nematode worm)
            GenEMBL AF016418

CYP35A5     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039049
            K07C6.5 [and part of F40C5 contig 6    9-578 plus strand Note: 
newest version of   
            F40C5 does not contain this P450. probably an error corrected by the 
            It is part of a contig with T09H2 and B0213 that has 13 P450s in a 
            6 P450s on B0213 appear to have inserted themselves into a cluster 
            three olfactory receptor-like genes.  K09D9 is the next clone 3' and 
it has at least 
            one more P450.  C49G7 is next with one more P450 
            Contig order K07C6 T09H2 B0213 K09D9 C49G7

CYP35A6    Caenorhabditis briggsae 
           XP_002635212.1 V  292452-294169 

CYP35A7    Caenorhabditis briggsae 
           XP_002636137.1 V  4616588-4618404

CYP35A7-de7b8b9b  Caenorhabditis briggsae 
                  V + 4618814-4619204 

CYP35A8    Caenorhabditis briggsae 
           XP_002636139.1 V + 4624954-4626736

CYP35A9    Caenorhabditis briggsae 
           XP_002636145.1 V + 4646141-4647941

CYP35A9-de8b  Caenorhabditis briggsae 
              V  4642983-4643048

>CYP35A9-de9b  Caenorhabditis briggsae 
                V  4638516-4638560

CYP35A10 Caenorhabditis briggsae XP_002636136.1 V ? 4648726-4650542 

35B Subfamily

CYP35B1     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039049
            K07C6.4, [F40C5 contigs 5 and 14 Note: newest version of F40C5 does 
            contain this P450. probably an error corrected by the sequencers]

CYP35B2     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039049
            K07C6.3 [and F40C5 contig 15 Note: newest version of F40C5 does not 
            this P450. probably an error corrected by the sequencers]

CYP35B3     Caenorhabditis elegans (nematode worm)
            GenEMBL AF039049

CYP35B4    Caenorhabditis briggsae 

CYP35B5    Caenorhabditis briggsae 
           91% to CYP35B6

CYP35B6    Caenorhabditis briggsae 

35C Subfamily

CYP35C1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z77652

CYP35C1    Caenorhabditis briggsae ortholog

35D Subfamily

CYP35D1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z83105
            F14H3 near 20k

CYP35D1     Caenorhabditis briggsae ortholog
            XP_002638285.1, XP_002638288.1

CYP35D2P     Caenorhabditis elegans (nematode worm)
            GenEMBL Z83105
            F14H3 near 14k
            only N-terminal is present

36A Subfamily

CYP36A1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z83220

CYP36A1    Caenorhabditis briggsae ortholog
           XP_002639478.1 94% to CYP36A1 C. elegans

37A Subfamily

CYP37A1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z81493 (F01D5) and Z92851 (Y39G8)

CYP37A1    Caenorhabditis briggsae ortholog
           XP_002631640.1 83% to CYP37A1

37B Subfamily

CYP37B1     Caenorhabditis elegans (nematode worm)
            GenEMBL Z93381 and Z93389
            F28G4 and T13F3

CYP37B1    Caenorhabditis briggsae ortholog
           XP_002638224.1 75% to CYP37B1

CYP38A1      Suberite domuncula (sponge)
             GenEMBL Y17816 (1789bp)
             Mueller,W.E.G., Wiens,M., Batel,R., Steffen,R., Borojevic,R. and
             Establishment of a primary cell culture from a sponge: Primmorphs
             from Suberites domuncula
             Mar. Ecol. Prog. Ser. In press
             most similar to the CYP4 family

CYP39    human
            GenEMBL EST R07010 R11279 and UNIGENE entry Hs.25121
            covers the C-terminal part of a P450.  The 2 ESTs with coding 
            are not found in UNIGENE, but the opposite end of EST R11279 = 
R11221 and it 
            is in UNIGENE with 13 EST sequences all from the 3 prime noncoding 
            This sequence is most like CYP4A11, but the percent identity is only 
            39%.  Since this is the most conserved region of P450s, the sequence 
must be in a 
            new family.  More sequence is known form the mouse homolog.

CYP39A1    human
           AC008104 AL035670 note heme region exon corrected 1/18/02

CYP39A1    Pan troglodytes (chimpanzee)
           99% (4 aa diffs) to human

CYP39A1   Macaca fasicularis (cynomolgus monkey)
          GenEMBL AB220544.1

CYP39A1   Canis familiaris (dog)
          GenEMBL XM_538946.2

CYP39a1   mouse 
          GenEMBL ESTs AA096922, AA606237
          Note: this sequence has a poorly conserved I Helix 

Cyp39a1    mouse
           GenEMBL NM_018887.1 AF237981 
           39a1 (oxysterol 7alpha-hydroxylase) 72% to human

Cyp39A1  rat 

CYP39A1     Bos taurus (cow)
            See cattle page for details

CYP39A1   Sus scrofa (miniature pig) 
          no accession number
          Haitao Shang
          Submitted to nomenclature committee May 23, 2007
          partial sequence
          80% to human CYP39A1, complete seq constructed from ESTs
          Ortholog of human CYP39A1

CYP39A1   pig 
          ESTs BP441358.1, BP458693.1, CV872464.1, DN131248.1, CB287479.1
          DN131598.1, CN156146.1, DN115951.1, BP166812.1, DN116306.1, CN154029.1, 

CYP39A1   Gallus gallus (chicken)
          GenEMBL BG712800 BG710422 BU226060 AI979980 BU247492 BU226060
          57% TO 39A1 HUMAN

CYP39A1     Xenopus tropicalis (Western clawed frog)
            CX851900.1 CX931743.2 CX956889.1
            51% to human CYP39A1, a CYP39 ortholog

CYP39A1   Xenopus laevis (African clawed frog)
          SwissProt A1A611, 
          91% to CYP39A1 X. tropicalis

CYP39A1   Xenopus laevis (African clawed frog)
          SwissProt Q3KQ11 GenEMBL BC106433.1
          4 aa diffs to CYP39A1 A1A611 X. laevis

CYP39A1     Danio rerio (zebrafish)
            GenEMBL NM_001030189.1

CYP39A1     Salmo salar (Atlantic salmon)
            GenEMBL DW563555.1 CB512602.1 ESTs 
712  WEKADLVKN  738

CYP39A1     Oncorhynchus mykiss (trout)
            GenEMBL BX298944.3 cDNA 
745  TFTAHLV  765

40A Subfamily

CYP40X       rat, mouse, human  (name changed to CYP27B1)

Note: This family was created based on the rat sequence AF000139 submitted to 
the Nomenclature Committee in May 1997.  This was the only sequence available at 
the time and it was about 38% identical to rat CYP27.  The sequence was 
considered a new family and named CYP40.  Since then, there have been additional 
sequences determined for the rat mouse and human homologs.  The rat sequence 
AB001992 differs from the AF000139 sequence at 34 amino acids, mostly in two 
regions that are probably frameshifts.  The sequence AB001992 is 42.3% identical 
to the rat CYP27A sequence. The mouse and human sequences are also more than 40% 
identical to the CYP27A sequence.  Therefore, they belong in the CYP27 family as 
a new subfamily CYP27B1.  Since there only appears to be one gene in each 
species, all three species orthologs will be called CYP27B1.  CYP40 has been 
retired and this is indicated by the X in CYP40X.

41A Subfamily

CYP41A1     Boophilus microplus (southern cattle tick)
            GenEMBL U92732 (414bp)
            Crampton,A.L., Miller,C., Baxter,G.D. and Barker,S.C.
            Expressed sequenced tags and new genes from the cattle tick,
            Boophilus microplus.
            Exp. Appl. Acarol. 22 (3), 177-186 (1998)
            EST is from the middle of the P450 
            whole sequence known but still confidential.

CYP41A2     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41B1     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C1     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C2     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C3     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C4     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C5     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C6v1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C6v2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C7     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C8     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C9     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C10    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C11    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C12    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C13    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C14    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41C15    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP41D1     Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

42A Subfamily

CYP42A1     C. elegans
            GenEMBL AL020988 (Y80D3), M89401 (EST cm08B12)

CYP42A1    Caenorhabditis briggsae ortholog
           XP_002647751.1 94% to CYP42A1

43A Subfamily

CYP43A1    C. elegans
           GenEMBL AF026203

CYP43A1    Caenorhabditis briggsae ortholog

44A Subfamily

CYP44A1     C. elegans
            GenEMBL U21321
            only mitochodrial-like P450 in C. elegans 

CYP44A1    Caenorhabditis briggsae
           XM_001679715.1, XP_002630734.1
           85% to CYP44A1 ortholog

CYP44A1    Caenorhabditis brenneri strain PB2801
           85% to CYP44A1 ortholog

CYP44A1    Caenorhabditis remanei strain PB4641
           83% to CYP44A1 ortholog

CYP44A1    Caenorhabditis japonica
           From UCSC browser

CYP44A1    Ascaris suum
           44% to CYP44A1 aa 134-170 possible ortholog

CYP44B1    Lottia gigantea (owl limpet)
           JGI Protein ID:163695
           74% to CYP44B2, 34% to CYP44A1 C. briggsae
           35% to CYP44A1 C. remanei

CYP44B2    Lottia gigantea (owl limpet)
           JGI Protein ID:163698
           74% to CYP44B1, 37% to 44A1 C. briggsae

CYP44C1    Capitella capitata (Gallery worm, polychaete worm, annelid)
           estExt_Genewise1Plus.C_850046 [Capca1:171547]
           39% to CYP44B1, 37% to 44A1 C. briggsae

45A Subfamily

CYP45     Homarus americanus (American lobster)
            GenEMBL AF065892 (1581bp)
            Identification of a new cytochrome P450 family, CYP45, from the
            lobster, Homarus americanus, and expression following hormone and
            xenobiotic exposures
            Arch. Biochem. Biophys. (1998) In press

46A Subfamily

CYP46A1    human
           GenEMBL NM_006668
           Lund EG, Guileyardo JM and Russell DW.
           cDNA cloning of cholesterol 24-hydroxylase, a mediator of
           cholesterol homeostasis in the brain.
           Proc. Natl. Acad. Sci. U.S.A. 96, 7238-7243 (1999)
           32% identity with Drosophila 4D2
           ESTs H06539, H51951, R36281
           mouse homolog EST AA096922

CYP46A4P    human = CYP46A-se1[12:13:14]
            NT_004424.11|Hs1_4581 chromosome 1 CYP46 pseudogene fragment
            Old name = CYP46A4P

CYP46A1     Pan troglodytes (chimp)
            XM_003314519 missing the N-term

CYP46A1    Macaca fasicularis (cynomolgus monkey)
           AB220390 (partial, not assembled correctly)
           N-term part (deleted) is not P450 sequence

Cyp46a1    mouse
           GenEMBL AF094479 NM_010010 ESTs AA096922, R75217 
           no UNIGENE entry

Cyp46a1  rat 

CYP46A1     Mesocricetus auratus (hamster)
            Genpept ACQ99542

CYP46A1     Bos taurus (cow)
            See cattle page for details

CYP46A1   pig 
          BI359892.1, BF193580.1, BF190788.1, 
          lower case = cow seq.

CYP46A1   Canis familiaris (dog)
          94% to CYP46A1 human 

CYP46A1     Xenopus tropicalis (Western clawed frog)
            See Xenopus pages for seq

CYP46A1     Danio rerio (zebrafish)
            Ensemble protein ID OTTDARP00000024410
            cyp46a1-001, transcript ID OTTDART00000029923
            Zv8 chr20:4947279-4961019  100% match
            Note: This seq. replaces my older version which was a hybrid

CYP46A1     Fugu rubripes (pufferfish)
            LKB67200.x1, LGP3798.x1
            60% to 46 human

CYP46A1    Tetraodon nigroviridis (freshwater pufferfish)
           84% to fugu CYP46A1
           exons 7,8 from CAAE01022534.1 

CYP46A2P    Fugu rubripes (pufferfish)
            FS:S000256 Scaffold_256
156393 FSSMEWQMETFFK 156431 frameshift

CYP46A2     Danio rerio (zebrafish)
            BC055161 cDNA, 
            N-term in seq gap, Zv8 chr5:73217357-73232610 (-)

CYP46A3P    Fugu rubripes (pufferfish)
            FS:S000256 Scaffold_256 aa 458-506

CYP46A4     Danio rerio (zebrafish)
            93% to CYP46A2 
            Zv8 chr5:73235997-73241459 (-)
Note: the EST EH438181 covers this sequence and supplies the N-terminal
So the genomic sequence is not correct and this is not a pseudogene
EE322098 was used to correct an internal indel and one other amino acid

CYP46A5    Danio rerio (zebrafish)
           BC116617 mRNA Danio 08-SEP-2006
           100% to EST CN329576.1, 1 aa diff to EST CF996834.1
           no exact match in the Zv8 genome assembly

CYP46A6   Xenopus tropicalis (Western clawed frog)
          53% to human CYP46
          note: this frog has five CYP46 genes in two clusters
          zebrafish has 2 CYP46 genes
          scaffold 519 627623-643634 (+) strand
          82% to CYP46A1, 79% to CYP46A7

CYP46A6   Xenopus laevis (African clawed frog)
          92% to CYP46A6 X. tropicalis (ortholog)
          84% to CYP46A8 X. laevis, 84% to CYP46A7 X. laevis

CYP46A7   Xenopus tropicalis (Western clawed frog)
          CX981536.1 CX970619.1 CX970620.1 CX370643.2
          87% to 46A1 Xenopus tropicalis and 84% to 46A4 Danio
          54% to 46A1 human
          old scaffold_588:627624-672691
          scaffold 519 646604 672690 (+) strand, adjacent to CYP46A6

CYP46A7   Xenopus laevis (African clawed frog)
          86% to CYP46A7 X. tropicalis (ortholog), 
          80% to CYP46A8

CYP46A8   Xenopus tropicalis (Western clawed frog)
          54% to human CYP46A1, 82% to CYP46A6 X. laevis
          note: this frog has five CYP46 genes
          scaffold 519 676371-696647 (+) strand
          adjacent to CYP46A7

CYP46A8   Xenopus laevis (African clawed frog)
          92% to CYP46A8 X. tropicalis (ortholog), 
          81% to CYP46A5, 79% to CYP46A.1

CYP46A8   Xenopus laevis (African clawed frog)
          BG018841 dab13d08.y1 opposite end to BG022212 dab13d08.x1
          45% to CYP46 N-term 1-200 
612 RLTLDVIAR 638 

          74% to CYP46 391-498

CYP46A9   Xenopus tropicalis (Western clawed frog)
          scaffold_49:1707219-1730127 (+) strand
          First part matches
          scaffold_49:1707219-1723435 with 7 aa diffs
          Then new seq is found below this up to 1730127
          58% to CYP46A8, 56% to CYP46A6, 56% to CYP46A7

CYP46A10   Xenopus tropicalis (Western clawed frog)
           scaffold_49:1780107-1800536 (+) strand
           Downstream of CYP46A9
           97% to CYP46A9 scaffold_49:1707219-1730127 (+) strand
           EL729253.1 fills in missing exon 8

CYP46A10   Xenopus tropicalis (Western clawed frog)
           SwissProt B1H1A6 58% TO CYP46A1
           4 aa diffs to 46A10 Xenopus tropicalis

CYP46a-de1b2b3b4b5b   Danio rerio (zebrafish)
           chr20:4973129-4977542 (+)
           note: this sequence and CYP46A4P would make a complete gene
           but they are on different chromosomes

46A-se1[12:13:14] human = CYP46A4P
            NT_004424.11|Hs1_4581 chromosome 1 CYP46 pseudogene fragment
            Old name = CYP46A4P

CYP46-se2[14:15]   Danio rerio (zebrafish)
                  exons 14,15 
                  Zv8 chr5:73126154-73127267 (+)

CYP46-se3[1:2:3:4]   Danio rerio (zebrafish)
                  Zv8 chr7:11430449-11434822 
                  CYP46 solo exons 1-4

Cyp47a1x   Drosophila melanogaster
           GenEMBL AC005556, AC004516, AC004426 intron exon boundaries 
           renamed Cyp4aa1 following CYP4Z1

CYP48A1     Trichogramma cacœciae (a parasitoid wasp) 
            GenEMBL AF207950
            BBRC 268, 677-682 (2000) Cloning and expression of cytochrome 
            P450 genes belonging to the CYP4 family and to a novel 
            family, CYP48, in two hymenopteran insects, Trichogramma
            cacœciae and Apis mellifera by S. Tares, J.B. Bergé and M. Amichot.
            123 amino acid sequence from I-helix to PERF region
            45% identical to CYP47A1, but sure to drop into the 
            mid to low 30% range for a full length sequence
            clone name 16Tc
            66% to CYP4AB22

CYP48A2v1     Trichogramma cacœciae (a parasitoid wasp)
            GenEMBL AF207951
            BBRC 268, 677-682 (2000) Cloning and expression of cytochrome 
            P450 genes belonging to the CYP4 family and to a novel 
            family, CYP48, in two hymenopteran insects, Trichogramma
            cacœciae and Apis mellifera by S. Tares, J.B. Bergé and M. Amichot.
            124 amino acid sequence from I-helix to PERF region
            40% identical to CYP47A1, but sure to drop into the 
            mid to low 30% range for a full length sequence
            clone name 15Tc
            72% to CYP4AB10 

CYP48A2v2   Trichogramma cacœciae (a parasitoid wasp)
            GenEMBL AF207952
            BBRC 268, 677-682 (2000) Cloning and expression of cytochrome 
            P450 genes belonging to the CYP4 family and to a novel 
            family, CYP48, in two hymenopteran insects, Trichogramma
            cacœciae and Apis mellifera by S. Tares, J.B. Bergé and M. Amichot.
            124 amino acid sequence from I-helix to PERF region
            40% identical to CYP47A1, but sure to drop into the 
            mid to low 30% range for a full length sequence.  
            58% identical to CYP48A1
            clone name 21Tc ony two amino acid differences with CYP48A2v1
            71% to CYP4AB10 

CYP49A1     Drosophila melanogaster
            GenEMBL AC017930 48452-54739 AC007398 AC007418 
            ESTs AA941795 AI258819 AA697999
            mitochondrial P450 fits in the mitochondrial clan

Cyp49a1     Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP49A1     Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2l1

CYP49A1     Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            45% to 49A1 Drosophila.  Note this sequence is 
            named in the same subfamily as other CYP49s since 
            there seems to be only one orthologous sequence per
            species and it does not make sense to name orthologs with 
            different subfamily names.

CYP49A1X   Bombyx mori (silkworm)
           BAAB01133495.1 BAAB01150577.1 BAAB01091102.1 BAAB01198981.1
           BAAB01133297.1 BAAB01093561.1
           44% to CYP301A1
           CYP49 and CYP301 are nearly subfamilies of a single family
           Note: name changed based on Rene Feyereisens analysis
           Name changed to CYP301B1
           See silkworm page for sequence

CYP49A1     Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            77% to CYP49A1 Bombyx mori

CYP49A1    Plutella xylostella 
           Gene number CCG012658.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           78% to CYP49A1 Bombyx mori

CYP49A1    Tribolium castaneum (red flour beetle)
           GenEMBL XP_970738
           63% to 49A1 Drosophila, 47% to CYP301A1 Tribolium

CYP49A1 part 1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 15
           84% to CYP49A1 Tribolium castaneum
           EXXR fragment

CYP49A1 part 2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 13
           89% to CYP49A1 Dendroctonus ponderosae
           C-term fragment

CYP49A1    Aedes aegypti (yellow fever mosquito)

CYP49A1    Culex pipiens

CYP49A1     Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph49, 58% to CYP49A1 Aedes, only 44% to CYP303A1 Aedes,
            58% to 49A1 Anopheles gambiae
            Pediculus genome site

CYP49A1X   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           65% to CYP301B1 Acyrthosiphon pisum, C-term only
           name changed to CYP301B1

CYP49A1?    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_262 only 26% to CYP49A1 unidentified mito clan N-term
            All best hits are CYP49A1 and this protein is not well conserved

CYP49A1    Bombyx mori (silkworm)
           BAAB01014940.1 BAAB01083735.1 BAAB01056249.1
           51% to CYP49A1 Drosoph.
           CYP49 and CYP301 are nearly subfamilies of a single family
           Note name changed based on Rene Feyereisens analysis
           Formerly CYP49A2
           See silkworm page for sequence

CYP49A1     Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            76% to CYP49A1 Tribolium castaneum
            clone name DPO024_I03

CYP49A2X   Bombyx mori (silkworm)
           BAAB01014940.1 BAAB01083735.1 BAAB01056249.1
           51% to CYP49A1 Drosoph.
           CYP49 and CYP301 are nearly subfamilies of a single family
           Note name changed based on Rene Feyereisens analysis
           Name changed to CYP49A1
           See silkworm page for sequence

Note this is the last two digit number for animal P450s (except CYP51).  The 
animal P450s will continue at CYP301A1.  This leaves 200 possible animal 
families before reaching CYP501 and higher that are reserved for lower 

51A Subfamily

A note on nomenclature.  CYP51s were originally all called CYP51, because only one 
gene was found per species and they all seemed to be in this one conserved family.
However, rice had many CYP51s in at least two sequence groups, so subfamilies
have been designated for CYP51s.  These are not the typical subfamilies, but only 
one subfamily is created for each major taxonomic group.  CYP51A for animals,
CYP51B for bacteria. CYP51C for Chromista, CYP51D for Dictyostelium, CYP51E
for Euglenozoa, CYP51F for fungi.  Those groups with only one CYP51 per species 
are all called by one name: CYP51A1 is for all animal CYP51s since they are 
orthologous.  The same is true for CYP51B, C, D, E and F.  CYP51G (green plants) 
and CYP51Hs (monocots only so far) have individual sequence numbers.

CYP51A1     human
            GenEMBL U23942 (3172bp)
            Stromstedt,M., Rozman,D. and Waterman,M.R.(1995)
            The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha 
            demethylase, a cyochrome P450 whose expression is regulated by 
            Arch. Biochem. Biophys. 329, 73-81 (1996)

CYP51A1     human
            GenEMBL U51684 to U51692 (genomic sequence)
            Rozman,D., Stromstedt,M., Tsui,L.-C., Scherer,S.W. and
            Structure and mapping of the human lanosterol 14-alpha demethylase
            gene (CYP51) encoding the cytochrome P450 involved in cholesterol
            biosynthesis; comparison of exon/intron organization with other
            mammalian and fungal CYP genes.
            Genomics (1996) In press

CYP51A1     human
            GenEMBL D55653 (3085bp)
            Aoyama,Y., Funae,Y, Noshiro,M., Horiuchi,T. and Yoshida,Y. 
            Occurrence of a P450 showing high homology to yeast lanosterol 14-
            demethylase (P450DM) in rat liver.
            Biochem. Biophys. Res. Commun. 201, 1320-1326 (1994)

CYP51A1     Pan troglodytes (chimpanzee)
            XM_003318576 REVISED N-TERM
            lanosterol 14-alpha demethylase
            99% (3 aa diffs) to human

CYP51A1     Macaca fasicularis (cynomolgus monkey)
            Yasuhiro Uno
            Submitted to nomenclature committee 1/11/2005
            Clone name mfCYP51A1_7H11
            98% to CYP51 human

CYP51A1     Bos taurus (cow)
            See cattle page for details

CYP51A1    pig 
           AB042982, AB009988, NM_214432

CYP51A1   Canis familiaris (dog)

CYP51P1      human
             no accession number
             Rozman, D. Stromstedt, M. and Waterman, M.R. The three human 
             cytochrome P450 lanosterol 14a-demethylase (CYP51) genes reside on 
             chromosomes 3, 7, and 13: Structure of two retrotransposed 
             association with a line-1 element, and evolution of the human CYP51 
             Archives of Biochemistry and Biophysics 333, 466-474 (1996).
             processed pseudogene on chromosome 3

CYP51P1      human
             processed pseudogene U36926 5 in frame stops

CYP51P2      human
             no accession number
             Rozman, D. Stromstedt, M. and Waterman, M.R. The three human 
             cytochrome P450 lanosterol 14a-demethylase (CYP51) genes reside on 
             chromosomes 3, 7, and 13: Structure of two retrotransposed 
             association with a line-1 element, and evolution of the human CYP51 
             Archives of Biochemistry and Biophysics, 333: 466-474 (1996)
             processed pseudogene on chromosome 13

CYP51P2      human
             processed pseudogene U40053 

CYP51P3      human
             NT_025741.8|Hs6_25897 chromosome 6 CYP51P3
             In an intron of the SASH1 gene

CYP51P3      Cavia porcellus (Guinea pig) 
             cavPor3_dna scaffold_60:1743956-1873082 at UCSC browser
             32% to 51 human in orthologous position to CYP51P3 pseudogene 
             inside SASH1 gene
59392 IWSC*PFT

CYP51A1     rat
            GenEMBL D29962 (1924bp) PIR JC2334 (430 amino acids)
            GenEMBL D55681 (2268bp)
            Aoyama,Y., Funae,Y, Noshiro,M., Horiuchi,T. and Yoshida,Y. 
            Occurrence of a P450 showing high homology to yeast lanosterol 14-
            demethylase (P450DM) in rat liver.
            Biochem. Biophys. Res. Commun. 201, 1320-1326 (1994)
            Note:  This is the first time a single P450 family is represented in
            plants and animals.  The N-terminal is more conserved than the C-

CYP51A1     rat
            GenEMBL U17697 (2383bp)
            Sloane,D.L., So,O., Leung,R., Scarafia,L.E., Saldou,N., Jarnagin,K.
            and Swinney,D.C.
            Molecular Cloning and Functional Expression of Rat Lanosterol 
            14 alpha-Demethylase
            Gene (1995) In press

CYP51A1     rat
            Aoyama, Y. et al . Sterol 14-demethylase P450 (P45014DM) is one of 
            the most ancient and conseved P450 species. 
            The Journal of Biochemistry 119: 926-933 (1996)
            includes a report on a processed pseudogene from  CYP51 in rats

Cyp51       mouse
            GenEMBL NM_020010 AF166266 Mm.24155

CYP51P3      Cavia porcellus (Guinea pig) 
             cavPor3_dna scaffold_60:1743956-1873082 at UCSC browser
             32% to 51 human in orthologous position to CYP51P3 pseudogene 
             inside SASH1 gene
59392 IWSC*PFT

CYP51A1     Gallus gallus (chicken)
            DKFZ426_22O10R1 from  http://www.ri.bbsrc.ac.uk/cgi-bin/est-blast/blast.pl
            Roslin Institute chicken EST project
603372085F1>603372085F1 cloneID='ChEST280i22' Chondrocytes from http://www.chick.umist.ac.uk/
603582971F1>603582971F1 cloneID='ChEST534n18' stage_36_trunks from http://www.chick.umist.ac.uk/
data from the UMIST/Nottingham/Dundee universities chicken EST sequencing project.
82% to human CYP51 81% to Fugu CYP51

CYP51A1     Xenopus laevis (African clawed frog)
            No accession number
            Hiroaki Ohi, Yoshiaki Fujita
            78-80% identical to mammalian CYP51s
            submitted to nomenclature committee July 26, 2000

CYP51A1   Xenopus laevis (African clawed frog)
          from parts BE669335 BE026950 BE026223 BE575528 seq 17

CYP51A1a   Xenopus laevis (African clawed frog)
           SwissProt A2BD59
           96% to CYP51A1 X. tropicalis

CYP51A1b   Xenopus laevis (African clawed frog)
           SwissProt Q66IT2 
           95% to CYP51A1 X. laevis A2BD59 CYP51A1a
           96% to CYP51A1 X. tropicalis
           presumed ohnolog of SwissProt A2BD59

CYP51A1     Xenopus tropicalis (Western clawed frog)
            80% to CYP51 human, ortholog 

CYP51A1     Danio rerio (zebrafish)
            Seq zebrafish pages for seq 

CYP51A1     Fugu rubripes (pufferfish)
            No accession number
            78% to 51 mouse
      KHPPYI 67266
66632 YFQRWGDSGER 66600
64963 PFGAG

CYP51A1    Tetraodon nigroviridis (freshwater pufferfish)
           91% TO FUGU

CYP51A1   Monosiga brevicola (choanoflagellate)
          single celled sister group to all animals)
          From JGI site estExt_fgenesh1_pg.C_250046 [Monbr1:38433]
          51% to CYP51A1 of human

CYP51A1     Caenorhabditis elegans (nematode worm/ mammalian contamination)
            no accession number
            F54E5 contig 00150 this fragment's amino acid translation is identical 
            to human sequences U51688, AC000120 and rat sequence AB004091.  
            The human sequences U23942, U40053 and D55653 and the rat sequences
            U17697, D55681, D87997, D78370 all have N instead of D at the first 
            amino acid. This may be a polymorphism in this gene.  It is very 
            unlikely that this sequence is from C. elegans and it most likely 
            represents a contamination by a mammalian sequence.

CYP51B1    Mycobacterium tuberculosis
           GenEMBL Z80226
           This is named in the CYP51 family even though it is in bacteria
           It always clusters with the other CYP51 sequences.
           The activity of this enzyme has been demonstrated to be a 14 alpha 
           demethylase with preference for obtusifoliol.
           Mike Waterman presented the crystal structure of this 
           protein at a recent meeting in Moscow in July 2000.
           See the bacterial nomenclature page for more CYP51B sequences.

CYP51C1    Phaeodactylum tricornutum (diatom)
           GenEMBL BI307668.1 
           estExt_Genewise1.C_chr_310065|Phatr2 at JGI
           note: one of the few P450s from diatoms (stramenopiles)
           another is CYP97E1 from Skeletonema costatum
           The CYP51C subfamily is for CYP51s in the Chromista
           55% to Ectocarpus 51C1

CYP51C1    Thalassiosira pseudonana (diatom)
           No accession
           From JGI genome project
           scaffold 68 48% to 51G1 Arabidopsis
           66% to CYP51C Phaeodactylum tricornutum 
           55% to Ectocarpus 51C1
           See stramenopile pages for a tree
           This N-term is revised

CYP51C1     Ectocarpus siliculosus (brown algae)
            Genoscope Ectocarpus siliculosus brown algae project
            ESTs LQ0AAA4YI04FM1.SCF, LQ0AAA7YJ01FM1.SCF
            LQ0AAB54YL14FM1.SCF, LQ0AAB79YH22FM1.SCF
            LQ0AAB69YF16FM1.SCF, LQ0AAB65YF19FM1.SCF
            LQ0AAA9YO17FM1.SCF, LQ0AAB58YH11FM1.SCF
            LQ0AAB55YN02FM1.SCF, LQ0AAB70YE14FM1.SCF
            LQ0AAB83YM18FM1.SCF, LQ0AAB2YA05FM1.SCF
            59% to Diatom CYP51C1 Thalassiosira pseudonana (ortholog)
            about 46% to Chlamydomonas CYP51G1
            Ectocarpus sctg_6 1176507-1185087

CYP51D1     Dictyostelium discoideum (cellular slime mold)
            GenEMBL AU033519
            47% identical to S. bicolor CYP51 all the best matches are to CYP51
            note: CYP51D is a subfamily for CYP51s from Dictyostelium and 
            other Mycetozoa

CYP51E1    Trypanosoma brucei (African sleeping sickness parasite)
           GenEMBL AZ217433 AQ948529 AQ950690 AL492728 AL481001 AZ217732 
           AQ948526 AQ647531 AL480043 AQ660405 AL495885 AZ212935 AL481816 
           Assembled from overlapping GSS fragments
           33% to mammalian CYP51s
           Note: CYP51E is a subfamily for CYP51s of Euglenozoa
           Also AAHB01000003.1 T. brucei chromosome 11, comp (1400971-1402470)

CYP51E1    Trypanosoma brucei (African sleeping sickness parasite)
           GenEMBL AF363026
           Joubert,B.M., Nguyen,L.N., Matsuda,S.P.T. and Buckner,F.S.
           Cloning and functional characterization of a Trypanosoma brucei
           lanosterol 14 alpha-demethylase gene
           Mol. Biochem. Parasitol. 117 (1), 115-117 (2001)

CYP51E1v1  Trypanosoma cruzi (Chagas disease parasite)
           GenEMBL AY283022.1 
           Buckner,F.S., Joubert,B.M., Boyle,S.M., Eastman,R.T., Verlinde,C.L.
           and Matsuda,S.P.
           Cloning and analysis of Trypanosoma cruzi lanosterol
           Mol. Biochem. Parasitol. 132 (2), 75-81 (2003)
           Submitted by Sean M. Boyle for Fred Buckner Oct 25, 2001
           83% to CYP51 of T. brucei
           clone name CL13
           CYP51-1 allele (only 3aa diffs to allele 2)

CYP51E1v2  Trypanosoma cruzi (Chagas disease parasite)
           GenEMBL AY283023.1 
           Buckner,F.S., Joubert,B.M., Boyle,S.M., Eastman,R.T., Verlinde,C.L.
           and Matsuda,S.P.
           Cloning and analysis of Trypanosoma cruzi lanosterol
           Mol. Biochem. Parasitol. 132 (2), 75-81 (2003)
           Submitted by Sean M. Boyle for Fred Buckner Oct 25, 2001
           4 amino acid difference to CYP51E1v1
           CYP51-2 allele, clone name WTB9

CYP51E1    Trypanosoma congolense
           Sanger Center congo469h11.p1k, congo931d01.p1k, 

CYP51E1    Trypanosoma vivax
           86% to 51E1 T. brucei

CYP51E1    Leishmania major (Leishmaniasis parasite)
           LM7_11c.1.Contig2  L. major Friedlin chromosome 7_11c GenEMBL AZ048391
           Also GenEMBL AZ048391 partial seq
           76% to T. brucei CYP51E1
121992 AA 121987

CYP51E1    Leishmania infantum
           Sanger Center Contig3290 

CYP51E1  Euglena gracilis
         GenEMBL EC678643.1 EC676958.1 EC676055.1 (N-term ESTs)
         EC672115.1 (C-term EST)
         51% to CYP51G1 Arabidopsis


Note: CYP51F is a subfamily for fungal CYP51 sequences

CYP51F1     Saccharomyces cerevisiae (yeast)
            GenEMBL U10555 (24,431bp)
            Johnston,M., Andrews,S., Brinkman,R., Cooper,J., Ding,H., Dover,J.,
            Du,Z., Favello,A., Fulton,L., Gattung,S., Geisel,C., Kirsten,J.,
            Kucaba,T., Hillier,L., Jier,M., Johnston,L., Keppler,D.,
            Langston,Y., Latreille,P., Louis,E., Macri,C., Mardis,E.,
            Mouser,L., Nhan,M., Rifken,L., Riles,L., St.Peter,H., Thornton,L.,
            Trevaskis,E., Vaudin,M., Vaughan,K., Vignati,D., Wilcox,L.,
            Willis,A., Wilson,R., Wohldman,P. and Waterston,R.
            The complete sequence of Saccharomyces cerevisiae chromosome VIII
            Science 265, 2077-2082 (1994)
            YHR007c reverse complement of 20,961-22,553, ERG11 gene

CYP51F1     Saccharomyces cerevisiae (yeast)
            GenEMBL T17568 (45bp)
            Burns,N., Grimwade,B., Ross-Macdonald,P.B., Choi,E.-Y., Finberg,K.,
            Roeder,G.S. and Snyder,M.
            Large-Scale Analysis of Gene Expression, Protein Localization and
            Gene Disruption in Saccharomyces cerevisiae
            Genes Dev. 8, 1087-1105 (1994)

CYP51F1     Saccharomyces paradoxus
            98% to 51F1 S. cerevisiae 
            see fungal pages for seq

CYP51F1     Saccharomyces mikatae
            96% to CYP51F1   S. cerevisiae 
            see fungal pages for seq

CYP51F1     Saccharomyces kudriavzevii
            96% to CYP51F1 S. cerevisiae 
            see fungal pages for seq

CYP51F1     Saccharomyces bayanus
            93% to CYP51F1 S. cerevisiae 
            see fungal pages for seq

CYP51F1     Saccharomyces castellii
            78% to CYP51F1 S. cerevisiae 
            see fungal pages for seq

CYP51F1     Saccharomyces kluyveri
            79% to CYP51F1 S. cerevisiae  
            see fungal pages for seq

CYP51F1     Kluyveromyces waltii
            77% to CYP51F1 S. cerevisiae 
            see fungal pages for seq

CYP51F1     Kluyveromyces polysporus
            81% to CYP51F1 S. cerevisiae
            see fungal pages for seq

CYP51F1     Kluyveromyces lactis
            76% to CYP51F1 Saccharomyces kluyveri
            see fungal pages for seq

CYP51F1     Ashbya gossypii ATCC 10895
            71% to CYP51F1 S. cerevisiae, 
            see fungal pages for seq

CYP51F1     Yarrowia lipolytica
            63% to CYP51F1 S. cerevisiae
            see fungal pages for seq

CYP51F1     Penicillium italicum
            GenEMBL Z49750 (2053bp)
            Nistelrooy,H.G.M., Van den Brink,H.M., Kan,J.A.L., Gorcom,R.F.M.
            and Waard,M.A.
            Isolation and molecular characterisation of the gene encoding
            eburicol 14-alpha-demethylase (CYP51) from Penicillium italicum
            Unpublished (1995)

CYP51F1     Uncinula necator (grape powdery mildew fungus)
            GenBank U72657 (1960bp) U83840 (1756bp) U72658 (1575bp)
            Delye,C., Laigret,F. and Corio-Costet,M.F.
            Cloning and sequence analysis of the eburicol 14alpha-demethylase
            gene of the obligate biotrophic grape powdery mildew fungus
            Gene 195 (1), 29-33 (1997)
            note: a mutation causing resistance to an inhibitor triadimenol is 
            Delye,C., Laigret,F. and Corio-Costet,M.F.
            A mutation in the 14 alpha-demethylase gene of Uncinula necator that 
            with resistance to a sterol biosynthesis inhibitor.
            Applied and Environ. Microbiol. 63, 2966-2970 (1997)

CYP51F1     Schizosaccharomyces pombe
            GenEMBL Z54096 (12168bp)
            Hunt,S. Devlin,K. and Churcher,C.M.
            unpublished (1995)

CYP51F1    Schizosachharomyces japonicus
           78% to Schizosachharomyces pombe CYP51A1  
           see fungal pages for seq

CYP51F1    Schizosachharomyces octosporus
           see fungal pages for seq

CYP51F1    Pneumocystis carinii
           contig_349-snap.1 from Fungal Genome DB
           contig_349-snap.2 from Fungal Genome DB
           58% to CYP51F1 S. pombe
           see fungal pages for seq

CYP51F1     Ustilago maydis
            GenEMBL Z48164 (1874bp)
            Hargreaves,J.A. and Keon,J.P.R.
            The sterol 14 alpha demethylase (ERG11) gene from Ustilago maydis.
            Unpublished (1994)

CYP51F1     Ustilago maydis
            GenEMBL XM_401277

CYP51F1     Puccinia graminis f. sp. tritici
            PGTG_07202 revised
            55% to CYP51F1 Malassezia globosa with a short seq gap.
            see fungal pages for seq

CYP51F1     Malassezia globosa
            67% to CYP51F1 Ustilago maydis, 
            see fungal pages for seq

CYP51F1     Sporobolomyces roseus
            JGI model e_gw1.1.480.1
            55% to CYP51F1 Ustilago maydis, 
            see fungal pages for seq

CYP51F1     Issatchenkia orientalis
            GenEMBL S75391 (1242bp)
            Burgener-Kairuz,P. Zuber,J.P., Buchman,T.G., Bille,J. and Rossier,M.
            Rapid detection and identification of Candida albicans and 
            Torulopsis (Candida) glabrata in clinical specimens by species-specific 
            nested PCR amplification of a       
            cytochrome P-450 lanosterol-alpha-demethylase (L1A1) gene fragment.
            J. Clin. Microbiol. 32, 1902-1907 (1994)

CYP51F1     Kluyveromyces marxianus
            GenEMBL X97682 (338bp)
            Morace,G., Posteraro,B., Sanguinetti,M., Lo Cascio,G. and Fadda,G.
            Identification of various medically important Candida species in
            clinical specimens by using PCR-REA.
            88% to CYP51F1 Kluyveromyces lactis

CYP51F1     Erysiphe graminis f. sp. hordei eburicol
            GenEMBL AF052515 (2167bp)
            Delye,C., Bousset,L. and Corio-Costet,M.F.
            PCR cloning and detection of point mutations in the eburicol
            14alpha-demethylase (CYP51) gene from Erysiphe graminis f. sp.
            hordei, a 'recalcitrant' fungus.
            Curr. Genet. 34, 399-403 (1998)

CYP51F1     Candida tropicalis
            GenEMBL M23673
            Chen,C., Kalb,V.F., Turi,T.G. and Loper,J.C.
            Primary structure of the cytochrome P450 lanosterol 14
            alpha-demethylase gene from Candida tropicalis
            DNA 7 (9), 617-626 (1988)

CYP51F1     Candida glabrata
            GenEMBL S75389 (1242bp)
            Burgener-Kairuz,P. Zuber,J.P., Buchman,T.G., Bille,J. and Rossier,M.
            Rapid detection and identification of Candida albicans and 
Torulopsis (Candida)
            glabrata in clinical specimens by species-specific nested PCR 
amplification of a       
            cytochrome P-450 lanosterol-alpha-demethylase (L1A1) gene fragment.
            J. Clin. Microbiol. 32, 1902-1907 (1994)

CYP51F1     Candida glabrata S75389
            GenPept CAG58795.1
            see fungal pages for seq

CYP51F1     Candida parapsilosis 
            GenEMBL AF019902 (677bp)
            Okhravi,N., Adamson,P., Mant,R., Matheson,M.M., Midgley,G.,
            Towler,H.M. and Lightman,S.
            Polymerase chain reaction and restriction fragment length
            polymorphism mediated detection and speciation of Candida spp
            causing intraocular infection.
            Invest. Ophthalmol. Vis. Sci. 39 (6), 859-866 (1998)

CYP51F1     Candida parapsilosis
            75% to CYP51F1 Candida tropicalis
            see fungal pages for seq

CYP51F1     Candida albicans
            GenEMBL X13296, orf19_922
            Lai,M.H. and Kirsch,D.R.
            Nucleotide sequence of cytochrome P450 L1A1 (lanosterol 14
            alpha-demethylase) from Candida albicans
            Nucleic Acids Res. 17, 804 (1989)

CYP51F1     Candida guilliermondii
            GenEMBL X97680 (336bp)
            Morace,G., Sanguinetti,M., Posteraro,B., Cascio,G.L. and Fadda,G.
            Identification of various medically important Candida species in
            clinical specimens by PCR-restriction enzyme analysis
            J. Clin. Microbiol. 35 (3), 667-672 (1997)

CYP51F1     Candida guilliermondii
            71% to CYP51F1 Candida lusitaniae
            see fungal pages for seq

CYP51F frag. Candida guilliermondii X97680
            this seq is 94% to Candida albicans but only 66% to
            full length CYP51A1 for C. guilliermondii
            This is a different gene

CYP51F1     Candida dubliniensis P450L1A1, partial.
            GenEMBL AJ012573
            Morace,G., Posteraro,B., Sanguinetti,M. and Fadda,G.
            Identification of various medically important yeast by Reverse
            Cross Blot Hybridization

CYP51F1    Candida dublinensis
           93% to CYP51F1  Candida albicans, cdub_2-g61.1, GenEMBL AJ012573
           see fungal pages for seq

CYP51F1    Candida lusitaniae
           72% to CYP51F1 Candida tropicalis
           see fungal pages for seq

CYP51F1     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            61% to CYP51F1 Debaryomyces hansenii

CYP51F1   Lodderomyces elongisporus
          77% to CYP51F1 Candida parapsilosis
          see fungal pages for seq

CYP51F1     Pichia anomala 
            GenEMBL AF019903
            Okhravi,N., Adamson,P., Mant,R., Matheson,M.M., Midgley,G.,
            Towler,H.M. and Lightman,S.
            Polymerase chain reaction and restriction fragment length
            polymorphism mediated detection and speciation of Candida spp
            causing intraocular infection
            Invest. Ophthalmol. Vis. Sci. 39 (6), 859-866 (1998)

CYP51F1    Pichia stipitis
           JGI model e_gww1.7.1.351.1
           71% TO CYP51F1 Debaryomyces hansenii
           see fungal pages for seq

CYP51F1    Debaryomyces hansenii
           GenPept CAG88416.1
           75% to CYP51F1   Candida guilliermondii
           see fungal pages for seq

CYP51F1     Neurospora crassa
            No accession number
            Neurospora crassa sequence contig 1.721  (supercontig 99)
            Lower case = EST support
49741 fmkialtteafrqyvpiisdevtsylkrtadfkgksgivdippkmaqitiftashalqg 49917
49918 keirdkfdetladlyhdldmgfspinfmlhwaplpwnnrrdyaqrtvakiymdtikerra 50097
50098 rgetgaqdimwhlmnstykgdvpvpdheiahmmiallmagqhsssstsswimlrlasr 50271
50272 pdimedlyneqvknlgadlppltyedlaklplhaaivkETLRLHAPIHSIMRAVKTPMPV 50451
50812 tdyaslfsrplepakiywerregcql* 50892

CYP51F1   Neurospora discreta
          JGI gene model estExt_fgenesh3_kg.C_20410
          98% to CYP51F1 N. crassa
          see fungal pages for seq

CYP51F1   Aspergillus nidulans
          AACD01000145 (WGS section)
          51 clan

CYP51F1   Magnaporthe grisea
          AACU01001110 cont2.837
          MG04432.4 (version4) 75% to CYP51

CYP51F1   Fusarium graminearum
          AACM01000048 (WGS section)
          FG01000.1 FGcontig1.48_scaffold1
          64% to Erysiphe graminis 72% to M. grisea 51F1

CYP51F1   Fusarium oxysporum
          92% to CYP51F1 Fusarium graminearum
          see fungal pages for seq

CYP51F1   Fusarium verticillioides
          98% to CYP51F1 Fusarium oxysporum
          see fungal pages for seq

CYP51F1   Nectria haematococca (Fusarium solani group)
          genome annotation in progress
          89% to Fusarium graminearum CYP51F1
          FG01000.1 AACM01000048 FGcontig1.48_scaffold1
          This gene model seems correct DRN 2/4/06

CYP51F1   Aspergillus fumigatus
          GenEMBL AAK73660.1 also XP_749134.1, EAL87096.1
          14-alpha sterol demethylase
          79% to 51F1 A. nidulans

CYP51F1  Neosartorya fischeri NRRL 181
         XM_001261294.1, NFIA_024690
         98% to CYP51F1 A. fumigatus = ortholog
         63% to CYP51F2 A. fumigatus

CYP51F1  Aspergillus oryzae
         GenEMBL BAE60239.1
         79% to CYP51F1 Aspergillus nidulans, 60% to CYP51F4

CYP51F1  Aspergillus flavus
         100% to CYP51F1  Aspergillus oryzae

CYP51F1  Aspergillus niger
         84% to CYP51F1

CYP51F1  Aspergillus clavatus NRRL 1
         XM_001273213.1, ACLA_005420
         89% to 51F1 S. fumigatus
         61% to 51F2 A. fumigatus

CYP51F1  Aspergillus terreus NIH2624
         XM_001212028.1, ATEG_02850.1

CYP51F1P  Aspergillus terreus
          ATEG_10302.1 revised
          71% to CYP51F1 Aspergillus terreus
          see fungal pages for seq

CYP51F1   Metarhizium anisopliae var. acridum Ma102
CYP51F1   Metarhizium anisopliae var. anisopliae Ma23

CYP51F1   Mycosphaerella graminicola
          Fungal P450 Database Mgr032 
          63% to CYP51F1 Aspergillus fumigatus
          see fungal pages for seq

CYP51F1   Mycosphaerella fijiensis
          JGI model e_gw1.3.1317.1
          81% to CYP51F1 Mycosphaerella graminicola
          see fungal pages for seq

CYP51F1   Uncinocarpus reesii
          78% to CYP51F1 Ajellomyces capsulatus
          see fungal pages for seq

CYP51F1   Coccidioides immitis
          89% to CYP51F1 Uncinocarpus reesii
          see fungal pages for seq

CYP51F1  Ajellomyces capsulatus NAm1 (Histoplasma capsulatum)
         63% to CYP51F2 A. fumigatus
         74% to CYP51F1 A. fumigatus

CYP51F1   Histoplasma capsulatum G217B, teleomorph: Ajellomyces capsulatus
          HCB02684.1 model is a fusion protein, top part deleted
          96% to CYP51F1 Ajellomyces capsulatus NAm1

CYP51F1  Venturia inaequalis strain Ent27
         GenEMBL AF227920 
         14 alpha-demethylase

CYP51F1   Phanerochaete chrysosporium (white rot fungus)
          Scaffold_44, JGI gene model ug.2.6.1
          54% to Ustilago maydis CYP51F1

CYP51F1v1 Postia placenta (brown rot basidiomycete fungi)
CYP51F1v2 Postia placenta (brown rot basidiomycete fungi)
CYP51F1v3 Postia placenta (brown rot basidiomycete fungi)

CYP51F1   confidential basidiomycete

CYP51F1   Cryptococcus neoformans var. neoformans B-3501A chromosome 1
          56% to CYP51F1 Phanerochaete chrysosporium
          ESTs gb|CF192489.1
          gb|CF192488.1, gb|CF191439.1
          see fungal pages for seq

CYP51F1  Cryptococcus gattii
         CNBG_0513 Transcript 1 Broad Institute
         96% to CYP51F1 Cryptococcus_neoformans var. neoformans B-3501A
         revised to include 14 nucleotide micro exon

CYP51F1   Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          46% to CYP51F1  Aspergillus fumigatus = CYP51F1
          see fungal pages for seq

CYP51F1P  Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          RO3G_08504.1 revised
          60% TO CYP51F1 Rhizopus oryzae
          see fungal pages for seq

CYP51F1   Grosmannia clavigera

CYP51F1   Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI model estExt_fgeneshPB_pg.C_10567
          73% to CYP51F1 Rhizopus oryzae
          see fungal pages for seq

CYP51F1   Batrachochytrium dendrobatidis JEL423 (chytrid)
          43% to CYP51F1 Rhizopus oryzae
          note this species has no obvious CYP61 sequence
          see fungal pages for seq

CYP51F2   Aspergillus nidulans
          AACD01000029 (WGS section)
          64% to 51F2, 60% to 51F1

CYP51F2   Magnaporthe grisea
          AACU01001139 cont2.870
          MG04628.4 (version4) 62% to CYP51 Penicillium

CYP51F2   Fusarium graminearum
          AACM01000179 (WGS section)
          FG04092.1 FGcontig1.179_scaffold2
          60% to CYP51F1 Penicillium 68% to Mg CYP51F2 54% to Mg 51F1

CYP51F2   Fusarium oxysporum
          83% to CYP51F2 Fusarium graminearum
          see fungal pages for seq

CYP51F2   Fusarium verticillioides
          94% to CYP51F2 Fusarium oxysporum
          see fungal pages for seq

CYP51F2   Nectria haematococca (Fusarium solani group)
          80% to Fusarium graminearum CYP51F2
          57% to CYP51F1 like seq fgenesh1_pg.scaffold_2000426, 
          genome annotation in progress
          Note only one intron, not two as seen in CYP51F1

CYP51F2v1 Aspergillus fumigatus strain = ATCC 36607
          GenEMBL AAF32372.1 also AAK73659.1
          cytochrome P450 sterol 14 alpha-demethylase variant

CYP51F2v2 Aspergillus fumigatus Af293
          GenEMBL XP_752137.1 also EAL90099.1
          14-alpha sterol demethylase variant
          74% to 51F2 A. nidulans 62% to 51F1 A. nidulans
          only 5 aa diffs to CYP51F2v1, may be a stran variant

CYP51F2  Neosartorya fischeri NRRL 181
         XM_001267337.1, NFIA_109350
         97% to CYP51F2 Aspergillus fumigatus

CYP51F2  Aspergillus oryzae
         GenEMBL BAE57417.1
         77% to CYP51F4, 75% to CYP51F2 Aspergillus nidulans

CYP51F2  Aspergillus flavus
         99% to CYP51F2 Aspergillus oryzae, 1 aa diff
         see fungal pages for seq

CYP51F2  Aspergillus clavatus NRRL 1
         XM_001271578.1, ACLA_046180
         81% to CYP51F2 Aspergillus fumigatus

CYP51F2  Aspergillus terreus NIH2624
         XM_001215095.1, ATEG_05917.1
         78% to CYP51F2 Aspergillus fumigatus

CYP51F2  Aspergillus niger CBS 513.88
         XM_001394187.1, CAK40582.1 
         80% to CYP51F2 Aspergillus fumigatus

CYP51F2  Aspergillus niger (from JGI)
         80% to CYP51F2 Aspergillus oryzae, 
         66% to 51F1 Penicillium italicum
         4 aa diffs to Aspergillus niger CBS 513.88

CYP51F2  Ajellomyces capsulatus NAm1
         70% to CYP51F2 Aspergillus fumigatus

CYP51F2  Histoplasma capsulatum G217B
         94% to CYP51F2  Ajellomyces capsulatus NAm1
         two identical sequences
         ABBT01000205.1 Ajellomyces capsulatus G217B 481620-479996 (-)
         ABBT01000207.1 Ajellomyces capsulatus G217B 78633-77009 (-)
         HCB05685.1 identical to HCB06140.1
         see fungal pages for seq

CYP51F2   Penicillium digitatum strain GL-01
          DQ355161.1, also AJ439081 (5 aa diffs)
          67% to CYP51F2 Aspergillus fumigatus

CYP51F2   Metarhizium anisopliae var. acridum Ma102
CYP51F2   Metarhizium anisopliae var. anisopliae Ma23

CYP51F3   Fusarium graminearum
          AACM01000457 (WGS section)
          FG11024.1 FGcontig1.457_scaffold8
          50% to 51F1 N.crassa (third CYP51 in this genome)

CYP51F3   Fusarium oxysporum
          87% to CYP51F3 Fusarium graminearum
          note: gc boundary at DQKR
          see fungal pages for seq

CYP51F3   Fusarium verticillioides
          95% to CYP51F3 Fusarium oxysporum
          see fungal pages for seq

CYP51F3   Nectria haematococca (Fusarium solani group)
          81% to Fusarium graminearum CYP51F3
          52% to fgenesh1_pg.scaffold_2000426, 
          Note two exons, but the second exon is not seen in CYP51F1 or CYP51F2

CYP51F4  Aspergillus oryzae
         GenEMBL BAE63554.1
         72% to 51F2 Aspergillus nidulans, 77% to 51F2 Aspergillus oryzae 
         60% to 51F1 Aspergillus oryzae

CYP51F5  Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         62% to CYP51F1 Rhizopus oryzae
         42% to CYP51F1 Ustilago maydis in the CYP51 family
         45% to CYP51F1   S. pombe
         see fungal pages for seq

CYP51F6  Kluyveromyces polysporus
         65% to CYP51F1 S. cerevisiae
         see fungal pages for seq

CYP51F7  Uncinocarpus reesii
         58% to CYP51F Uncinocarpus reesii from PPVV on
         62% to Aspergillus terreus CYP51F1
         model is short. Seq. runs into a gap, missing last exon
         see fungal pages for seq

CYP51F7  Coccidioides immitis
         84% to CYP51F7 Uncinocarpus reesii 
         (ortholog to second CYP51 in this species)

CYP51F8   confidential basidiomycete

CYP51G1     Triticum aestivum (wheat)
            Francis Durst
            submitted to nomenclature committee
            note: CYP51G subfamily is for Green plants and their close relatives
            see under plants for more 51G sequences

CYP51H1     Oryza sativa (rice)
            note: the CYP51H subfamily is for non-typical CYP51s in Green plants 
            and their close relatives see under plants for more 51H sequences

52A Subfamily

CYP52A1     Candida tropicalis
            GenEMBL M24894 M15945
            Sanglard,D. and Loper,J.C.
            Characterization of the alkane-inducible cytochrome P450 (P450alk)
            gene from the yeast Candida tropicalis: identification of a new
            P450 gene family.
            Gene 76, 121-136 (1989)

CYP52A2     Candida tropicalis
            Swiss P30607 (522 amino acids) GenEMBL M63258 (5745bp)
            Seghezzi,W., Sanglard,D. and Fiechter,A.
            Characterization of a second alkane-inducible cytochrome
            P450p-encoding gene, CYP52A2, from Candida tropicalis
            Gene 106, 51-60 (1991)

CYP52A3     Candida maltosa
            GenEMBL D12475 D01168 (2047bp)
            Ohkuma,M., Hijiki,T., Tanimoto,T., Schunck,W.H., Muller,H.G.,
            Yano,K. and Takagi,M.
            Evidence that more than one gene encodes n-alkane-inducible
            cytochrome P-450s in Candida maltosa, found by two-step gene
            Agric. Biol. Chem. 55, 1757-1764 (1991)
            Note: This is CYP52A3-b, one of two alleles in C. maltosa.

CYP52A3     Candida maltosa
            GenEMBL S77461 (2047bp) Swiss P24458 (523 amino acids)
            Ohkuma,M., Hikiji,T., Tanimoto,T., Schunck,W.H., Muller,H.G.,
            Yano,K. and Takagi,M.
            Evidence that more than one gene encodes n-alkane-inducible
            cytochrome P-450s in Candida maltosa, found by two-step gene
            Agric. Biol. Chem. 55, 1757-1764 (1991)

CYP52A4     Candida maltosa
            GenEMBL X51932, S64322 (1787bp) 
            Schunck,W.H., Vogel,F., Gross,B., Kargel,E., Mauersberger,S.,
            Kopke,K., Gengnagel,C. and Muller,H.G.
            Comparison of two cytochromes P-450 from Candida maltosa:
            primary structures, substrate specificities and effects of
            their expression in Saccharomyces cerevisiae on the proliferation
            of the endoplasmic reticulum.
            Eur. J. Cell Biol. 55, 336-345 (1991)

CYP52A5      Candida maltosa
             GenEMBL D12714

             GenEMBL X55881
             Ohkuma,M., Muraoka,S., Tanimoto,T., Fujii,M., Ohta,A. and Takagi,M.
             CYP52 (cytochrome P450alk) multigene family in Candida maltosa:
             identification and characterization of eight members.
             DNA Cell Biol. 14, 163-173 (1995)

CYP52A6     Candida tropicalis 
            GenEMBL Z13010 (2501bp) Swiss P30608 (524 amino acids)
            Seghezzi,W., Meili,C., Ruffiner,R., Kuenzi,R., Sanglard,D. and
            Identification and characterization of additional members of the
            cytochrome P450 gene family CYP52 of Candida tropicalis.
            DNA Cell Biol. 11, 767-780 (1992)

CYP52A7     Candida tropicalis
            GenEMBL Z13011 (2087bp) Swiss P30609 (507 amino acids)
            Seghezzi,W., Meili,C., Ruffiner,R., Kuenzi,R., Sanglard,D. and
            Identification and characterization of additional members of the
            cytochrome P450 gene family CYP52 of Candida tropicalis.
            DNA Cell Biol. 11, 767-780 (1992)

CYP52A8     Candida tropicalis
            GenEMBL Z13012 (1929bp) Swiss P30610 (517 amino acids)
            Seghezzi,W., Meili,C., Ruffiner,R., Kuenzi,R., Sanglard,D. and
            Identification and characterization of additional members of the
            cytochrome P450 gene family CYP52 of Candida tropicalis.
            DNA Cell Biol. 11, 767-780 (1992)

CYP52A9     Candida maltosa
            GenEMBL D26160 (283bp)
            ALK5-B allele of CYP52A9 ALK5-A

CYP52A9     Candida maltosa
            PIR JS0723

CYP52A10    Candida maltosa

CYP52A11    Candida maltosa
            GenEMBL D26159 (815bp)
            ALK8-B allele of CYP52A11 ALK8-A

Note on CYP52A12-CYP52A20 and CYP52D2 from Candida tropicalis.
These sequences seem to be orthologs of other Candida tropicalis sequences.
52A12 seems to be an ortholog of 52A6
52A13 and 52A14 seem to be orthologs of 52A2
52A15 and 52A16 seem to be orthologs of 52A1
52A17 and 52A18 seem top be orthologs of 52A8
52A19 and 52A20 seem to be orthologs of 52A7
the last 8 listed appear in what might be allelic pairs 94-96% identical to each other.
It seems probable that these actually are the orthologs of those other sequences
and this Candida tropicalis strain is different from the other.
CYP52D2 matches Candida maltosa 52D1 and was not observed in C. tropicalis before.

CYP52A12    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 1p
            90% to CYP52A6

CYP52A13    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 2p might be an allele of CYP52A14 (96% identical)
            86% to CYP52A2

CYP52A14    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 3p might be an allele of CYP52A13 (96% identical)
            87% to CYP52A2

CYP52A15    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 4p might be an allele of CYP52A16 (95% identical)
            85% to CYP52A1

CYP52A16    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 5p might be an allele of CYP52A15 (95% identical)
            84% to CYP52A1

CYP52A17    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 7p might be an allele of CYP52A18 (94% identical)
            78% to CYP52A8

CYP52A18    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 8p might be an allele of CYP52A17 (94% identical)
            77% to CYP52A8

CYP52A19    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 9p might be an allele of CYP52A20 (95% identical)
            75% to CYP52A7

CYP52A20    Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 10p might be an allele of CYP52A19 (95% identical)
            76% to CYP52A7

CYP52A21    Candida albicans
            GenEMBL XM_705082 (one aa diff to the Kim seq), orf19_10
            XM_705076 (one aa diff to the Kim seq)
            Y14766 (3 aa diffs to the Kim seq)
            Donghak Kim and Paul Ortiz de Montellano
            Submitted to nomenclature committee July 21, 2006
            72% to CYP52A11 (ALK8) of Candida maltosa

CYP52A22    Candida albicans SC5314
            79% to CYP52A4 orf19_7512
            see Fungal pages for seq

CYP52A23    Candida albicans SC5314
            78% to CYP52A5 orf19_7513
            see Fungal pages for seq

CYP52A24    Candida albicans SC5314
            78% to CYP52A3 orf19_5728 partial sequence
            see Fungal pages for seq

CYP52A25    Candida dublinensis
            79% to CYP52A3 Candida maltosa
            see Fungal pages for seq

CYP52A26    Candida dublinensis
            89% to CYP52A21 Candida albicans
            see Fungal pages for seq

CYP52A27    Candida dublinensis
            94% to CYP52A23 Candida albicans
            see Fungal pages for seq

CYP52A28    Candida dublinensis
            93% to CYP52A22 Candida albicans
            see Fungal pages for seq

CYP52A29    Candida lusitaniae
            55% to CYP52A13 Candida tropicalis
            see Fungal pages for seq

CYP52A30    Candida lusitaniae
            55% to CYP52A23   Candida albicans
            see Fungal pages for seq

CYP52A31    Candida lusitaniae
            52% to CYP52A18 Candida tropicalis
            see Fungal pages for seq

CYP52A32    Candida parapsilosis
            71% to CYP52A5 Candida maltosa
            see Fungal pages for seq

CYP52A33    Candida parapsilosis
            73% to CYP52A5 Candida maltosa
            see Fungal pages for seq

CYP52A34    Candida parapsilosis
            71% to CYP52A5 Candida maltosa
            see Fungal pages for seq

CYP52A35    Candida parapsilosis
            65% to CYP52A21 Candida albicans
            see Fungal pages for seq

CYP52A36    Candida parapsilosis
            65% to CYP52A21 Candida albicans
            see Fungal pages for seq

CYP52A37    Candida parapsilosis
            58% to CYP52A12 Candida tropicalis
            see Fungal pages for seq

CYP52A38    Candida parapsilosis
            74% to CYP52A25 Candida dublinensis
            see Fungal pages for seq

CYP52A39    Candida guilliermondii
            66% to CYP52A14 Candida tropicalis
            see Fungal pages for seq

CYP52A40    Candida guilliermondii
            60% to CYP52A25 Candida dublinensis
            see Fungal pages for seq

CYP52A41    Candida guilliermondii
            52% to CYP52A12 Candida tropicalis
            see Fungal pages for seq

CYP52A42    Candida guilliermondii
            62% to CYP52A23 Candida albicans
            see Fungal pages for seq

CYP52A43    Debaryomyces hansenii
            54% to CYP52A3 Candida maltosa
            see Fungal pages for seq

CYP52A44    Debaryomyces hansenii
            63% to CYP52A25 Candida dublinensis
            see Fungal pages for seq

CYP52A45    Debaryomyces hansenii
            62% to CYP52A14 Candida tropicalis
            see Fungal pages for seq

CYP52A46    Debaryomyces hansenii
            63% to CYP52A14 Candida tropicalis
            see Fungal pages for seq

CYP52A47    Debaryomyces hansenii
            65% to CYP52A14 Candida tropicalis
            see Fungal pages for seq

CYP52A48    Lodderomyces elongisporus
            73% to CYP52A38 Candida parapsilosis
            see Fungal pages for seq

CYP52A49    Lodderomyces elongisporus
            72% to CYP52A37 Candida parapsilosis
            see Fungal pages for seq

CYP52A50    Lodderomyces elongisporus
            71% to CYP52A37 Candida parapsilosis
            see Fungal pages for seq

CYP52A51    Lodderomyces elongisporus
            75% to CYP52A35 Candida parapsilosis
            see Fungal pages for seq

CYP52A52    Lodderomyces elongisporus
            70% to CYP52A5 Candida maltosa
            see Fungal pages for seq

CYP52A53    Pichia stipitis
            JGI model e_gww1.3.1.449.1
            65% to CYP52A40 Candida guilliermondii
            see Fungal pages for seq

CYP52A54    Pichia stipitis
            JGI model e_gww1.3.1.459.1
            63% to CYP52A44 Debaryomyces hansenii
            see Fungal pages for seq

CYP52A55    Pichia stipitis
            JGI model  fgenesh1_pm.C_chr_3.1000237
            63% to CYP52A14 Candida tropicalis
            see Fungal pages for seq

CYP52A56    Pichia stipitis
            JGI model fgenesh1_pm.C_chr_8.1000042
            59% to CYP52A38 Candida parapsilosis
            see Fungal pages for seq

CYP52A57    Pichia stipitis
            JGI model e_gww1.3.1.1392.1
            62% to CYP52A39 Candida guilliermondii
            see Fungal pages for seq

52B Subfamily

CYP52B1     Candida tropicalis
            GenEMBL Z13013 (2442bp) Swiss P30611 (506 amino acids)
            Seghezzi,W., Meili,C., Ruffiner,R., Kuenzi,R., Sanglard,D. and
            Identification and characterization of additional members of the
            cytochrome P450 gene family CYP52 of Candida tropicalis.
            DNA Cell Biol. 11, 767-780 (1992)

52C Subfamily

CYP52C1     Candida tropicalis
            GenEMBL Z13014 (1622bp) Swiss P30612 (505 amino acids)
            Seghezzi,W., Meili,C., Ruffiner,R., Kuenzi,R., Sanglard,D. and
            Identification and characterization of additional members of the
            cytochrome P450 gene family CYP52 of Candida tropicalis.
            DNA Cell Biol. 11, 767-780 (1992)

CYP52C2    Candida maltosa

CYP52C3    Candida albicans SC5314
           60% to CYP52C2 orf19_6574
           see Fungal pages for seq

CYP52C4    Candida dublinensis
           94% to CYP52C3 Candida albicans (ortholog)
           see Fungal pages for seq

CYP52C5    Candida parapsilosis
           48% to CYP52C3  Candida albican
           There is one 52C seq per Candida species except this 
           species has two. They all seem to be orthologs even 
           though the percent identity is not high
           see Fungal pages for seq

CYP52C6    Candida parapsilosis
           50% to CYP52C2 Candida maltosa
           53% to to CYP52C5 this species
           see Fungal pages for seq

CYP52C7    Lodderomyces elongisporus
           54% to CYP52C6 Candida parapsilosis
           48% to CYP52C3 Candida albicans
           see Fungal pages for seq

52D Subfamily

CYP52D1    Candida maltosa

CYP52D2     Candida tropicalis
            No accession number
            David Craft Cognis Corp.
            Submitted to nomenclature committee June 26, 2001
            Clone name 6p 
            61% to CYP52D1

52E Subfamily

CYP52E1     Candida apicola 
            GenEMBL X76225 (1560bp) PIR S38894 (519 amino acids)
            unpublished (1994)

CYP52E2     Candida apicola 
            GenEMBL X87640 (2203bp)
            Lottermoser,K., Schunck,W.H. and Asperger,O.
            Cytochromes P450 of the sophorose lipid-producing yeast Candida
            apicola: heterogeneity and polymerase chain reaction-mediated
            cloning of two genes
            Yeast 12 (6), 565-575 (1996)

CYP52E3     Candida bombicola, alternative name Starmerella bombicola
            Inge Van Bogaert
            Submitted to nomenclature committee Dec. 7, 2007
            92% to 52E2, 82% to 52E1

CYP52E4     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            86% to CYP52E1

CYP52E5     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            86% to CYP52E1

CYP52E6     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            86% to CYP52E1

52F Subfamily

CYP52F1     Yarrowia lipolytica
            GenEMBL AB010388 (3578bp), GenPept CAG80007.1
            Iida,T., Ohta,A. and Takagi,M.
            Cloning and characterization of an n-alkane-inducible cytochrome
            P450 gene essential for n-decane assimilation by Yarrowia 
            Yeast 14 (15), 1387-1397 (1998)
            gene for ALK1
            see Fungal pages for seq

CYP52F2    Yarrowia lipolytica gene for ALK2
            GenEMBL   AB010389, GenPept CAG77659.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F3    Yarrowia lipolytica gene for ALK3
            GenEMBL   AB010390, GenPept  CAG79910.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F4    Yarrowia lipolytica gene for ALK4
            GenEMBL   AB010391, GenPept CAG83106.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F5    Yarrowia lipolytica gene for ALK5
            GenEMBL   AB010392, GenPept CAG83107.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F6    Yarrowia lipolytica gene for ALK6
            GenEMBL   AB010393, GenPept CAG82620.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F7    Yarrowia lipolytica gene for ALK7
            GenEMBL   AB010394, GenPept CAG84028.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F8    Yarrowia lipolytica gene for ALK8
            GenEMBL   AB010395, GenPept CAG82058.1
            Iida,T., Ohta,A. and Takagi,M.
            Yarrowia lipolytica cytochrome P450 gene, complete cds
            see Fungal pages for seq

CYP52F9    Yarrowia lipolytica
           64% to CYP52F3
           see Fungal pages for seq

CYP52F10   Yarrowia lipolytica
           71% to CYP52F1
           see Fungal pages for seq

CYP52F11   Yarrowia lipolytica
           69% to CYP52F2
           see Fungal pages for seq

CYP52G1   Aspergillus nidulans
          38% to 539A1 46% to 52F1 52 clan
          see Fungal pages for seq

CYP52G2  Aspergillus fumigatus Af293
         GenEMBL XP_755288.1 also EAL93250.1 
         60% to 52G1

CYP52G2   Neosartorya fischeri
          97% to CYP52G2 Aspergillus fumigatus = ortholog
          see Fungal pages for seq

CYP52G3  Aspergillus oryzae
         GenEMBL BAE65166.1, AP007171.1
         58% to CYP52G4, 63% to 52G1
         14 P450 genes and 2 pseudogenes on this contig

CYP52G3   Aspergillus flavus
          99% to CYP52G3  Aspergillus oryzae
          see Fungal pages for seq

CYP52G4  Aspergillus oryzae
         GenEMBL BAE55312.1
         54% to 52G1

CYP52G4   Aspergillus flavus
          99% to CYP52G4  Aspergillus oryzae
          see Fungal pages for seq

CYP52G5P  Nectria haematococca 
          old name = CYP-un1 pseudogene
          PSEUDOGENE very short piece
          57% to 538A3, 54% to 584D1, 61% to 52A3, 68% to 52G2

CYP52G6   Aspergillus niger
          57% to CYP52G2
          see Fungal pages for seq

CYP52G7   Aspergillus niger
          67% to CYP52G3
          see Fungal pages for seq

CYP52G8   Aspergillus clavatus
          83% to CYP52G2
          see Fungal pages for seq

CYP52G9   Aspergillus terreus NIH2624
          GenPept EAU33222.1
          62% to CYP52G2
          see Fungal pages for seq

CYP52G10  Aspergillus terreus
          68% to CYP52G4
          see Fungal pages for seq

CYP52G11  Beauveria bassiana (an entomopathogenic fungus, Pezizomycotina)
          No accession number
          Nicolas Pedrini, Nemat O. Keyhani
          Submitted to nomenclature committee Dec. 3, 2009
          Clone name P450-4 
          66% TO CYP52G6 Aspergillus niger, 56% TO CYP52G2 Aspergillus fumigatus

CYP52H1  Aspergillus nidulans
         45% to 584B1 52 clan
         see Fungal pages for seq

CYP52H2  Aspergillus fumigatus Af293
         GenEMBL XP_746567.1 also EAL84529.1
         cytochrome P450 alkane hydroxylase
         72% to 52H1

CYP52H2   Neosartorya fischeri
          95% to CYP52H2 Aspergillus fumigatus = ortholog
          see Fungal pages for seq

CYP52H3  Aspergillus oryzae
         GenEMBL BAE64862.1, AP007171.1
         71% to 52H1, 48% to 584G1
         14 P450 genes and 2 pseudogenes on this contig

CYP52H3   Aspergillus flavus
          100% to CYP52H3 Aspergillus oryzae
          see Fungal pages for seq

CYP52H4   Aspergillus niger
          73% to CYP52H2
          see Fungal pages for seq

CYP52H5   Aspergillus clavatus
          84% to CYP52H2 Aspergillus fumigatus
          see Fungal pages for seq

CYP52H6   Aspergillus terreus
          75% to CYP52H5
          see Fungal pages for seq

CYP52J1P  Aspergillus fumigatus Af293
          GenEMBL XP_746816.1 also EAL84778.1
          alkane hydroxylase predicted
          42% to CYP52F1, in 52 clan
          insertion of 11 C bases causes frameshift = &

CYP52J1   Neosartorya fischeri
          95% to CYP52J1 Aspergillus fumigatus = ortholog
          see Fungal pages for seq

CYP52J2   Uncinocarpus reesii
          71% to 52J1 in overlapping parts
          see Fungal pages for seq

CYP52K1  Aspergillus oryzae
         GenEMBL BAE66393.1
         44% to 52A5, 44% TO CYP52J1

CYP52K1P  Aspergillus flavus
          97% to CYP52K1  Aspergillus oryzae
          small 6 aa deletion and frameshift = &
          see Fungal pages for seq

CYP52L1   Graphium sp. ATCC 58400
          GenEMBL AY438638.1
          Skinner,K.M., Cone,M. and Ciuffetti,L.M.
          Characterization and cloning of an alkane inducible cytochrome P450
          monooxygenase from a filamentous fungi, Graphium sp.
          alkane monooxygenase P-450 (ALK1) gene
          41/65 top blast hits to a complete set of named fungal P450s
          are CYP52 sequences.  The others are from CYP538, CYP539, CYP584, CYP585
          related families in the CYP52 clan of fungal P450s.
          45% to CYP52G2 Aspergillus fumigatus

CYP52M1   Candida bombicola alternative name Starmerella bombicola
          Inge Van Bogaert
          Submitted to nomenclature committee Dec. 7, 2007
          45% to CYP52A3, 45% to CYP52E1

CYP52N1   Candida bombicola alternative name Starmerella bombicola
          Inge Van Bogaert
          Submitted to nomenclature committee Dec. 7, 2007
          45% to CYP52M1, 45% to CYP52A15

CYP52N2     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            94% to CYP52N3, 85% to CYP52N1

CYP52N3     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            94% to CYP52N2, 85% to CYP52N1

CYP52P1   Aspergillus niger
          46% to CYP52K1
          see Fungal pages for seq

CYP52P2   Mycosphaerella graminicola
          53% to CYP52P1 A. niger, 47% to 52K1 (missing N-term)
          yellow from JGI model e_gw1.8.895.1|Mycgr3
          see Fungal pages for seq

CYP52P3   Metarhizium anisopliae var. acridum Ma102

CYP52Q1   Aspergillus niger
          45% to CYP52H3, 41% to CYP52P1
          see Fungal pages for seq

CYP52R1   Mycosphaerella graminicola
          51% to CYP52G2 Aspergillus fumigatus
          see Fungal pages for seq

CYP52R2   Mycosphaerella fijiensis
          60% to CYP52R1 Mycosphaerella graminicola
          see Fungal pages for seq

CYP52S1   Yarrowia lipolytica
          42% to 52H3, 44% to 52F1
          see Fungal pages for seq

CYP52T1   Aspergillus terreus
          48% to CYP52G2
          see Fungal pages for seq

CYP52V1X  Metarhizium anisopliae
          No accession number
          Renamed CYP52X2

CYP52U1   Metarhizium anisopliae var. acridum Ma102
          No accession number

CYP52W1   Metarhizium anisopliae var. acridum Ma102
          No accession number

CYP52X1   Beauveria bassiana (an entomopathogenic fungus, Pezizomycotina)
          No accession number
          Nicolas Pedrini, Nemat O. Keyhani
          Submitted to nomenclature committee Dec. 3, 2009
          Clone name P450-1 
          48% to CYP52R1 Mycosphaerella graminicola
          50% to CYP52G2 Neosartorya fischeri
          60% to CYP52X2 

CYP52X2   Metarhizium anisopliae var. acridum Ma102
          No accession number

CYP52X2   Metarhizium anisopliae var. anisopliae Ma23

CYP52X3   Trichodherma harzianum (anamorph) Hypocrea lixii (teleomorph)
          No accession number
          Renata Del Carratore
          Submitted to nomenclature committee July 13, 2010
          65% to CYP52X2 Metarhizium anisopliae
          47% to CYP52R1 Mycosphaerella graminicola
          49% to CYP52G2 Neosartorya fischeri NFIA_085030

53A Subfamily

CYP53A1     Aspergillus niger
            GenEMBL X52521
            van Gorcom,R.F., Boschloo,J.G., Kuijvenhoven,A., Lange,J., van
            Vark,A.J., Bos,C.J., van Balken,J.A., Pouwels,P.H. and van den
            Isolation and molecular characterisation of the
            benzoate-para-hydroxylase gene (bphA) of Aspergillus niger: a
            member of a new gene family of the cytochrome P450 superfamily
            Mol. Gen. Genet. 223, 192-197 (1990)

CYP53A2     Aspergillus parasiticus
            GenEMBL AC005991
            Lewis,J., Kupfer,D., Keller,N. and Roe,B.A.
            Aspergillus parasiticus Cosmid Clone ap0
            57% to CYP53A3

CYP53A3   Aspergillus nidulans or Emericella nidulans
          GenEMBL AY048583, AN7589.1
          Fraser,J.A., Davis,M.A. and Hynes,M.J.
          Submitted to nomenclature committee Oct. 3, 2000
          benzoate-para-hydroxylase (bzuA) gene
          82% identical to CYP53A1

CYP53A4   Neurospora crassa
          AABX01000266.1 cont3.41 NCU01086.1 (version3)
          65% to 53A1 over 417 aa
          note the automated assembly of the gene is missing the KYG 
          fragment seen in 53A1.  See my assembly for corrected seq.
          Neurospora crassa sequence contig 1.248  (supercontig 26)

CYP53A4   Neurospora discreta
          JGI gene model estExt_Genewise1Plus.C_10226
          97% to CYP53A4 N. crassa
          see Fungal pages for seq

CYP53A5   Magnaporthe grisea
          AACU01000984.1 cont2.1481 runs off end, changed C-term
          AACU01000983 cont2.1480 = N-term
          69% to CYP53A4 (split on two contigs)
          see Fungal pages for seq

CYP53A6   Fusarium graminearum
          FG08079.1 AACM01000324 FGcontig1.324_scaffold5
          see Fungal pages for seq

CYP53A7   Fusarium graminearum
          FG08086.1 AACM01000324 FGcontig1.324_scaffold5
          see Fungal pages for seq

CYP53A8   Fusarium graminearum
          FG10451.1 AACM01000435 FGcontig1.435_scaffold7
          see Fungal pages for seq

CYP53A10  Nectria haematococca (Fusarium solani group)
          83% to Fusarium graminearum CYP53A7 possible ortholog
          59% to fgenesh1_pg.scaffold_12000228,
          Note: this seq has two more introns than the CYP53A8 ortholog
          This gene model seems correct DRN 2/4/06
          see Fungal pages for seq

CYP53A11  Nectria haematococca (Fusarium solani group)
          84% to Fusarium graminearum CYP53A8 possible ortholog
          64% TO 53A1 Aspergillus niger
          This gene model seems correct DRN 2/4/06
          see Fungal pages for seq

CYP53A12  Aspergillus fumigatus Af293
          GenEMBL XP_755858.1 also EAL93820.1
          benzoate 4-monooxygenase
          85% to CYP53A1, 79% to 53A3 seq looks correct

CYP53A12   Neosartorya fischeri
           96% to CYP53A12 Aspergillus fumigatus = ortholog
           see Fungal pages for seq

CYP53A13  Aspergillus oryzae
          GenEMBL BAE60506.1
          58% TO CYP53A14, 81% to 53A3

CYP53A13   Aspergillus flavus
           99% to CYP53A13  Aspergillus oryzae, 
           1 aa diff, N-term extension deleted
           see Fungal pages for seq

CYP53A14  Aspergillus oryzae
          56% to 53A3

CYP53A15  Cochliobolus lunatus
          Nada Krasevec
          Submitted to nomenclature committee July 10, 2007
          65% to CYP53A1

CYP53A16  Mycosphaerella graminicola
          64% to CYP53A11 Nectria haematococca
          see Fungal pages for seq

CYP53A17  Uncinocarpus reesii
          74% to CYP53A1   Aspergillus niger
          model has some missing seq (added back)
          see Fungal pages for seq

CYP53A18  Coccidioides immitis
          90% to CYP53A17
          see Fungal pages for seq

CYP53A19  Fusarium oxysporum
          90% to CYP53A8
          see Fungal pages for seq

CYP53A19  Fusarium verticillioides
          98% to CYP53A19 Fusarium oxysporum = ortholog
          see Fungal pages for seq

CYP53A20  Fusarium oxysporum
          92% to CYP53A7
          see Fungal pages for seq

CYP53A20  Fusarium verticillioides
          97% to CYP53A20 Fusarium oxysporum = ortholog
          see Fungal pages for seq

CYP53A21  Aspergillus clavatus
          90% to CYP53A12
          see Fungal pages for seq

CYP53A22  Aspergillus terreus
          85% to CYP53A12
          see Fungal pages for seq

CYP53A23  Mycosphaerella fijiensis
          88% to CYP53A16 Mgr055 Mycosphaerella graminicola
          see Fungal pages for seq

CYP53A24  Metarhizium anisopliae var. anisopliae Ma23
CYP52A25  Metarhizium anisopliae var. acridum Ma102
CYP53A25  Metarhizium anisopliae var. anisopliae Ma23

CYP53A26  Beauveria bassiana (an entomopathogenic fungus, Pezizomycotina)
          No accession number
          Nicolas Pedrini, Nemat O. Keyhani
          Submitted to nomenclature committee Dec. 3, 2009
          Clone name P450-7 
          76% TO CYP53A11 Nectria haematococca

CYP53A27  Grosmannia clavigera

53B Subfamily

CYP53B1     Rhodotorula minuta (a fungi)
            GenEMBL D63703(2766bp)
            Fukuda,H., Nakamura,K., Shibuya,K., Tanase,S., Gotoh,O., Ogawa,T.
            and Fujii,T.
            Nucleotide sequence of gene for cytochrome P450rm from Rhodotorula
            minuta IFO 1102.
            Unpublished (1995)

CYP53B2     Sporobolomyces roseus
            57% to CYP53B1 Rhodotorula minuta 
            see Fungal pages for seq

CYP53B3     Puccinia graminis f. sp. Tritici
            PGTG_08085 +  PGTG_08086 revised
            54% to CYP53B2 from LNRYP
            see Fungal pages for seq

CYP53C1     Ustilago maydis
            GenEMBL XM_397620.1
            hypothetical protein UM00005.1
            in the CYP53 clan part B 54% to 53A1 54% to 53B1

CYP53C2  Phanerochaete chrysosporium
         55% to CYP53C1
         my Scaffold_164a
         JGI gene models ug.1.19.1 and pc.1.261.1

CYP53C3   Postia placenta (brown rot basidiomycete fungi)
CYP53C4   confidential basidiomycete
CYP53D1   Postia placenta (brown rot basidiomycete fungi)
CYP53D2v1 Postia placenta (brown rot basidiomycete fungi)
CYP53D2v2 Postia placenta (brown rot basidiomycete fungi)
CYP53D3   Postia placenta (brown rot basidiomycete fungi)
CYP53D4   Postia placenta (brown rot basidiomycete fungi)
CYP53D5   Postia placenta (brown rot basidiomycete fungi)
CYP53D6   Postia placenta (brown rot basidiomycete fungi)

CYP53D1X  Fusarium oxysporum
          48% to CYP53A10
          see Fungal pages for seq
          renamed CYP53F1 due to name conflict

CYP53E1   Grosmannia clavigera

CYP53F1   Fusarium oxysporum
          48% to CYP53A10
          see Fungal pages for seq
          formerly CYP53D1

54A Subfamily

CYP54A1     Neurospora crassa
            GenEMBL X15033
            Neurospora crassa sequence contig 1.1450 (supercontig 261)
The translation below is more accurate than the one in Genbank

CYP54A1   Neurospora discreta
          JGI gene model scaffold_13-snap.17.1
          93% to CYP54A N. crassa
          see Fungal pages for seq

CYP54B1   Magnaporthe grisea
          45% to CYP54A1 AACU01000043 cont2.256
          AI068604 revised to fill in gap
          see Fungal pages for seq

CYP54C1   Fusarium graminearum
          FG11536.1 AACM01000473 FGcontig1.473_scaffold10
          see Fungal pages for seq

CYP54C2   Nectria haematococca (Fusarium solani group)
          75% to Fusarium graminearum CYP54C1 probable ortholog
          small gap after GYQK? (5 aa), this seq looks right,
          maybe the 54C seq is too long here. 
          Note LTIEQ can be removed from 54C and
          the intron boundary is preserved.
          This gene model seems correct
          see Fungal pages for seq

CYP54C3   Cryphonectria parasitica 
          CB690595.1 60% to CYP54C2 N-term only, 55% TO 54C1 

CYP54C4   Cryphonectria parasitica 
          CB686707.1 CB688482.1
          55% TO CYP54C1 

CYP54C5   Fusarium oxysporum
          82% to CYP54C1
          see Fungal pages for seq

CYP54C5   Fusarium verticillioides
          FVEG_00258 revised
          90% to CYP54C5 Fusarium oxysporum = ortholog
          see Fungal pages for seq

CYP54C6   Metarhizium anisopliae var. anisopliae Ma23

55A Subfamily

CYP55A1     Fusarium oxysporum
            GenEMBL D14517 (2598bp)
            Tomura,D., Obika,K., Fukamizu,A. and Shoun,H.
            Nitric oxide reductase cytochrome P450 (P450nor) gene,
            CYP 55, of the fungus Fusarium oxysporum containing a
            putative FNR site in its upstream flanking region.
            unpublished (1993)

CYP55A1     Fusarium oxysporum
            PIR A40401 (403 amino acids)
            Kizawa, H., Tomura, D., Oda, M., Fukamizu, A., Hoshino, T.,
            Gotoh, O., Yasui, T., Shoun, H.
            Nucleotide sequence of the unique nitrate/nitrite-inducible
            cytochrome P-450 cDNA from Fusarium oxysporum.
            J. Biol. Chem. 266, 10632-10637 (1991)
            Note: This sequence is probably a bacterial sequence related to the 

CYP55A1     Fusarium oxysporum
            GenEMBL D14517 (2598bp)
            Park, S.-Y., Shimizu, H., Adachi, S.-i., Nakagawa,A., 
            Tanaka, I., Nakahara, K.,
            Shoun, H., Obayashi, E., Nakamura, H., Iizuka, T. and Shiro, Y.
            Crystal structure of nitric oxide reductase from dentrifying fungus 
            Fusarium oxysporum.
            Nature Structural Biology 4, 827-832 (1997)

CYP55A1v2   Fusarium oxysporum
            96% to CYP55A1v1
            see Fungal pages for seq

CYP55A1     Fusarium verticillioides
            96% to CYP55A1v2 Fusarium oxysporum
            see Fungal pages for seq

CYP55A2     Cylindrocarpon tonkinense (a denitrifying fungus)
            GenEMBL D78511

CYP55A3      Cylindrocarpon tonkinense (a denitrifying fungus)
             GenEMBL D78512

CYP55A4      Trichosporon cutaneum (a basidiomycete fungus)
             GenEMBL AB052733
             Zhang,L., Takaya,N., Kitazume,T., Kondo,T. and Shoun,H.
             Purification and cDNA cloning of nitric oxide reductase cytochrome
             P450nor (CYP55A4) from Trichosporon cutaneum
             Eur. J. Biochem. 268 (11), 3198-3204 (2001)
             Submitted to nomenclature committee Oct. 11, 2000 
             66% to CYP55A1

CYP55A5v1    Aspergillus oryzae
             GenEMBL AB055659
             Kaya,M., Hata,Y., Kawato,A., Abe,Y. and Akita,O.
             Aspergillus oryzae CYP55A5 gene for cytochrome P450nor
             Submitted to nomenclature committee Jan. 23, 2001 
             60% to 55A1

CYP55A5v1  Aspergillus oryzae
           GenEMBL BAC01275.1 
           cytochrome P450nor

CYP55A5v2  Aspergillus oryzae
           GenEMBL BAE61721.1
           6 aa diffs to CYP55A5v1

CYP55A5   Aspergillus flavus
          99% to CYP55A5v2 Aspergillus oryzae, 2 aa diffs
          Supercontig 11: 146268-147914 (-) strand
          see Fungal pages for seq

CYP55A6   Neurospora crassa
          AABX01000354.1 cont3.356 NCU06137.1 (version3)
          Neurospora crassa sequence contig 1.183  (supercontig 22)
          70% to CYP55A1
          EST h8b02ne.f1 in lower case

CYP55A6   Neurospora discreta
          JGI gene model estExt_fgenesh3_pm.C_80311
          95% to CYP55A6 N. crassa
          see Fungal pages for seq

CYP55A7   Trichosporon domesticus SBUG 752 (a basidiomycete fungus)
          GenEMBL AY044231 and AY044232
          Dirk Patzak
          Submitted to nomenclature committee March 4, 2002 
          124 amino acid N-terminal fragment
          77% to 55A4

CYP55A8   Fusarium graminearum
          FG11585.1 AACM01000475.1 FGcontig1.475_scaffold11
          see Fungal pages for seq

CYP55A9   Nectria haematococca (Fusarium solani group)
          92% to CYP55A2 Cylindrocarpon tonkinense probable ortholog
          genome annotation in progress
          79% to CYP55A8 Fusarium graminearum 
          This gene model seems correct DRN 2/5/06
          see Fungal pages for seq

CYP55A10  Nectria haematococca (Fusarium solani group)
          fgenesh1_pg.scaffold_28000090 [Necha1:94366]
          96% to CYP55A3 Cylindrocarpon tonkinense probable ortholog
          genome annotation in progress
          Note: the very high similarity suggests a very close 
          relationship  between the two species.  This is higher 
          than the ortholog pair matches between
          F. graminearum and N. haematococca
          This seq is originally of bacterial origin (P450 B type 
          not E type) similar to CYP105s
          This gene model seems correct DRN 2/4/06
          see Fungal pages for seq

CYP55A11  Nectria haematococca (Fusarium solani group)
          estExt_fgenesh1_pg.C_880004 (better model)
          58% to CYP55A3 Cylindrocarpon tonkinense
          69% to AB226066.1  Aspergillus oryzae cDNA
          58% to fgenesh1_pg.scaffold_28000090
          54% to CYP55A8 Fusarium graminearum
          same as fgenesh1_pg.scaffold_88000004 which is too long at
          SNAQAHPAP between MHQ and RQM
          Note: This gene has one extra intron at the N-terminal
          that only codes for 3 amino acids
          This gene model seems correct DRN 2/5/06
          see Fungal pages for seq

CYP55A12P Aspergillus niger
          48% to CYP55A5v1 aa 53-257, this is a pseudogene
          see Fungal pages for seq

CYP55A13  Uncinocarpus reesii
          71% to CYP55A5v1  Aspergillus oryzae
          see Fungal pages for seq

CYP55A14  Histoplasma capsulatum
          73% to CYP55A13
          see Fungal pages for seq

CYP55A15P Fusarium oxysporum
          74% to CYP55A2 Cylindrocarpon tonkinense
          see Fungal pages for seq

CYP55A16P Fusarium oxysporum
          83% to CYP55A11
          see Fungal pages for seq

CYP55A17  Aspergillus terreus
          73% to CYP55A13 Uncinocarpus reesii
          see Fungal pages for seq

CYP55A18  Trichophyton rubrum
          ESTs DW700172.1, DW689200.1, DW681558.1
          72% to CYP55A14 Histoplasma capsulatum
          see Fungal pages for seq

CYP55A19  Metarhizium anisopliae var. acridum Ma102
CYP55A19  Metarhizium anisopliae var. anisopliae Ma23
CYP55A20  Metarhizium anisopliae var. acridum Ma102
CYP55A20  Metarhizium anisopliae var. anisopliae Ma23

CYP55B1   Chlamydomonas reinhardtii (green algae)
          See Chlamydomonas pages 

CYP55C1   Aspergillus niger
          40% to CYP55A1, 40% to CYP55B1
          see Fungal pages for seq

56A Subfamily

CYP56A1   Saccharomyces cerevisiae
          GenEMBL X55713(2265bp) PIR S13502 (489 amino acids)
          Briza, P., Breitenbach, M., Ellinger, A. and Segall, J.
          Isolation of two developmentally regulated genes involved in
          spore wall maturation in Saccharomyces cerevisiae.
          Genes Dev. 4, 1775-1789 (1990)

CYP56A2   Saccharomyces paradoxus NRRL Y-17217
          GenEMBL AABY01000059.1 
          91% to CYP56A1
45359  LKFTENITE*  45330

CYP56A3   Saccharomyces bayanus MCYC 623
          GenEMBL AACA01000139.1 
          83% to CYP56A1
21725  LNFKERLPS*  21696

CYP56A4   Saccharomyces castellii NRRL Y-12630
          GenEMBL AACF01000075.1
          63% to CYP56A1

CYP56A5   Candida glabrata strain CBS138
          GenEMBL CR380952.1, GenPept CAG59007.1
          57% to CYP56A1 

CYP56A6   Ashbya gossypii (= Eremothecium gossypii)
          GenEMBL AE016819, NP_985947.1
          54% to CYP56A1 

CYP56A7   Kluyveromyces lactis NRRL Y-1140
          GenEMBL XM_452498, KLLA0C06743g 
          49% to CYP56A1, 53% to 56A6 

CYP56A8   Saccharomyces mikatae 
          90% to CYP56A2 Saccharomyces paradoxus partial seq
          see Fungal pages for seq

CYP56A9   Saccharomyces kudriavzevii
          AACI02001147.1, AACI02000561.1
          85% to CYP56A3
          see Fungal pages for seq

CYP56A10  Saccharomyces kluyveri
          AACE03000001.1 Sklu_Contig1634.3 
          Cyan region is an insertion
          60% to CYP56A3 Saccharomyces bayanus w/o the insert
          see Fungal pages for seq

CYP56A11  Kluyveromyces waltii 
          59% to CYP56A10 Saccharomyces kluyveri 
          similar insertion as in 56A10
          see Fungal pages for seq

CYP56A12  Kluyveromyces polysporus
          62% to CYP56A3 Saccharomyces bayanus
          see Fungal pages for seq

CYP56B1  Aspergillus nidulans 
         43% to CYP56A1 547 clan
         revised 7/18/07

CYP56B2   Uncinocarpus reesii
          59% to CYP56B1 Aspergillus nidulans
          see Fungal pages for seq

CYP56B3   Coccidioides immitis
          80% to CYP56B2 Uncinocarpus reesii
          see Fungal pages for seq

CYP56C1   Aspergillus oryzae
          GenEMBL AP007164.1c 
          third P450 of six on this accession
          CDS join(1160825..1161472,1161531..1162415,1162505..1162558)
          47% to CYP56B1 Aspergillus nidulans
          41% to CYP56A1 S. cerevisiae

CYP56C1   Aspergillus flavus
          98% to CYP56C1 Aspergillus oryzae
          see Fungal pages for seq

CYP56C2   Uncinocarpus reesii
          60% to CYP56C1 Aspergillus oryzae
          see Fungal pages for seq

CYP56C3   Aspergillus clavatus
          53% to CYP56C2
          see Fungal pages for seq

CYP56D1   Clavispora lusitaniae ATCC 42720
          GenEMBL AAFT01000066.1, CLUG_02306.1 
          46% to CYP56A1

CYP56E1   Candida tropicalis MYA-3404
          GenEMBL AAFN01000070.1 
          45% to CYP56A1

CYP56E2   Candida albicans SC5314
          GenEMBL AACQ01000054.1
          45% to CYP56A1 missing N-term runs off the end of the contig
          whole seq on orf19_554

CYP56E3   Candida dublinensis
          96% CYP56E2 Candida albicans (ortholog)
          see Fungal pages for seq

CYP56E4   Candida parapsilosis
          65% to CYP56E1 Candida tropicalis
          see Fungal pages for seq

CYP56E5   Lodderomyces elongisporus
          runs of EE probably in an intron seq
          59% to CYP56E2 Candida albicans
          see Fungal pages for seq

CYP56E6   Pichia stipitis
          JGI model e_gwh1.2.1.1913.1
          57% to CYP56E4 Candida parapsilosis
          see Fungal pages for seq

CYP56F1   Metarhizium anisopliae var. acridum Ma102
CYP56F1   Metarhizium anisopliae var. anisopliae Ma23

57A Subfamily

CYP57A1v1   Nectria haematococca MP VI (Fusarium solani group)
            GenEMBL L20976  (3276bp) S70757 (1373bp) PIR S45583 (515 amino 
            Maloney,A.P. and VanEtten,H.D.
            A gene from the fungal plant pathogen Nectria haematococca that       
            encodes the phytoalexin-detoxifying enzyme pisatin demethylase       
            defines a new cytochrome P450 family.
            Mol. Gen. Genet. 243, 506-514 (1994)
            PDAT9 pisatin demethylase

CYP57A1v2   Nectria haematococca (Fusarium solani group)
            no accession number
            Kevin McCkluskey and Hans Vanetten, Univ. Arizona
            personal communication
            pda4 pisatin demethylase
            Note 98% identical to CYP57A1v1, probable allele

CYP57A2     Nectria haematococca (Fusarium solani group)
            GenEMBL X73145 (2750)
            Reimmann,C. and VanEtten,H.D.
            Cloning and characterization of PDA6-1 a fungal gene encoding a 
            cytochrome P-450 which can detoxify the phytoalexin pisatin from 
            Gene 146, 221-226 (1994)
            high similarity to CYP57A1

CYP57A3   Nectria haematococca (Fusarium solani group)
          61% to CYP57A1 
          see Fungal pages for seq

CYP57A4   Nectria haematococca (Fusarium solani group)
          63% to fgenesh1_pg.scaffold_15000311, 57% to 57A1 
          This gene model seems correct DRN 2/5/06
          see Fungal pages for seq

CYP57B1   Nectria haematococca (Fusarium solani group)
          43% to CYP57A3 
          in  CYP57 family, model short at N-TERM
          see Fungal pages for seq

CYP57B2   Nectria haematococca (Fusarium solani group)
          83% to CYP57B1 
          see Fungal pages for seq

CYP57B3   Aspergillus oryzae
          GenEMBL BAE55311.1
          56% to 57B2, 55% to 57B1

CYP57B3   Aspergillus flavus
          AFL2G_00227 revised
          100% to CYP57B3 Aspergillus oryzae
          see Fungal pages for seq

CYP57B4   Fusarium oxysporum
          81% to CYP57B2
          see Fungal pages for seq

CYP57C1   Mycosphaerella fijiensis
          fgenesh1_pg.C_scaffold_2000556 revised N-term
          51% to CYP57B3 Aspergillus oryzae
          see Fungal pages for seq

58A Subfamily

CYP58A1   Fusarium sporotrichioides (filamentous fungus)
          GeEMBL U22462 PIR S57337 (520 amino acids)
          Hohn.T.M., Desjardins,A.E. and McCormick,S.P.
          The Tri4 gene of Fusarium sporotrichioides encodes a cytochrome P450
          monooxygenase involved in tricothecene biosynthesis.
          Mol. Gen. Genet. 248, 95-102 (1995)
          Note: also called TOX4

CYP58A2   Myrothecium roridum, complete cds.
          GenEMBL AF009417 (4058bp)
          Trapp,S.C., Hohn,T.M., McCormick,S. and Jarvis,B.B.
          Characterization of the gene cluster for biosynthesis of
          macrocyclic trichothecenes in Myrothecium roridum
          Mol. Gen. Genet. 257 (4), 421-432 (1998)
          (TRI4) gene

CYP58A3   Fusarium graminearum

CYP58B1   Aspergillus parasiticus
          No accession number
          Ken Ehrlich
          Submitted to nomenclature committee 12/30/2003
          40% to 58A1, 37% to 58A2 on the border of the CYP58 family
          gene name CypA in aflatoxin biosynthesis

CYP58B1   Aspergillus parasiticus aflatoxin pathway gene cluster
          GenEMBL AY371490

CYP58B2P  Aspergillus flavus NRRL3357 pseudogene
          GenEMBL AAIH01000612.1, AFL2G_07229 
          missing first 29 aa, two frameshifts and one stop codon, 
          bad boundary at 1273

CYP58B2P   Aspergillus oryzae
           Supercontig 10: 19609-20001 +
           95% to CYP58B2P Aspergillus flavus
           even pseudogenes are well conserved
           see Fungal pages for seq

CYP58B3    Aspergillus nomius isolate AN13137
           92% to CYP58B1 Aspergillus parasiticus
           gene CypA of aflatoxin biosynthesis
           gene model revised

CYP58C1   Aspergillus nidulans
          see Fungal pages for seq

CYP58D1   Aspergillus nidulans
          AACD01000172.1 Aspergillus nidulans FGSC A4 revised
          see Fungal pages for seq

CYP58D2   Aspergillus oryzae RIB40
          GenEMBL BAE58658.1
          AP007157.1b (second P450 of 8 on this accession)
          73% to CYP58D1

CYP58D2   Aspergillus flavus
          99% to CYP58D2 Aspergillus oryzae
          see Fungal pages for seq

CYP58D3  Aspergillus fumigatus Af293
         GenEMBL XP_753152.1 also AAHF01000003.1
         trichodiene oxygenase predicted
         71% to 58D1
         N-term part of broken gene

CYP58D3  Aspergillus fumigatus Af293
         GenEMBL XP_753171.1 also AAHF01000003.1
         73% to 58D1 
         C-term part of broken gene

CYP58E1   Nectria haematococca (Fusarium solani group)
          48% to CYP58A3, 46% to CYP58A2
          46% to 58A2 also 48% to 579A2, check 579A2 vs 58A2 = 65%
          Note 58A2 and 579A2 are same family and same subfamily,
          already revised names 579A2 = 58A3, not yet changed on blast server
          This gene model seems correct DRN 2/5/06
          Note this gene is near scaffold_14000017
          see Fungal pages for seq

CYP58E2  Aspergillus oryzae
         GenEMBL BAE59845.1
         61% TO 58E1, 47% TO 58A2, 41% to 58C1, 46% TO 58A3

CYP58E2  Aspergillus flavus
         AFL2G_06877 revised
         100% to CYP58E2  Aspergillus oryzae
         see Fungal pages for seq

CYP58E3  Neosartorya fischeri
         53% to CYP58E1
         see Fungal pages for seq

CYP58E3  Aspergillus flavus NRRL3357
         Identical to CYP58E3 Neosartorya fischeri 
         (partial seq, upstream part in a seq gap)
         see Fungal pages for seq

CYP58E3  Aspergillus terreus NIH2624
         AAJN01000124.1, ATEG_04417.1
         93% to CYP58E3 = ortholog
         see Fungal pages for seq

CYP58F1  Aspergillus oryzae
         GenEMBL BAE64028.1
         46% TO 58E2, 40% to 58C1, 45% to 58D1, 44% to 58B1
         46% to 58A3

CYP58F1   Aspergillus flavus
          99% to CYP58F1  Aspergillus oryzae
          see Fungal pages for seq

CYP58F2   Aspergillus niger
          60% to CYP58F1
          see Fungal pages for seq

CYP58F3   Aspergillus terreus
          68% to CYP58F1
          see Fungal pages for seq

CYP58G1  Aspergillus oryzae
         GenEMBL BAE64022.1
         40% to 58C1, 41% to 58D1, 39% to 58B1, 35% to 58A3
         39% to 52E2, 41% to 58F1
         revised 3/18/2009

CYP58G1  Aspergillus flavus
         99% to CYP58G1 Aspergillus oryzae
         see Fungal pages for seq

CYP58H1  Aspergillus oryzae
         GenEMBL BAE56719.1
         43% to 58B1, 44% to 58C1, 42% to 58D1, 38% to 58A3
         42% to 58G1, 40% to 58E2, 42% to 58F1

CYP58H1  Aspergillus flavus
         98% to CYP58H1 Aspergillus oryzae
         see Fungal pages for seq

CYP58J1  Aspergillus oryzae
         GenEMBL BAE62179.1
         41% to 58C1 46% to 58C1, 44% to 58D1, 41% to 58B1,
         40% to 58A3, 43% to 58E2, 42% to 58F1, 41% to 58G1,
         41% to 58H1 

CYP58J1   Aspergillus flavus
          98% to CYP58J1 Aspergillus oryzae
          see Fungal pages for seq

CYP58K1  Aspergillus oryzae
         GenEMBL BAE63021.1
         41% to 58J1, 38% to 58A1, 40% to 58D2, 39% to 58C1,
         38% to 58B1, 42% to 58J1, 37% to 58H1, 37% to 58G1,
         39% to 58F1, 39% to 58E2

CYP58L1   Aspergillus niger
          49% to CYP58D1, 49% to e_gw1.8.187.1
          see Fungal pages for seq

CYP58M1   Aspergillus niger
          51% to CYP58K1
          see Fungal pages for seq

CYP58M2   Neosartorya fischeri
          55% to CYP58M1
          Note: this seq has no ortholog in A. fumigatus
          see Fungal pages for seq

CYP58M3   Aspergillus terreus
          55% to CYP58M1
          see Fungal pages for seq

CYP58M4   Aspergillus terreus
          57% to CYP58M1
          see Fungal pages for seq

CYP58N1   Aspergillus niger
          42% to CYP58C1, 39% to e_gw1.8.187.1
          see Fungal pages for seq

CYP58P1   Aspergillus clavatus
          49% to CYP58H1
          see Fungal pages for seq

CYP58Q1   Aspergillus terreus
          49% to CYP58M1, 48% to CYP58P1
          see Fungal pages for seq

CYP58R1   Metarhizium anisopliae var. acridum Ma102
CYP58R1   Metarhizium anisopliae var. anisopliae Ma23
CYP58S1   Metarhizium anisopliae var. anisopliae Ma23
CYP58T1   Metarhizium anisopliae var. acridum Ma102
CYP58T1   Metarhizium anisopliae var. anisopliae Ma23
CYP58T2   Metarhizium anisopliae var. anisopliae Ma23

CYP58-un1 Aspergillus niger
          43% to CYP58J1 pseudogene fragment C-term, 52% to CYP58M1

59A Subfamily

CYP59A1     Emericella nidulans
            GenEMBL L27825 (4310bp)
            Keller,N.P., Kantz,N.J. and Adams,T.H.
            Aspergillus nidulans verA is reqired for production of the mycotoxin
            Appl. Environ. Microbiol. 60, 1444-1450 (1994)
            gene stcS
            note: C-terminal missing

            Aspergillus nidulans (same as Emericella nidulans, Emericella is the
            teleomorph sexual phase of the fungal life cycle.
            GenEMBL U34740 (505 amino acids)
            Brown, D.W., Keller, N.P. and Adams, T.H.
            complete sequence of CYP59
            Proc. Natl. Acad. Sci. USA 93, 1418-1422 (1996)

CYP59A1     Aspergillus nidulans 
            stcS L27825 revised 7/20/07

CYP59A3     Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            function="conversion of versicolorin A to
            70% to CYP59A1

CYP59A4  Aspergillus oryzae
         GenEMBL BAE59520.1 also BAE71324.1
         72% to 59A1 

CYP59A5  Aspergillus oryzae
         GenEMBL BAE48804.1
         92% to 59A4, 71% to 59A1 

CYP59A5  Aspergillus flavus
         96% to CYP59A5  Aspergillus oryzae
         see Fungal pages for seq

CYP59A6  Aspergillus nomius isolate AN13137
         94% to CYP59A5 Aspergillus flavus
         gene VerA of aflatoxin biosynthesis

CYP59A7  Aspergillus ochraceoroseus strain SRRC 1432
         gene StcS/AflN in aflatoxin/sterigmatocystin biosynthesis
         76% to CYP59A5 Aspergillus flavus

CYP59B1X  Fusarium graminearum (Gibberella zeae PH-1)
          GenEMBL AACM01000117.1 
          52362-54017 (+) strand, one intron
          renamed CYP5071A1

CYP59C1  Aspergillus nidulans 
         44% to 59A1 586clan?
         Revised 7/18/07

CYP59C2   Aspergillus niger
          63% to CYP59C1
          see Fungal pages for seq

CYP59D1  Aspergillus oryzae
         GenEMBL BAE66084.1
         55% TO 59D2, 41% to 59A1, 41% to 59C1

CYP59D1  Aspergillus flavus
         99% to CYP59D1  Aspergillus oryzae
         see Fungal pages for seq

CYP59D2  Aspergillus oryzae
         GenEMBL BAE58153.1, AP007155.1
         37% to 59A1, 37% to 59C1

CYP59D2  Aspergillus flavus
         99% to CYP59D2  Aspergillus oryzae
         see Fungal pages for seq

CYP59D3  Aspergillus niger
         63% to CYP59D2
         see Fungal pages for seq

CYP59E1  Mycosphaerella graminicola
         39% to 59C1, 9/10 top hits are CYP59, but only 34% to 59D3
         N-term is short
         see Fungal pages for seq

CYP59E2  Mycosphaerella fijiensis
         61% to CYP59E1 Mycosphaerella graminicola
         see Fungal pages for seq

60A Subfamily

CYP60A1     Aspergillus parasiticus
            GenEMBL L40839 (1266bp) L41149 (1284bp)
            Yu,J., Chang,P.-k., Cary,J.W., Wright,M., Bhatnagar,D., 
            Payne,G.A. and Linz,J.E.
            Comparative mapping of aflatoxin pathway gene clusters in 
            parasiticus and aspergillus flavus.
            Applied Environ. Microbiol. 61, 2365-2371 (1995)
            gene ord1
            missing N-terminal (approximately 93 amino acids missing)

CYP60A2     Aspergillus nidulans
            GenEMBL U34740 (507 amino acids)
            Brown, D.W., Keller, N.P. and Adam, T.H.
            Proc. Natl. Acad. Sci. USA 93, 1418-1422 (1996)
            gene stcF

CYP60A2     Aspergillus nidulans 
            U34740 AN7818.1 
            53 clan, note the CYP60 family falls inside the 
            much larger CYP65 family that has grown
            stcF revised 7/19/07

CYP60A3     Aspergillus parasiticus
            GenEMBL U62774
            Yu,J., Chang,P.K., Cary,J.W., Bhatnagar,D. and Cleveland,T.E.
            avnA, a gene encoding a cytochrome P-450 monooxygenase, is involved
            in the conversion of averantin to averufin in aflatoxin
            biosynthesis in Aspergillus parasiticus.
            Appl. Environ. Microbiol. 63, 1349-1356 (1997)

CYP60A3     Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            function="conversion of averantin to 5'-hydroxyaverantin
            70% to CYP60A2
            note CYP60A1 and CYP60A3 are essentially the same sequence
            the CYP60A1 sequence is incomplete and has 4 amino acid differences.

CYP60A4v1X  Aspergillus flavus strain SRRC 141
            GenEMBL AF106960
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene 85% identical to 60B2
            note: error in name assignment, this gene is CYP60B4v1 

CYP60A4v2X  Aspergillus flavus strain SRRC 1007
            GenEMBL AF106959
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene
            99% identical to 60A4v1
            note: error in name assignment, this gene is CYP60B4v2 

CYP60A4v3X  Aspergillus parasiticus strain RH1
            GenEMBL AF106958
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene
            97% identical to 60A4v1
            note: error in name assignment, this gene is CYP60B4v3 

CYP60A4v3X  Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            function="conversion of versicolorin B to versicolorin A"
            note: error in name assignment, this gene is CYP60B4v3 

CYP60A5  Aspergillus oryzae
         GenEMBL BAE71325.1, BAC45242.1, BAE59521.1
         95% to CYP60A3

CYP60A5  Aspergillus flavus
         AFL2G_07217 revised
         98% to CYP60A5  Aspergillus oryzae
         Bottom HALF (two adjacent P450s in this gene model CYP60B3 and CYP60A5)
         see Fungal pages for seq

CYP60A6 Aspergillus nomius isolate AN13137
92% to CYP60A3
gene AvnA of aflatoxin biosynthesis

CYP60A7 Aspergillus ochraceoroseus strain SRRC 1432
gene AflG in aflatoxin/sterigmatocystin biosynthesis
79% to CYP60A3 Aspergillus parasiticus avnA
gene model revised at one intron boundary

60B Subfamily

CYP60B1     Aspergillus nidulans
            GenEMBL U34740 (501 amino acids) AN7813.2, revised 7/18/07
            Brown, D.W., Keller, N.P. and Adam, T.H.
            Proc. Natl. Acad. Sci. USA 93, 1418-1422 (1996)
            gene stcL

CYP60B2     Aspergillus ochraceoroseus strain SRRC 1432
            GenEMBL AY092402.3
            Cary,J.W., Beltz,S.B., Bennett,C.A. and Klich,M.A.
            Molecular Characterization of the Aflatoxin Biosynthetic Cluster
            from Aspergillus ochraceoroseus.
            function="desaturation of aflatoxin precursor VER B to VER A
            84% to CYP60B1 Aspergillus nidulans StcL
            probable ortholog of CYP60B1
            gene AflL/StcL

CYP60B3  Aspergillus oryzae
         GenEMBL BAE71326.1, BAC45243.1, BAE59522.1
         81% TO 60B1 
         probable ortholog of CYP60B1

CYP60B3v1  Aspergillus flavus
           AFL2G_07217 revised
           97% to CYP60B3  Aspergillus oryzae
           TOP HALF (two P450s in this gene model CYP60B3 and CYP60A5
           see Fungal pages for seq

CYP60B3v2   Aspergillus flavus strain SRRC 141
            GenEMBL AF106960
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene 85% identical to 60B2
            97% to 60B3v1 ortholog
            99% to CYP60B3v3  Aspergillus flavus strain SRRC 1007
            formerly CYP60B4v1

CYP60B3v3   Aspergillus flavus strain SRRC 1007
            GenEMBL AF106959
            formerly CYP60B4v2

CYP60B3     Aspergillus parasiticus strain RH1
            GenEMBL AF106958
            formerly CYP60B4v3

CYP60B3     Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            formerly CYP60B4v3

CYP60B3     Aspergillus nomius
            gene VerB of aflatoxin biosynthesis
            94% to CYP60B3 Aspergillus flavus

CYP60B4v1X   Aspergillus flavus strain SRRC 141
            GenEMBL AF106960
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene 85% identical to 60B2
            note: error in name assignment, this gene was erroneously called
            probable ortholog of CYP60B1
            note: Asp. oryzae and Asp. flavus are very closely related species
            This seq is 97% identical to CYP60B3
            Their P450 genes are nearly identical
            So this is the ortholog/ same gene as 60B3v2

CYP60B4v2X   Aspergillus flavus strain SRRC 1007
            GenEMBL AF106959
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene
            99% identical to 60B4v1
            note: error in name assignment, this gene was erroneously called
            probable ortholog of CYP60B1
            renamed CYP60B3v3

CYP60B4v3X   Aspergillus parasiticus strain RH1
            GenEMBL AF106958
            Bhatnagar,D., Cary,J.W., Ehrlich,K.C., Cleveland,T.E. and
            Molecular characterization of an aflatoxin B2 producing mutant
            strain of Aspergillus flavus
            verB gene
            97% identical to 60B4v1
            note: error in name assignment, this gene was erroneously called
            probable ortholog of CYP60B1
            renamed CYP60B3

CYP60B4v3X   Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            function="conversion of versicolorin B to versicolorin A"
            note: error in name assignment, this gene was erroneously called
            probable ortholog of CYP60B1
            renamed CYP60B3

61A Subfamily

Note: all fungi have CYP61 a C-22 sterol desaturase in the ergosterol 
biosynthesis pathway.  These will just be called CYP61 without subfamilies
assigned.  A few older names were 61A1-61A5.  The sequential numbers may not
be needed, except in rare cases where there are more than one CYP61 in a single 

CYP61A1     Saccharomyces cerevisiae (yeast)
            GenEMBL Z49211 (30,011bp) PIR S54015
            Lye,G. and Churcher,C.M.
            Unpublished 1995
            Barrell,B., Rajandream,M.A. and Walsh,S.V.
            S.cerevisiae chromosome XIII cosmid 9711 complement of 3155-4771.

CYP61A1     Saccharomyces paradoxus
            98% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Saccharomyces mikatae
            97% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Saccharomyces castellii
            83% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Saccharomyces bayanus
            93% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Saccharomyces kluyveri
            79% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Kluyveromyces waltii
            82% to CYP61A1 S. cerevisiae C-term part only
            See the fungal pages for seq

CYP61A1     Yarrowia lipolytica
            GenPept CAG84120.1
            64% to CYP61A1 Saccharomyces paradoxus
            See the fungal pages for seq

CYP61A1     Ashbya gossypii ATCC 10895
            75% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Pichia stipitis
            JGI model estExt_genewise1_human.C_chr_6.10410
            82% to CYP61A1 Debaryomyces hansenii
            See the fungal pages for seq

CYP61A1     Debaryomyces hansenii
            80% to CYP61A1 Candida lusitaniae
            See the fungal pages for seq

CYP61A1     Lodderomyces elongisporus
            84% to CYP61A2 C.albicans

CYP61A2/61A1     C.albicans
            GenEMBL AL033396 comp(39932..41485) 
            gene="Ca35A5.10c" 68.9% identical to 61A1
            note: most fungi have onlt one CYP61 gene
            so this is probably the ortholog of CYP61A1
            but for historical reasons it was named CYP61A2

CYP61A1     Candida guilliermondii
            79% to CYP61A1 Candida dublinensis
            See the fungal pages for seq

CYP61A1     Candida parapsilosis
            79% to CYP61A2 C.albicans
            See the fungal pages for seq

CYP61A1     Candida lusitaniae
            78% to CYP61A2 C.albicans
            See the fungal pages for seq

CYP61A1     Candida dublinensis
            96% to CYP61A2 C.albicans
            See the fungal pages for seq

CYP61A1     Candida glabrata CBS138
            GenPept CAG62657.1
            81% to CYP61A1 S. cerevisiae 
            See the fungal pages for seq

CYP61A1     Candida bombicola, alternative name Starmerella bombicola
            No accession number
            Inge Van Bogaert
            Submitted to nomenclature committee Jan. 17, 2012
            63% to CYP61A1 Saccharomyces kluyveri

CYP61A1     Kluyveromyces polysporus
            86% to CYP61A1 S. cerevisiae
            See the fungal pages for seq

CYP61A1     Kluyveromyces lactis
            80% to CYP61A1 Saccharomyces kluyveri
            See the fungal pages for seq

CYP61A1     Uncinocarpus reesii
            75% to CYP61A1 Aspergillus fumigatus
            See the fungal pages for seq

CYP61A1     Histoplasma capsulatum G217B
            77% to CYP61A1 Uncinocarpus reesii
            ABBT01000205.1 Ajellomyces capsulatus G217B 1837477-1839379 (+)
            ABBT01000210.1 Ajellomyces capsulatus G217B 225529- 227431 (+)
            Two identical sequences. Note 51F2 also has two identical sequences
            One of them is also on ABBT01000205.1 and 
            the other is on ABBT01000207.1
            See the fungal pages for seq

CYP61A1     Coccidioides immitis
            90% to CYP61A1 Uncinocarpus reesii
            See the fungal pages for seq

CYP61A1     Fusarium graminearum
            FG01959.1 AACM01000104 FGcontig1.104_scaffold1
            See the fungal pages for seq

CYP61A1     Nectria haematococca (Fusarium solani group)
            88% to CYP61A1 Fusarium graminearum
            See the fungal pages for seq

CYP61A1     Magnaporthe grisea
            See the fungal pages for seq

CYP61A1     Ustilago maydis
            GenEMBL XM_397965.1 
            in the 61 clan 49% to CYP61 N.crassa
            See the fungal pages for seq

CYP61A1     Sporobolomyces roseus
            JGI gene model estExt_fgenesh1_pm.C_40050
            57% to CYP61A1 Ustilago maydis, 
            See the fungal pages for seq

CYP61A1     Malassezia globosa
            74% to CYP61A1   Ustilago maydis
            See the fungal pages for seq

CYP61A1     Aspergillus nidulans 
            66% to 61A1 51 clan revised 7/19/07

CYP61A1     Aspergillus oryzae
            GenEMBL AP007155.1, BAE58068.1

CYP61A1   Aspergillus flavus
          100% to CYP61A1 Aspergillus oryzae

CYP61A1  Aspergillus fumigatus Af293
         GenEMBL XP_750145.1 
         cytochrome P450 sterol C-22 desaturase
         81% to 61A1 Aspergillus oryzae

CYP61A1  Neosartorya fischeri
         99% to CYP61A1 Aspergillus fumigatus = ortholog
         See the fungal pages for seq

CYP61A1  Gibberella moniliformis 7600 
         99% to 61A1 F. oxysporum
         also called Fusarium verticillioides FVEG_07284
        GSMLI  351948

CYP61A1  Fusarium oxysporum
         99% to 61A1 Gibberella moniliformis
         See the fungal pages for seq

CYP61A1  Aspergillus clavatus NRRL
         87% TO ASPERGILLUS FUMIGATUS CYP61A1, 52% TO CYP61A6 A. clavatus
        FVVIASTR  468135

CYP61A1  Aspergillus niger
         JGI gene model estExt_GeneWisePlus.C_12230|Aspni1
         84% to CYP61A1
         See the fungal pages for seq

CYP61A1 Aspergillus terreus
        87% TO CYP61A1 Aspergillus niger
        70% to CYP61A1 Aspergillus terreus
        55% to CYP61A6 Aspergillus terreus

CYP61A1   Metarhizium anisopliae var. acridum Ma102
CYP61A1   Metarhizium anisopliae var. anisopliae Ma23

CYP61A1  Mycosphaerella graminicola
         67% to CYP61A1 A. oryzae
         See the fungal pages for seq

CYP61A1  Mycosphaerella fijiensis
         JGI gene model estExt_Genewise1.C_20563
         80% to CYP61A1 Mycosphaerella graminicola
         See the fungal pages for seq

CYP61A1  Chaetomium globosum CBS 148.51 
         NZ_AAFU01000895.1 AAFU01000895.1
         84% TO N. CRASSA 61A1
      GSMVIPT  8109

CYP61A1   Phanerochaete chrysosporium (white rot fungus)
          Scaffold_75 JGI gene model ug.78.18.1
          62% to CYP61A1 Usilago maydis
          the sequence GYVLQYCLVLYAMLTHRR seems to be an
          insertion and it may need to be removed

CYP61A1v1 Postia placenta (brown rot basidiomycete fungi)
CYP61A1v2 Postia placenta (brown rot basidiomycete fungi)

CYP61A1   confidential basidiomycete

CYP61A1   Cryptococcus neoformans var. neoformans B-3501A chromosome 6
          ESTs gb|CF191501.1|CF191501,gb|CF188802.1|
          CF188802, gb|CF194425.1|CF194425
          61% to CYP61A1 Ustilago maydis
          See the fungal pages for seq

CYP61A1   Cryptococcus gattii
          CNBG_1921 Transcript 1. Broad Institute
          98% to CYP61A1_Cryptococcus_neoformans var. neoformans B-3501A

CYP61A1   Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          65% to P450-8 = CYP61 C-22 sterol desaturase
          53% to CYP61A3 S. pombe
          See the fungal pages for seq

CYP61A1  Grosmannia clavigera

CYP61A3/61A1  S. pombe
            GenEMBL Z98974 join(10345..10419,10514..12001)
            gene="SPAC19A8.04" 51% identical to CYP61A1
            note: most fungi have onlt one CYP61 gene
            so this is probably the ortholog of CYP61A1
            but for historical reasons it was named CYP61A3

CYP61A1     Schizosaccharomyces japonicus
            80% to S. pombe CYP61A3 (misnamed, should be CYP61A1)
            See the fungal pages for seq

CYP61A1     Schizosachharomyces octosporus
            See the fungal pages for seq

CYP61A4/61A1  Botrytis cinerea (a plant-pathogenic fungus infecting over 200 
            plant species)
            GenEMBL AL111744 AL111746
            Bitton,F., Levis,C., Fortini,D., Pradier,J.M. and Brygoo,Y.
            58% to S. pombe 61A3
            note: most fungi have onlt one CYP61 gene
            so this is probably the ortholog of CYP61A1
            but for historical reasons it was named CYP61A4

CYP61A5/61A1  Neurospora crassa
            No accession number
            Neurospora crassa sequence contig 1.384  (supercontig 48)
            note: most fungi have onlt one CYP61 gene
            so this is probably the ortholog of CYP61A1
            but for historical reasons it was named CYP61A5

CYP61A1   Neurospora discreta
          JGI gene model estExt_fgenesh3_kg.C_120065
          98% to CYP61A5 N. crassa ortholog of CYP61A1
          See the fungal pages for seq

CYP61A6   Fusarium graminearum
          A second CYP61 gene in Fusarium graminearum

CYP61A6   Nectria haematococca (Fusarium solani group)
          79% to CYP61A6 Fusarium graminearum (ortholog)
          only 56% to 61A1 F. graminearum
          55% to CYP61A1 Nectria
          See the fungal pages for seq

CYP61A6   Aspergillus oryzae
          GenEMBL AP007155.1, BAE57461.1
          73% to CYP61A6 Nectria haematococca

CYP61A6  Aspergillus flavus NRRL3357
         Only 1 aa diff to 61A6 of Asp. Oryzae, 
         73% to CYP61A6 Nectria haematococca
4843  PM (0) 4838

CYP61A6   Gibberella moniliformis
          GenEMBL AAIM01002518.1 
          81% to CYP61A6 Nectria haematococca
          also called Fusarium verticillioides FVEG_08786
28084  DECQLVFTKRE*  28049

CYP61A6   Trichoderma reesei
          GenEMBL AAIL01000244.1 
          75% to CYP61A6 Nectria haematococca
      DECPLVFTRRE*  8517

CYP61A6   Aspergillus terreus NIH2624
          GenEMBL AAJN01000026.1 
          76% to CYP61A6 Nectria haematococca
       DGCQLVFRKRS*  46499

CYP61A6   Chaetomium globosum CBS
          GenEMBL AAFU01000675.1 148.51 
          74% to CYP61A6 Nectria haematococca
      DGAQLVFEKRP*  2579

CYP61A6   Aspergillus clavatus NRRL
          GenEMBL AAKD02000011.1 
          77% to CYP61A6 Nectria haematococca
667823  ATLFPM (0)
        DGCQLVFSKRV*  667698

CYP61A6    Fusarium oxysporum
           96% to CYP61A6 Gibberella moniliformis
           See the fungal pages for seq

CYP61A7    Aspergillus niger
           JGI gene model estExt_fgenesh1_pm.C_40133|Aspni1
           74% to CYP61A5
           See the fungal pages for seq

CYP61A8    Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
           93% to P450-10_var1
           53% to CYP61A3 S. pombe in CYP61 family
           See the fungal pages for seq

CYP61A9    Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
           50% to CYP61A3 S. pombe = CYP61 C-22 sterol desaturase
           See the fungal pages for seq

CYP61A10   Aspergillus terreus NIH2624
           NW_001471411.1 AAJN01000002.1
           72% TO 61A1 A. ORYZAE, 55% TO A. TERREUS 61A6
           70% TO CYP61A1 Aspergillus niger
           70% to CYP61A1 Aspergillus terreus
           55% to CYP61A6 Aspergillus terreus
           formerly CYP61A1, but a better match was found in A. terreus to CYP61A1

62A Subfamily

CYP62A1     Aspergillus nidulans
            GenEMBL U34740  L39121 (9392bp)
            Brown,D.W., Yu,J.H., Kelkar,H.S., Fernandes,M., Nesbitt,T.C.,
            Keller,N.P., Adams,T.H. and Leonard,T.J.
            Twenty-five coregulated transcripts define a sterigmatocystin gene
            cluster in Aspergillus nidulans
            Proc. Natl. Acad. Sci. U.S.A. 93, 1418-1422 (1996)
            gene stcB

CYP62A1     Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            69% to CYP62A1 of Aspergillus nidulans (ortholog)
            note the earlier 62A1 sequence is missing some internal amino acids

CYP62A1  Aspergillus oryzae
         GenEMBL BAE71332.1, BAE59529.1, BAC20333.1
         66% to CYP62A1 Aspergillus nidulans, ortholog

CYP62A1   Aspergillus flavus
          99% to CYP62A1  Aspergillus oryzae
          See fungal pages for sequence

CYP62A1   Aspergillus nomius
          gene CypX of aflatoxin biosynthesis
          92% to CYP62A1 Aspergillus flavus

CYP62A1   Aspergillus ochraceoroseus strain SRRC 1432
          gene StcB/AflV in aflatoxin/sterigmatocystin biosynthesis
          80% to CYP62A1 Aspergillus nidulans
          N-terminal exon modified to be more like Podospora anserina EST CU876063

CYP62B1   Fusarium graminearum
          FG05806.1 AACM01000233 FGcontig1.233_scaffold3
          See fungal pages for sequence

CYP62B2   Nectria haematococca (Fusarium solani group)
          66% to CYP62B1 Fusarium graminearum (probable ortholog)
          See fungal pages for sequence

CYP62B3   Fusarium oxysporum
          76% to CYP62B1   Fusarium graminearum
          See fungal pages for sequence

CYP62B3   Fusarium verticillioides
          90% to CYP62B3 Fusarium oxysporum = ortholog
          See fungal pages for sequence

CYP62B    Fusarium sporotrichioides 
          fragment BI188839 EST 88% to 62B1

CYP62C1   Aspergillus nidulans
          AN6414.1 49% to 62B1 53 clan
          See fungal pages for sequence

CYP62C2  Aspergillus flavus NRRL3357
         GenEMBL AAIH01000225.1
         63% TO 62C1
         1 AA diff to Aspergillus oryzae CYP62C2

CYP62C2  Aspergillus oryzae
         GenEMBL BAE55279.1, AP007151.1
475900 MEWQIYLGIAFALWIVQ (0) 475950

CYP62C3  Aspergillus niger
         JGI gene model estExt_fgenesh1_pg.C_150110|Aspni1
         67% to CYP62C2
         See fungal pages for sequence

CYP62D1  Nectria haematococca (Fusarium solani group)
         43% to 62B1, 43% to 62C1, 37% to 62A1
         See fungal pages for sequence

CYP62E1  Phaeosphaeria nodorum SN15
         GENEMBL AAGI01000353.1 
         46% TO 62C1, 46% TO 62B1, 42% TO 62D1, 39% TO 62A1

CYP62F1  Mycosphaerella fijiensis
         JGI gene model e_gw1.7.207.1 revised at N-term
         40% to CYP62B2 Nectria haematococca
         41% to CYP62B1 Fusarium graminearum
         See fungal pages for sequence

63A Subfamily

CYP63A1     Phanerochaete chrysosporium (white rot fungus)
            GenEMBL AF005475 (208 amino acids)
            Kullman,S.W. and Matsumura,F.
            Identification of a novel cytochrome P-450 gene from the white rot
            fungus Phanerochaete chrysosporium
            Appl. Environ. Microbiol. 63, 2741-2746 (1997)

CYP63A1     Phanerochaete chrysosporium (white rot fungus)
            No accession number 
            Jagjit Yadav
            Submitted to nomenclature committee Dec. 15, 2000
            Clone name Pc-1
            Aside from intron editing, this sequence and AF005475 have only 
            10 aa differences clustered in one region and are probably 
            the same gene
            JGI gene model ug.20.36.1

CYP63A2     Phanerochaete chrysosporium (white rot fungus)
            No accession number 
            Jagjit Yadav
            Submitted to nomenclature committee Dec. 15, 2000
            Clone name Pc-2 JGI gene model ug.20.35.1
            85% to 63A3, 59% identical to 63A1 

CYP63A3     Phanerochaete chrysosporium (white rot fungus)
            JGI geme model ug.20.34.1
25697 AILATDFTSFVK (1) 25662
      GDMWK (2)
      ETLRLYPAV (2) 24515
      PWNVR (2)

CYP63A4     Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.151.16.1

CYP63A5   Postia placenta (brown rot basidiomycete fungi)
CYP63A6v1 Postia placenta (brown rot basidiomycete fungi)
CYP63A6v2 Postia placenta (brown rot basidiomycete fungi)
CYP63A7   Postia placenta (brown rot basidiomycete fungi)

CYP63A8   confidential basidiomycete
CYP63A9   confidential basidiomycete
CYP63A10  confidential basidiomycete
CYP63A11P confidential basidiomycete
CYP63A12  confidential basidiomycete
CYP63A13  confidential basidiomycete
CYP63A14  confidential basidiomycete
CYP63A15P confidential basidiomycete

CYP63B1     Phanerochaete chrysosporium (white rot fungus)
            JGI geme models genscan.57.18.1 and genewise.57.16.1

CYP63B2   Postia placenta (brown rot basidiomycete fungi)

CYP63C1     Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.101.32.1

CYP63C2     Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.101.28.1
            PC-6, partial only 387 amino acids, needs more work

CYP63D1v1 Postia placenta (brown rot basidiomycete fungi)
CYP63D1v2 Postia placenta (brown rot basidiomycete fungi)

64A Subfamily

CYP64A1     Aspergillus flavus
            GenEMBL U81806(2760bp)
            Prieto,R. and Woloshuk, C.P.
            ord1, an oxidoreductase gene involved in the conversion of
            O-methylsterigmatocystin to aflatoxin in Aspergillus flavus

CYP64A1     Aspergillus parasiticus
            GenEMBL AF017151
            Yu,J., Chang,P.K., Ehrlich,K.C., Cary,J.W., Montalbano,B.,
            Dyer,J.M., Bhatnagar,D. and Cleveland,T.E.
            Characterization of the critical amino acids of an Aspergillus
            parasiticus cytochrome P-450 monooxygenase encoded by ordA that is
            involved in the biosynthesis of aflatoxins B1, G1, B2, and G2
            Appl. Environ. Microbiol. 64 (12), 4834-4841 (1998)
            97% identical to Aspergillus flavus CYP64A1 (0rtholog)

CYP64A1     Aspergillus parasiticus aflatoxin pathway gene cluster
            GenEMBL AY371490
            function="conversion of O-methylsterigmatocystin to
            aflatoxin B1 and aflatoxin G1 and
            dihydro-O-methylsterigmatocystin to aflatoxin B2 and
            aflatoxin G2"

CYP64A1  Aspergillus oryzae
         GenEMBL BAE71330.1, BAE59527.1
         99% to CYP64A1 Aspergillus flavus

CYP64A1   Aspergillus nomius
          gene OrdA of aflatoxin biosynthesis
          93% to CYP64A1 Aspergillus flavus

65A Subfamily

CYP65A1     Fusarium sporotrichioides
            GenEMBL AF011355
            Alexander, N., Hohn, T.M., and McCormick, S.P. (1998)
            The TRI11 gene of Fusarium sporotrichioides encodes a cytochrome
            P450 monooxygenase required for C-15 hydroxylation in trichothecene
            Appl.Environ.Microbiol. 64(1), In Press
            The TRI11 gene catalyzes the hydroxylation of isotrichodermin to 15-
            submitted to nomenclature committee

CYP65A2     Fusarium graminearum
            FG03540.1 AACM01000159 FGcontig1.159_scaffold2
            See fungal pages for sequence

CYP65B1     Neurospora crassa
            AABX01000364.1 cont3.489
            Neurospora crassa sequence contig 1.742  (supercontig 102)
            42% to CYP65A1

CYP65B1   Neurospora discreta
          JGI gene model scaffold_9-snap.228.1
          85% to CYP65B1 N. crassa
          gene model does not appear to be assembled 
          correctly. One low complexity sequence
          removed. mRNA may be needed to decide this assembly.
          See fungal pages for seq 

CYP65B2   Magnaporthe grisea
          MG06544.4  55% to 65B1 new N-term AACU01000188 cont2.1218
          See fungal pages for seq 

CYP65C1     Neurospora crassa
            AABX01000034.1 cont3.25
            Neurospora crassa sequence contig 1.96   (supercontig 12)
            45% to 65B1

CYP65C1   Neurospora discreta
          JGI gene model estExt_Genewise1.C_41538, 
          gene model incorrect. Added I-helix
          87% to CYP65C1 N. crassa
          see fungal pages for seq 

CYP65D1   Magnaporthe grisea
          47% to 65B1 partial seq. length 53916
          runs off end, changed C-term AACU01001030.1 cont2.747
          N-term on AACU01001031.1 cont2.748
          seems to be missing some N-terminal seq.
          see fungal pages for seq 

CYP65E1   Magnaporthe grisea
          MG03830.4  37% to 60A3 AACU01001030 cont2.747
          see fungal pages for seq 

CYP65F1   Magnaporthe grisea
          MG08498.4  42% to 65A1 AACU01001266 cont2.1600
          see fungal pages for seq 

CYP65G1   Magnaporthe grisea
          MG00023.4 39% to CYP65A1 41% to 65B1 AACU01001352 cont2.7
          see fungal pages for seq 

CYP65H1   Magnaporthe grisea
          MG10954.4  39% to 65B1 40% to 65A1 41% to MG05390.4
          AACU01001824.1 cont2.2124
          see fungal pages for seq 

CYP65J1   Magnaporthe grisea
          MG10070.4  39% to 65B1 , 40% to 60A2 AACU01001328 cont2.1928
          see fungal pages for seq 

CYP65J2   Alternaria solani
          Alt3 BAD83682 69% to 65J1 Mg
          PKS for alternapyrone is next to three P450s called alt1, 2, 3
          Chem Biol. 2005 Dec;12(12):1301-9.
CYP65K1   Magnaporthe grisea
          MG09945.4  poor match 41% to MG02982.4
          AACU01001747.1 cont2.1897
          see fungal pages for seq 

CYP65L1   Magnaporthe grisea
          MG02982.4  42% to CYP65B1 38% to 65A1 AACU01001589 cont2.600
          see fungal pages for seq 

CYP65M1   Magnaporthe grisea
          MG00651.4  37% to 65B1 AACU01001445 cont2.120
          see fungal pages for seq 

CYP65N1X  Magnaporthe grisea
          Name changed to 563B1
          see fungal pages for seq 

CYP65P1   Magnaporthe grisea
          MG07983.4  48% to 65B1 partial RUNS OFF END
          AACU01000985 cont2.1482 C-TERM HALF
          see fungal pages for seq 

CYP65Q1   Fusarium graminearum
          FG07765.1 AACM01000318 FGcontig1.318_scaffold4
          see fungal pages for seq 

CYP65R1   Fusarium graminearum
          FG03191.1 AACM01000148 FGcontig1.148_scaffold2
          see fungal pages for seq 

CYP65R2   Fusarium oxysporum
          82% to CYP65R1
          frameshift at TLQ/KMH
          see fungal pages for seq 

CYP65R2   Fusarium verticillioides
          95% to CYP65R2 Fusarium oxysporum = ortholog
          see fungal pages for seq 

CYP65S1   Fusarium graminearum= Gibberella zeae 
          GenEMBL AACM01000323 
sequence revised added back GMSRPEIIENSSLLIV to gene model

CYP65S2   Nectria haematococca (Fusarium solani group)
          JGI gene model e_gw1.7.949.1 short on N-term
          54% to CYP65S1 Fusarium graminearum
          see fungal pages for seq 

CYP65S3   Nectria haematococca (Fusarium solani group)
          JGI gene model fgenesh1_pg.scaffold_4000060
          56% to CYP65S1 Fusarium graminearum
          60% to 65S2
          see fungal pages for seq 

CYP65S4   Fusarium oxysporum
          58% to CYP65S1 Fusarium graminearum
          see fungal pages for seq 

CYP65S4   Fusarium verticillioides
          94% to CYP65S4 Fusarium oxysporum
          see fungal pages for seq 

CYP65T1   Aspergillus nidulans
          AN7522.1 38% to 65A1 53 clan
          see fungal pages for seq 

CYP65T2  Neosartorya fischeri NRRL 181
         DS027697.1  complement(627606..628748)
         57% to 65T1

CYP65T2P  Aspergillus fumigatus Af293
          XP_748490.1 also AAHF01000010.1
          58% to 65T1 Nterm aa 52-168 plus C-term part, 84% to 65T2
          name revised from 65T3P


CYP65T4  Aspergillus oryzae
         GenEMBL BAE59716.1
         68% to 65T1, 45% TO CYP65AF1

CYP65T4  Aspergillus flavus
         99% to CYP65T4 Aspergillus oryzae
         see fungal pages for seq 

CYP65T5   Aspergillus terreus NIH2624
          68% to 65T4, 62% to CYP65T1

CYP65T6   Aspergillus niger
          JGI gene model e_gw1.4.330.1|Aspni1
          65% to CYP65T4
          see fungal pages for seq 

CYP65T7   Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_3000290|Aspni1
          68% to CYP65T4
          see fungal pages for seq 

CYP65T8   Aspergillus clavatus
          69% to CYP65T2 Neosartorya fischeri
          see fungal pages for seq 

CYP65 fragment   Aspergillus ochraceus
         DQ054597 C-term piece after heme signature
         Involved in ochratoxin synthesis
         See DQ054596 for a second P450 in this pathway
         This fragment is 60% identical to CYP65T5 C-term

CYP65U1  Aspergillus nidulans 
         AN6466.2 37% to 65B1 53 clan
         revised 7/18/07

CYP65U2   Aspergillus niger
          JGI gene model e_gw1.3.403.1|Aspni1
          61% to CYP65U1
          see fungal pages for seq 

CYP65V1   Nectria haematococca (Fusarium solani group)
          JGI gene model gw1.24.106.1 model short on N-term
          49% to CYP65B1 N. crassa
          see fungal pages for seq 

CYP65V2  Aspergillus oryzae
         GenEMBL BAE61720.1, AP007163.1
         53% to 65V1, 43% to 65B1 
         revised 3/20/2009 with a frameshift = &

CYP65V2  Aspergillus flavus
         99% to CYP65V2 Aspergillus oryzae
         see fungal pages for seq 

CYP65V3P  Aspergillus oryzae
          GenEMBL BAE55600.1, AP007151.1
          Gene model has wrong C-term, revised
          about 60% to CYP65V2, 48% to 65B2, 54% to 65V1
          one stop codon and one frameshift in last exon

CYP65V3P  Aspergillus flavus
          98% to CYP65V3P
          see fungal pages for seq 

CYP65V4  Aspergillus niger
         JGI gene model e_gw1.11.216.1|Aspni1
         70% to CYP65V3P
         see fungal pages for seq 

CYP65V5  Histoplasma capsulatum
         ABBT01000064.1 Ajellomyces capsulatus G217B
         55% to CYP65V4
         see fungal pages for seq 

CYP65V6  Aspergillus terreus
         57% to CYP65V5
         see fungal pages for seq 

CYP65W1   Nectria haematococca (Fusarium solani group)
          JGI gene model e_gw1.5.258.1
          49% to CYP65B1 N. crassa
          see fungal pages for seq 

CYP65W2   Aspergillus niger
          53% to CYP65W1
          see fungal pages for seq 

CYP65W3   Metarhizium anisopliae var. acridum Ma102

CYP65X1   Aspergillus oryzae RIB40 genomic DNA, SC023
          GenEMBL AP007157.1c, BAE58707.1
          third P450 gene in a set of 8 on this accession
          42% to CYP65S2, 40% to CYP65S3, 42% to 65A1

CYP65X1   Aspergillus flavus
          99% to CYP65X1 Aspergillus oryzae, 48% to CYP65AU1
          see fungal pages for seq 

CYP65Y1  Aspergillus fumigatus Af293
         GenEMBL XP_746900.1 
         49% to CYP65V1, 88% to CYP65Y1 Neosartorya fischeri
         revised 3/12/2009 added N-term, one stop codon

CYP65Y1   Neosartorya fischeri
          88% to CYP65Y1 Aspergillus fumigatus = ortholog
          see fungal pages for seq 

CYP65Y2P fragment   Histoplasma capsulatum G217B
          C-term pseudogene of CYP65Y sequence 67% to 65Y1
          ABBT01000195.1 Ajellomyces capsulatus G217B
          see fungal pages for seq 

CYP65Z1  Aspergillus fumigatus Af293
         GenEMBL XP_751828.1
         41% to 65R1 Fg, 44% to 65S3

CYP65Z1  Neosartorya fischeri NRRL 181 XM_001267015
         94% to CYP65Z1
         name revised from CYP65Z3
         see fungal pages for seq 

CYP65Z2   Neosartorya fischeri NRRL 181
          56% to CYP65Z1 Aspergillus fumigatus Af293
          76% to CYP65Z5 Aspergillus clavatus

CYP65Z2P  Aspergillus fumigatus
          87% to CYP65Z2 Neosartorya fischeri
          supercontig 2 3641455-3643345 region
          see fungal pages for seq 

CYP65Z4   Aspergillus clavatus
          81% to CYP65Z1 Neosartorya fischeri
          see fungal pages for seq 

CYP65Z5   Aspergillus clavatus
          76% to CYP65Z2 Neosartorya fischeri
          see fungal pages for seq 

CYP65AA1  Aspergillus fumigatus Af293
          GenEMBL XP_749877.1 
          43% to 65S2, 40% to 65Z1

CYP65AA1P  Neosartorya fischeri
           C-term is missing
           92% to CYP65AA1 Aspergillus fumigatus
           downstream gene is a polyketide synthase
           both genes are broken and fused at YNSE/PVEP
           PVEP is about aa 410 in the A. terreus PKS gene XP_001215858
           The high conservation (92%) suggests an assembly error rather than a                    
           deletion creating a pseudogene. CYP65AA1 in A fumigatus is upstream of 
           a short PKS gene on AAHF01000007

CYP65AB1  Aspergillus oryzae
          GenEMBL BAE56591.1
          41% to 60A2, 39% to 60A5, 40% to 60B3
          43% to 65S1, 40% to 65A2, 41% to 65B1, 44% to 65H1 
          47% to 65S3
          Supercontig 5: 63753-65569 (+) strand
          Revised 3/18/2009

CYP65AB1  Aspergillus flavus
          Supercontig 8: 73235-75051 (+) strand
          see fungal pages for seq 

CYP65AB2  Aspergillus clavatus
          82% to CYP65AB1 Aspergillus oryzae
          see fungal pages for seq 

CYP65AC1  Aspergillus oryzae
          GenEMBL BAE59505.1 AY510452.1
          58% TO CYP65AC2, 45% to 65U1

CYP65AC2  Aspergillus oryzae
          GenEMBL BAE54634.1, AP007150.1
          40% to 60A2 (CYP60 is in the 65 family)
          revised 3/20/2009

CYP65AC2  Aspergillus flavus
          98% to CYP65AC2  Aspergillus oryzae
          see fungal pages for seq 

CYP65AC3P  Aspergillus nidulans 
           67% to CYP65AC1 AN10101.3 (partial)

CYP65AD1  Aspergillus oryzae
          GenEMBL BAE55230.1
          45% to 65V1, 43% to CYP65AF1

CYP65AD1  Aspergillus flavus
          see fungal pages for seq 

CYP65AD2  Aspergillus terreus
          60% to CYP65AD1 Aspergillus flavus
          see fungal pages for seq 

CYP65AE1  Aspergillus oryzae
          GenEMBL BAE60010.1
          40% to CYP65AF1, 39% to 65S2

CYP65AF1  Aspergillus oryzae
          GenEMBL BAE65144.1, AP007171.1
          46% to 65T1 50% to 65S2
          14 P450 genes and 2 pseudogenes on this contig

CYP65AF1  Aspergillus flavus
          98% to CYP65AF1 Aspergillus oryzae
          see fungal pages for seq 

CYP65AG1  Aspergillus oryzae
          GenEMBL BAE60004.1
          45% to CYP65AF1, 39% to 65U1, 47% to 655Z1

CYP65AG2  Aspergillus niger
          JGI gene model e_gw1.3.1457.1|Aspni1
          57% to CYP65AG1
          see fungal pages for seq 

CYP65AG3  Aspergillus terreus
          64% to CYP65AG1
          see fungal pages for seq 

CYP65AH1  Gibberella moniliformis (also Fusarium verticillioides)
          fumonisin biosynthetic gene cluster,
          47% to 65L1, 45% to CYP65R1

CYP65AJ1   Alternaria solani
           Alt1 BAD83680 48% to 65J1 Mg
           PKS for alternapyrone is next to three P450s called alt1, 2, 3
           Chem Biol. 2005 Dec;12(12):1301-9.

CYP65AK1  Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_9000016|Aspni1
          42% to CYP65R1, 34% to fgenesh1_pg.C_scaffold_5000711
          see fungal pages for seq 

CYP65AL1  Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_5000711|Aspni1
          42% to CYP65Z2, 43% to CYP65Z3
          see fungal pages for seq 

CYP65AM1  Aspergillus niger
          JGI gene model estExt_Genewise1.C_31719|Aspni1
          45% to CYP65AF1, top 28 hits are CYP65 or CYP60
          see fungal pages for seq 

CYP65AM2  Mycosphaerella graminicola
          65% to CYP65AM1 A. niger
          see fungal pages for seq 

CYP65AM3  Aspergillus clavatus
          92% t0 65AM1
          see fungal pages for seq 

CYP65AM4  Mycosphaerella fijiensis
          62% to CYP65AM2 Mycosphaerella graminicola
          JGI gene model estExt_fgenesh1_pm.C_10205
          see fungal pages for seq 

CYP65AN1  Aspergillus niger
          JGI gene model gw1.16.109.1|Aspni1
          36% to CYP65Z1 top 26 hits are to CYP65 or CYP60
          see fungal pages for seq 

CYP65AP1  Aspergillus niger
          JGI gene model gw1.10.1058.1|Aspni1
          40% to CYP65AF1, 60% to fgenesh1_pg.C_scaffold_1001144
          Top 27 hits are CYP65 or CYP60 (CYP5118 also in this set, may need name        
          change = 41% to CYP65Z2)
          see fungal pages for seq 

CYP65AP2  Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_1001144|Aspni1
          40% to CYP65Z2, 60% to gw1.10.1058.1
          see fungal pages for seq 

CYP65AP3  Histoplasma capsulatum G217B
          ABBT01000035.1 Ajellomyces capsulatus G217B
          68% TO CYP65AP1
          see fungal pages for seq 

CYP65AP4P  Aspergillus terreus
          some parts are 76% to CYP65AP1 Aspergillus niger
          see fungal pages for seq 

CYP65AQ1  Aspergillus niger
          JGI gene model gw1.10.1062.1|Aspni1
          37% to CYP65Z2 top 36 hits are CYP65
          see fungal pages for seq 

CYP65AR1  Aspergillus niger
          JGI gene model gw1.11.201.1|Aspni1
          36% to CYP65AH1, top 21 hits are CYP65
          see fungal pages for seq 

CYP65AS1  Mycosphaerella graminicola
          39% to CYP65E1, all top hits except CYP5117A1 are CYP65 sequences.
          This may mean that CYP5117 should be renamed.
          N-term from JGI model estExt_Genewise1Plus.C_chr_11525|Mycgr3
          see fungal pages for seq 

CYP65AT1  Mycosphaerella graminicola
          JGI gene model e_gw1.3.1373.1|Mycgr3 
          40% to 65L1, 41% TO 65Z2
          see fungal pages for seq 

CYP65AU1  Coccidioides immitis
          47% to CYP65X1
          see fungal pages for seq 

CYP65AV1  Histoplasma capsulatum
          39% to CYP65AZ2, 40% TO CYP65AF1
          see fungal pages for seq 

CYP65AW1  Fusarium oxysporum
          44% to CYP65A1 Fusarium sporotrichioides
          see fungal pages for seq 

CYP65AW1  Fusarium verticillioides
          90% to CYP65AW1 Fusarium oxysporum = ortholog
          see fungal pages for seq 

CYP65AX1  Fusarium oxysporum
          42% to CYP65B1
          see fungal pages for seq 

CYP65AX1  Fusarium verticillioides
          94% to CYP65AX1 Fusarium oxysporum
          see fungal pages for seq 

CYP65AY1  Aspergillus flavus
          40% to CYP65S4 Fusarium verticillioides
          Note: there is no ortholog of this gene in A. oryzae
          see fungal pages for seq 

CYP65AY2  Penicillium chrysogenum Wisconsin 54-1255
          61% to CYP65AY1
365921  KAGSYIDGKWVPG  365959
        QVPLNLKIRDARA*  366398

CYP65AZ1   Aspergillus oryzae
           GenEMBL BAE63025.1
           39% to 65S2, 41% to 65Z2
           formerly CYP5118A1
           see fungal pages for seq 

CYP65BA1   Aspergillus terreus
           43% to CYP65AF1
           see fungal pages for seq 

CYP65BB1 Mycosphaerella fijiensis
          JGI gene model e_gw1.18.265.1 revised at N-term
          46% to CYP65AF1 Aspergillus oryzae
          45% to CYP563A2 Botrytis cinerea
          44% to CYP65S2  Nectria haematococca
          43% to CYP65Z2  Neosartorya fischeri
          see fungal pages for seq 

CYP65BC1   Metarhizium anisopliae var. acridum Ma102
CYP65BD1   Metarhizium anisopliae var. acridum Ma102
CYP65BD1   Metarhizium anisopliae var. anisopliae Ma23
CYP65BE1   Metarhizium anisopliae var. acridum Ma102
CYP65BF1   Metarhizium anisopliae var. acridum Ma102
CYP65BG1   Metarhizium anisopliae var. anisopliae Ma23
CYP65BH1   Metarhizium anisopliae var. acridum Ma102
CYP65BH1   Metarhizium anisopliae var. anisopliae Ma23

CYP65BJ1  Grosmannia clavigera
CYP65BJ2  Grosmannia clavigera
CYP65BJ3  Grosmannia clavigera

CYP65-un1  Magnaporthe grisea
           MG09636.4  poor match 39% to MG02982.4
           AACU01001669 cont2.1850 PSEUDOGENE
           see fungal pages for seq 

CYP65-un2  Aspergillus flavus
           45% to CYP65L1
           see fungal pages for seq 

CYP65-un2  Aspergillus oryzae
           45% to CYP65L1
           100% to CYP65-un2 Aspergillus flavus
           Supercontig 26: 405493-406148 (-) strand
           see fungal pages for seq 

CYP65-un3  Aspergillus terreus
           36% to CYP65AQ1
           one frameshift, possible CYP65 pseudogene
           30/31 top hits are CYP65
           see fungal pages for seq 

CYP65-un4  Mycosphaerella fijiensis
           JGI gene model e_gw1.3.1109.1
           46% to CYP65-un2 Aspergillus flavus
           see fungal pages for seq 

CYP65-un5  Mycosphaerella fijiensis
           JGI gene model e_gw1.8.672.1
           45% to CYP65AS1 Mycosphaerella graminicola
           see fungal pages for seq 

66A Subfamily

CYP66A1    Agaricus bisporus (a mushroom)
           GenEMBL Z82021 (932bp) AW444023.1 adds C-term
           De Groot, P.W.J., Schaap, P.J., Van Griensven, L.J.L. and Visser, J.
           Isolation of develpmentally regulated genes from the edible mushroom 
           Agaricus bisporus.
           Note: CYP66 is most similar to CYP64

CYP66B1    Agaricus bisporus (edible mushroom)
           GenEMBL ABI271707
           50% to CYP66A1
           partial mRNA

67A Subfamily

CYP67A1    Uromyces fabae (fungus)
           GenEMBL U81793(1849bp)
           Hahn,M. and Mendgen,K.
           Characterization of in planta induced rust genes isolated from a 
           cDNA library.
           unpublished (1997)

CYP67A2    Puccinia graminis f. sp. tritici
           76% to CYP67A1 Uromyces fabae
           see fungal pages for seq 

CYP68A1    Gibberella fujikuroi (a rice pathogenic fungus producing plant
           GenEMBL Y15277
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           Malonek S, Rojas MC, Hedden P, Gaskin P, Hopkins P, Tudzynski B. (2005) 
           Functional characterization of two cytochrome P450 monooxygenase genes, 
           P450-1 and P450-4, of the gibberellic acid gene cluster in Fusarium 
           proliferatum (Gibberella fujikuroi MP-D).
           Appl Environ Microbiol. 71, 1462-1472.
           called P450I or P450-1 GA14-synthase

CYP68A1    Gibberella proliferatum (teleomorph sexual form)
           Fusarium proliferatum (anamorph asexual form)
           GenEMBl AJ628021
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           Malonek S, Rojas MC, Hedden P, Gaskin P, Hopkins P, Tudzynski B. (2005) 
           Functional characterization of two cytochrome P450 monooxygenase genes, 
           P450-1 and P450-4, of the gibberellic acid gene cluster in Fusarium 
           proliferatum (Gibberella fujikuroi MP-D).
           Appl Environ Microbiol. 71, 1462-1472.
           Ortholog to Gibberella fujikuroi 68A1

CYP68B1    Gibberella fujikuroi (a rice pathogenic fungus producing plant
           GenEMBL Y15278
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           called P450II 38% identical to CYP68A1

CYP68C1    Fusarium sporotrichioides (fungi)
           GenEMBL AY040587  (not released yet)
           Andrew Peplow  Isaac Meek
           Clone name TRI1
           Submitted to nomenclature committee July 25, 2001
           Low 40% range with 68A1 and 68B1, 44% to 68D1

CYP68C2    Fusarium graminearum
           FG00071.1 AACM01000004 FGcontig1.4_scaffold1
           See fungal pages for sequence

CYP68D1    Neurospora crassa
           GenEMBL AL355928.2 
           Neurospora crassa sequence contig 1.317  (supercontig 36)
           sequence below not annotated in genbank entry
           46% to 68C1 
RLSFTRWTYK (phase 0 intron)

CYP68D1   Neurospora discreta
          JGI gene model estExt_fgenesh2_pg.C_110241
          92% to CYP68D1 N. crassa
          See fungal pages for gene model

CYP68D2   Nectria haematococca (Fusarium solani group)
          JGI gene model e_gw1.16.35.1
          55% to 68D1, 48% to 68C2
          See fungal pages for gene model

CYP68D3   Aspergillus niger
          JGI gene model e_gw1.6.1239.1|Aspni1
          60% to CYP68D1
          See fungal pages for gene model

CYP68E1   Magnaporthe grisea
          MG10527.4  with C-term extension = accidental fusion
          AACU01001764 cont2.2024
          See fungal pages for gene model

CYP68F1   Magnaporthe grisea
          MG00300.4  36% to 68A1 35% to 68D1 AACU01001402 cont2.70
          See fungal pages for gene model

CYP68frag Magnaporthe grisea
          MG10029.4 AACU01001319 cont2.1919
          62% to CYP68A1 C-TERM fragment RUNS OFF END

CYP68G1   Magnaporthe grisea
          MG03834.4  40% to 68B1 AACU01001031 cont2.748
          See fungal pages for gene model

CYP68H1   Magnaporthe grisea
          MG02294.4  41% to 68B1 39% to 68D1 AACU01000444 cont2.449 
          See fungal pages for gene model

CYP68H2   Magnaporthe grisea
          MG11075.4  38% to 68B1 AACU01001898 cont2.2223 
          See fungal pages for gene model

CYP68H3   Magnaporthe grisea
          MG00024.4 41% to CYP68B1 41% to 68D1 AACU01001352 cont2.7 
          See fungal pages for gene model

CYP68J1   Fusarium graminearum
          FG02672.1 AACM01000132 FGcontig1.132_scaffold1 
          See fungal pages for gene model

CYP68J2   Fusarium graminearum
          FG04717.1 AACM01000196 FGcontig1.196_scaffold3 
          See fungal pages for gene model

CYP68J3   Fusarium oxysporum
          68% to CYP68J1
          See fungal pages for sequence

CYP68J3   Fusarium verticillioides
          95% to CYP68J3 Fusarium oxysporum = ortholog, 60% to CYP68J4
          See fungal pages for sequence

CYP68J4   Fusarium oxysporum
          70% to CYP68J2 Fusarium graminearum
          See fungal pages for sequence

CYP68J4   Fusarium verticillioides
          83% to CYP68J4 Fusarium oxysporum probable ortholog
          See fungal pages for sequence

CYP68K1   Fusarium graminearum
          FG11002.1 AACM01000457 FGcontig1.457_scaffold8
          See fungal pages for gene model

CYP68L1   Aspergillus nidulans
          AN8530.1 45% to 68A1 54 clan
          See fungal pages for gene model

CYP68L2  Aspergillus oryzae
         GenEMBL BAE66422.1
         59% to 68L1, 47% TO CYP68Q1

CYP68L2  Aspergillus flavus
         97% to CYP68L2 Aspergillus oryzae
         See fungal pages for sequence

CYP68L3  Histoplasma capsulatum G217B
         ABBT01000111.1 Ajellomyces capsulatus G217B 382612-384420 (-) strand
         57% to CYP68L2
         See fungal pages for sequence

CYP68L4P Aspergillus clavatus
         AAKD03000015.1 117585-116726 (-) strand mid region is 63% to 68L2
         See fungal pages for sequence

CYP68L5P  Aspergillus fumigatus Af293
          XP_752004.1 also EAL89966.1
          Internal fragment, needs revision
          Pseudogene fragment mid region aa 183-260
          62% to CYP68L3 Histoplasma capsulatum
          74% to CYP65L5P Neosartorya fischeri
          formerly CYP5088A1

CYP68L5P  Neosartorya fischeri
          62% to CYP68L3
          Supercontig 569: 1883929-1885384 (+) strand

CYP68L6   Aspergillus terreus
          63% to CYP68L3
          See fungal pages for sequence

CYP68L7   Aspergillus terreus
          54% to CYP68L6
          See fungal pages for sequence

CYP68M1X  Aspergillus nidulans
          Name revised to CYP5073A1

CYP68N1   Nectria haematococca (Fusarium solani group)
          JGI gene model e_gw1.41.77.1
          48% to CYP68A1 Fusarium graminearum, 52% to CYP58D1 N. crassa
          See fungal pages for sequence

CYP68N2P  Nectria haematococca (Fusarium solani group)
          JGI gene model fgenesh1_pg.scaffold_36000012
          48% to 68J2 C-term only, 64% to 68N1, pseudogene
          See fungal pages for sequence

CYP68N3   Metarhizium anisopliae var. anisopliae Ma23

CYP68P1   Aspergillus fumigatus Af293
          GenEMBL XP_756138.1 also EAL94100.1
          41% to 68N1, 39% to 68A1

CYP68Q1  Aspergillus oryzae
         GenEMBL BAE64916.1, AP007171.1
         47% TO 68L2, 45% to 68L1, 48% to 68D1
         14 P450 genes and 2 pseudogenes on this contig

CYP68Q2P  Aspergillus clavatus
          ~73% to 68Q1 Aspergillus oryzae
          pseudogene adjacent to CYP5117A2P on opposite strand
          See fungal pages for sequence

CYP68R1  Aspergillus terreus 
         AF141924.1, XM_001209275.1
         lovastatin biosynthesis gene cluster
         function="involved in lovastatin production"
         39% to 68D1 N. crassa
         73% to CYP68R2 gene mlcC Penicillium citrinum ML-236B
         (compactin) biosynthetic gene cluster

CYP68R2  Penicillium citrinum
         BAC20565.1, AB072893
         gene mlcC compactin biosynthetic gene cluster
         join(AB072893.1 :15823..16167,
         note="putative ML-236B biosynthetic gene"
         73% to lovA CYP68R1
         note: compactin is 6 desmethyl lovastatin

CYP68R3  Monascus pilosus 
         DQ176595.1, ABA02241.1 
         monacolin K (lovastatin) biosynthetic gene cluster
         possible GC boundary at exon 2/3 DNKggc
         86% to lovA CYP68R1
41807  CMYKFLGT  (0) 41830

CYP68S1  Aspergillus niger
         JGI gene model e_gw1.4.292.1|Aspni1
         51% to CYP68L2
         See fungal pages for sequence

CYP68T1  Aspergillus niger
         51% to CYP68L2, 42% to e_gw1.4.292.1
         See fungal pages for sequence

CYP68U1  Mycosphaerella graminicola
         47% to CYP68N1 Nectria haematococca, 
         48% to CYP68D3 A. Niger 
         N-term from JGI model fgenesh1_pm.C_chr_10000062|Mycgr3
         See fungal pages for sequence

CYP68V1  Histoplasma capsulatum G217B
         50% to CYP68N1
         See fungal pages for sequence

CYP68W1  Aspergillus clavatus
         42% to 68D1
         See fungal pages for sequence

CYP68X1  Neosartorya fischeri
         47% to CYP68V1 Histoplasma capsulatum
         Note: this seq does not have an ortholog in A. fumigatus
         See fungal pages for sequence

CYP68Y1   Metarhizium anisopliae var. acridum Ma102
CYP68Y1   Metarhizium anisopliae var. anisopliae Ma23
CYP68Z1   Metarhizium anisopliae var. anisopliae Ma23
CYP68Z2   Metarhizium anisopliae var. acridum Ma102

CYP69A1    Gibberella fujikuroi (a rice pathogenic fungus producing plant
           GenEMBL Y15279
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           called P450III a distant match to CYP54

CYP97E1    Skeletonema costatum (diatom)
           GenEMBL AF459441
           Yang,S., Wu,R.S.S., Mok,H.O.L., Zhang,Z.P. and Kong,R.Y.C.
           Identification of a novel cytochrome P450 cDNA, CYP97E1, from the
           marine diatom Skeletonema costatum (Bacillariophyceae)
           J. Phycol. 39 (3), 555-560 (2003)
           52% to 97B3, 51% to 97B2, 50% to 97B1
           submitted to nomenclature committee Jan 28, 2001
           this is the first full length sequence from a diatom
           See stramenopile/diatom pages for sequence and a tree

CYP97E2    Thalassiosira pseudonana (diatom)
           No accession
           From JGI genome project
           See stramenopile pages for sequence and a tree

CYP97E3     Ectocarpus siliculosus (brown algae)
            Genoscope Ectocarpus siliculosus brown algae project
            EST LQ0AAB42YI07FM1.SCF (C-term)
            59% to CYP97E1 and CYP97E2 876 amino acids is very long for a P450
            Ectocarpus sctg_63 344994-350246

CYP97E4     Phaeodactylum tricornutum (diatom)
            estExt_Genewise1.C_chr_50056|Phatr2 (at JGI)
            69% to 97E2 and 97E1
            this gene model was automatically generated at JGI
            I have not checked it, it may have some errors

CYP97F1    Thalassiosira pseudonana (diatom)
           No accession
           From JGI genome project
           See stramenopile pages for sequence and a tree

CYP97F2    Euglena gracilis
           GenEMBL EC678021.1 EST
           60% to 97F1 of Thalassiosira pseudonana (diatom)
           51% to CYP97B2 Glycine max, 50% to 97B3 Arabidopsis
           52% to Pinus taeda CYP97B9, 50% to 97B4, 49% to 97B3
           only 40% to 97A3 and 39% to 97C1 Arab. 
           This is the CYP97B ortholog
           If euglena only has one CYP97, then CYP97B
           May be the oldest CYP97 subfamily

CYP97F3     Phaeodactylum tricornutum (diatom)
            e_gw1.27.30.1|Phatr2 (at JGI)
            75% to CYP97F1
            this gene model was automatically generated at JGI
            I have not checked it, it may have some errors

CYP97F4     Ectocarpus siliculosus (brown algae)
            Genoscope Ectocarpus siliculosus brown algae project
            ESTs LQ0AAA4YK08FM1.SCF, LQ0AAB23YL07FM1.SCF
            LQ0AAB3YI17FM1.SCF, LQ0AAB85YI22FM1.SCF
            60% to CYP97F1 diatom, 62% to 97F3 Phaeodactylum
            Ectocarpus sctg_63 359933-352442

Note:  two digit names for lower eukaryotes end here and continue as three digit 
names at 
CYP501.  Animal P450 families cover CYP1-49 and CYP301-499 are reserved for new 
animal P450 families.

Cyp301a1   Drosophila melanogaster
           GenEMBL AC017275 comp(35594-38192) also AC007356
           possible mitochondrial P450 fits in the mitochondrial clan.

Cyp301a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP301A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2l3

CYP301A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            66% to 301A1 Drosophila melanogaster.  

CYP301A1   Linepithema humile (argentine ant)
           No accession number
CYP301A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           86% to CYP301A1 Linepithema humile

CYP301A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           89% to CYP301A1 Linepithema humile

CYP301A1   Pogonomyrmex barbatus (seed-harvester ant)
           No accession number
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           61% to CYP301A1 Apis mellifera

CYP301A2   Drosophila arizonae
           no accession number
           from Tina Yee and Phil Danielson
           submitted to nomenclature committee 6/29/99
           84% identical to Cyp301a1
           clone name DU36az

CYP301A1   Bombyx mori (silkworm)
           BAAB01030444.1 BP117781 BAAB01134599.1 BAAB01155686.1 BAAB01102862.1
           BAAB01093671.1 BAAB01132355.1 BAAB01006099.1
           65% to Drosophila 301A1, 64% to Apis 301A1
           CYP49 and CYP301 are nearly subfamilies of a single family
           See silkworm page for sequence

CYP301A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            77% to CYP301A1 Helicoverpa armigera
            91% to CYP301A1 Bombyx mori

CYP301A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_268 51% to CYP301A1, probable ortholog

CYP301A1   Plutella xylostella 
           Gene number CCG011722.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           90% to CYP301A1 Heliconius melpomene

CYP301A1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           89% to CYP301A1 Bombyx mori

CYP301A1   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP301A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_974014
           75% to 301A1 bee, 66% to CYP301A1 Drosophila

CYP301A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 12
           75% to CYP301A1 Tribolium castaneum
           C-helix to PERF

CYP301A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            77% to CYP301A1 Tribolium castaneum

CYP301A1   Aedes aegypti (yellow fever mosquito)

CYP301A1   Culex pipiens

CYP301A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph301-2, 73% to 301A1 Tribolium
            Pediculus genome site

CYP301A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           67% to CYP301A1 Tribolium castaneum, incomplete

CYP301A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP301A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig19832 231aa 
           67% TO CYP301A1 aphid, in the mito clan

CYP301A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           mito clan

CYP301A1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011

CYP301A1   Trialeurodes vaporariourum (whitefly)

CYP301B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_974040
           43% to 49A1 Drosophila, mito clan
           60% to 301B1 bee, 48% to 301A1 bee

CYP301B1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           mito clan
           name corrected, formerly CYP49A1

CYP301B1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           65% to CYP301B1 Acyrthosiphon pisum, C-term only
           name changed, formerly CYP49A1

CYP301B1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           60% to CYP301B1 Tribolium castaneum

CYP301B1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 33
           68% to CYP301B1 Tribolium castaneum
           mid region to PERF

CYP301B1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            63% to CYP301B1 Tribolium castaneum

CYP301B1   Bombyx mori (silkworm)
           BAAB01133495.1 BAAB01150577.1 BAAB01091102.1 BAAB01198981.1
           BAAB01133297.1 BAAB01093561.1
           44% to CYP301A1
           CYP49 and CYP301 are nearly subfamilies of a single family
           Note: name changed based on Rene Feyereisens analysis
           Formerly CYP49A1
           See silkworm page for sequence

CYP301B1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            73% to CYP301B1 Bombyx mori

CYP301B1   Plutella xylostella 
           Gene number CCG011724.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           74% to CYP301B1 Bombyx mori formerly CYP49A1

CYP301B1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph301-1, 61% to 301B1 Tribolium, 58% to 301B1 Apis, 
            insert between PERF and Heme not in Tribolium
            Pediculus genome site

CYP301B1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP301B1   Linepithema humile (argentine ant)
           No accession number
CYP301B1   Solenopsis invicta (fire ant)
           See Solenopsis page
           70% to CYP301B1 Linepithema humile

CYP301B1   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf37 and sf30 two pieces probably from the same gene
           63% and 74% to CYP301B1 Tribolium and Apis

CYP301B1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           64% to CYP301B1 Apis mellifera, incomplete

CYP301C1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph12, 39% to Tribolium 301A1, 39% to 301A1 Pediculus 
            (including  Ns at N-term) and 39% to 301B1 Pediculus
            39% to CYP12H1 Tribolium
            Pediculus genome site

CYP302A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2l2
            Note: in Drosophila Cyp302a1 is the disembodied gene (dib), 
            a C22 hydroxylase in the ecdysteroid biosynthetic pathway from cholesterol

Cyp302a1   Drosophila melanogaster
           GenEMBL AC015396 31954-33705
           Michael B. O'Connor
           Submitted to nomenclature committee 11/17/99
           30% to Cyp12b1 other best matches are 12 family members
           the fly gene is called disembodied Dib
           see <A HREF="http://flybase.bio.indiana.edu:82/.bin/fbidq.html?FBrf0101392">abstract</A>

Cyp302a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            Gene name disembodied dib

CYP302A1    Bactrocera dorsalis (oriental fruit fly)
            Lin Cong
            Submitted to nomenclature committee 12/5/2011
            64% to CYP302A1 D. melanogaster

CYP302A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            First 3 exons
            45% to 302A1 Drosophila melanogaster.
            disembodied ortholog

CYP302A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            Last 4 exons
            51% to 302A1 Drosophila melanogaster.
            disembodied ortholog
            it is highly probable that these to partial sequences are 
            from the same gene (missing about 68 amino acids)

CYP302A1   Linepithema humile (argentine ant)
           No accession number
CYP302A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           79% to CYP302A1 Linepithema humile

CYP302A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           81% to CYP302A1 Linepithema humile

CYP302A1    Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            78% to CYP302A1 Linepithema humile

Cyp302a1    Bombyx mori (silkworm)
            BAAB01119552.1 BAAB01040509.1 BAAB01022270.1 CK534186 
            46% to 302A1 Anoph. Probable ortholog
            See silkworm page for sequence

Cyp302a1    Bombyx mori (silkworm)
            GenEMBL AB198340
            Niwa, R, Sakudoh, T, Namiki, T. Saida, K, Fujimoto, Y, Kataoka, H.
            The ecdysteroidogenic P450 Cyp302a1/disembodied from the silkworm
            Bombyx mori, is transcriptionally regulated by prothoracicotropic 
            hormone. Insect Molecular Biology 2005 in press

CYP302A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            59% to CYP302A1 Manduca sexta

CYP301B1   Plutella xylostella 
           Gene number CCG011849.1, CCG004291.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           62% to CYP302A1 Bombyx mori

CYP302A1    Manduca sexta (tobacco hornworm)
            GenEMBL DQ357067
            Rewitz,K.F., Rybczynski,R., Warren,J.T. and Gilbert,L.I.
            Identification, characterization and developmental expression of
            Halloween genes encoding P450 enzymes mediating ecdysone
            biosynthesis in the tobacco hornworm, Manduca sexta
            Insect Biochem. Mol. Biol. 36 (3), 188-199 (2006)

CYP302A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_264 49% to CYP302A1, probable ortholog

CYP302A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_974252
           47% to 302a1 Drosophila, 49% to 302A1 bee, 49% to 302A1 Anopheles
           disembodied ortholog

CYP302A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010, revised Nov. 22
           mito clan
           Clone name seq 18
           59% to CYP302A1 Tribolium castaneum

CYP302A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            65% to CYP302A1 Leptinotarsa decemlineata

CYP302A1v1  Aedes aegypti (yellow fever mosquito)

CYP302A1v2  Aedes aegypti (yellow fever mosquito)

CYP302A1   Culex pipiens

CYP302A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph302, 52% to 302A1 Tribolium, 54% to 302A1 Apis
            ortholog to dib disembodied
            Pediculus genome site

CYP302A1    Nasonia vitripennis (jewel wasp)
            See wasp page

CYP302A1    Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Lce0063I12 
            68% identical to D. pseudoobscura CYP302a1 ortholog
            only 183 aa

CYP302A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           dib 22-hydroxylase
           mito clan

CYP302A1    Trialeurodes vaporariourum (whitefly)

CYP302A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           40% to CYP302A1 Acyrthosiphon pisum (probable ortholog)

CYP302A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           40% to CYP302A1 Acyrthosiphon pisum, incomplete, 500 aa 
           missing the N-term

CYP302A1a   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            N-term part 95% to CYP302A1 Laodelphax striatellus
CYP302A1b   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            C-term part 86% to CYP302A1 Laodelphax striatellus
CYP302A1    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

CYP302A1    Tetranychus urticae (two-spotted spider mite, arachnid)

CYP302A1    Daphnia pulex (water flea)

Cyp303a1    Drosophila melanogaster
            GenEMBL AC017306 12933-14444 no introns

Cyp303a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP303A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs3r4

CYP303A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            43% to 303A1 Drosophila melanogaster.  Note this sequence is 
            named in the same subfamily as other CYP303As since 
            there seems to be only one orthologous sequence per
            species and it does not make sense to name orthologs with 
            different subfamily names.

CYP303A1   Linepithema humile (argentine ant)
           No accession number
CYP303A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           77% to CYP303A1 Linepithema humile

CYP303A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           83% to CYP303A1 Pogonomyrmex barbatus

CYP303A1    Bombyx mori (silkworm)
            BAAB01045446.1 BAAB01180906.1
            BP126135 BAAB01031702.1
            45% to 303A1 Probable ortholog
            See silkworm page for sequence

CYP303A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            77% to CYP303A1 Bombyx mori

CYP303A1   Plutella xylostella 
           Gene number CCG015922.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           74% to CYP303A1 Bombyx mori

CYP303A1   Chilo suppressalis (striped rice stem borer)
           No accession number
           Jifeng Shi
           Submitted to nomenclature committee May 1, 2012
           77% to CYP303A1 Bombyx mori

CYP303A1    Tribolium castaneum (red flour beetle)
            GenEMBL XP_966541
            42% to 303A1 Dm, 47% to 303A1 Anopheles, 51% to 303A1 Aedes

CYP303A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            52% to CYP303A1 Tribolium castaneum

CYP303A1    Aedes aegypti (yellow fever mosquito)

CYP303A1   Culex pipiens

CYP303A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph303, 52% to 303A1 Aedes
            Pediculus genome site

CYP303A1   Locusta migratoria manilensis
           No accession number
           Xiaoyu Ren
           Submitted to nomenclature committee May 15, 2013
           69% to CYP303A1 Acyrthosiphon pisum (pea aphid)

CYP303A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP303A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           nompH (not a Halloween gene)
           CYP2 clan

CYP303A1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           Two pieces 84-87% to CYP303A1 Acyrthosiphon pisum

CYP303A1   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf59
           69% to CYP303A1 aphid

CYP303A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           Complete, 63% to CYP303A1 Acyrthosiphon pisum 

CYP303A2   Linepithema humile (argentine ant)
           No accession number
Cyp304a1    Drosophila melanogaster
            GenEMBL AC008359 comp(80887-82836) also AC014292 AC009393

Cyp304a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP304B1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPg2r1

CYP304B2    Aedes aegypti (yellow fever mosquito)

CYP304B3    Aedes aegypti (yellow fever mosquito)

CYP304B4    Culex pipiens

CYP304B5    Culex pipiens

CYP304B6    Culex pipiens

CYP304B7    Culex pipiens

CYP304C1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPg2r2

CYP304C1    Aedes aegypti (yellow fever mosquito)

CYP304C1   Culex pipiens

CYP304E1    Tribolium castaneum (red flour beetle)
            GenEMBL XP_973180
            37% to 304a1 Dm, 40% to 304B3 Aedes, 38% to 304B1 Anopheles
            AAJJ01000062.1, DT790944.1 DN650948.1 ESTs 

CYP304F1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_236 42% to CYP304B2 or B3, 39% to CYP304B1, 
            37% to CYP304C1, 41% to CYP304E1 Tribolium, 40% to CYP304A1
            HAH003134 100% to Contig_236 except a short internal seq
            Contig_226 1 diff to Contig_236, contig 226 and 236 agree in
            Region where HAH003134 is different (frameshift?)

CYP304F1    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            92% to CYP304F1 Helicoverpa armigera

CYP304F2   Zygaena filipendulae (zygaenid moth, Lepidoptera)
           No accession number
           Mika Zagrobelny Larsen
           Submitted to nomenclature committee Feb. 4, 2009
           Clone name Zygae_c481 
           63% to CYP304F1 Helicoverpa armigera (cotton bollworm)

CYP304F3   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP304F4   Spodoptera litura
           No accesion number
           Zihbin Xu, Sichun Zheng, Qili Feng
           submitted to nomenclature committee April 17, 2011
           80% to CYP304F1 Helicoverpa armigera

CYP304F4   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           99% to CYP304F4 Spodoptera litura (ortholog) 2 aa diffs

CYP304F5    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            81% to CYP304F4 Spodoptera litura

CYP304F6    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            60% to CYP304F2 Zygaena filipendulae

CYP304F7   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP304G1    Trialeurodes vaporariourum (whitefly)

CYP304H1v1 Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           41% to CYP304E1 Tribolium castaneum

CYP304H1v2 Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           One amino acid diff to CYP304H1v1

CYP304H1v3 Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           incomplete, 3 aa diffs to CYP304H1v1, 4 aa diffs to CYP304H1v2

Cyp305a1    Drosophila melanogaster
            GenEMBL AC018013 comp(34574-37224)

Cyp305a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP305A1    Tribolium castaneum (red flour beetle)
            GenEMBL XP_970235
            41% to 305A1 Dm, 46% to 305A5 Aedes, 40% to 305B1 B. mori

CYP305A1 part 1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 17
           63% to CYP305A1 Tribolium castaneum
           short N-term fragment

CYP305A1 part 2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 20
           56% to CYP305A1 Tribolium castaneum
           short C-helix fragment

CYP305A1 part 3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 3
           51% to CYP305A1 Tribolium castaneum
           middle region up to PKG motif

CYP305A1 part 4   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 22
           62% to CYP305A1 Tribolium castaneum
           short C-term fragment

CYP305A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph305, 45% to 305A1 Anopheles gambiae
            Pediculus genome site

CYP305A2    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPj2l1

CYP305A3    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPj2l2

CYP305A4    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPj2l4

CYP305A5    Aedes aegypti (yellow fever mosquito)

CYP305A6    Aedes aegypti (yellow fever mosquito)

CYP305A7    Culex pipiens

CYP305A8    Culex pipiens

CYP305A9    Culex pipiens

CYP305A10   Culex pipiens

CYP305A11   Culex pipiens

CYP305A12P  Anopheles gambiae (malaria mosquito)
            GenEMBL XM_001230354.2 (seq below is expanded on both ends)
            Partial cDNA sequence 97% identical to CYP305A3 and CYP305A4
            Chromosome UNKN: 41,132,263-41,133,123 reverse strand.
            This transcript is a product of gene AGAP012937
            The genomic region 66760 bp upstream of this seq 
            is missing the N-term 140 aa, so this is a pseudogene.

CYP305A13  Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           incomplete, 48% to CYP305A5 Aedes aegypti

CYP305B1    Bombyx mori (silkworm)
            GenEMBL AB044900
            Nobuyoshi Katagiri, Okitsugu Yamashita
            39% identical to 305a1

CYP305B1    Helicoverpa armigera (cotton bollworm)
            No accession number
            David G. Heckel 
            submitted to nomenclature committee Feb. 21, 2005
            after revision 61% to 305B1

CYP305B1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_201 38% to CYP305A3 
            (note: original CYP305C1 seq had an error in the mid region
            name changed to CYP305B1 after revision)

CYP305B1   Heliconius melpomene (common postman butterfly)
           No accession number
           Ritika Chauhan and Richard ffrench-Constant
           Submitted to nomenclature committee June 2, 2011
           54% to CYP305B2 Heliconius melpomene
           62% to CYP305B1 Bombyx mori

CYP305B1   Plutella xylostella 
           Gene number CCG002515.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           64% to CYP305B1 Heliconius melpomene

CYP305B1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           79% to CYP305B1 Helicoverpa armigera

CYP305B1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           C-term 45% to CYP305B1 Heliconius melpomene

CYP305B2   Heliconius melpomene (common postman butterfly)
           No accession number
           Ritika Chauhan and Richard ffrench-Constant
           Submitted to nomenclature committee June 2, 2011
           54% to CYP305B1 Heliconius melpomene

CYP305C1X   Helicoverpa armigera (cotton bollworm)
            No accession number
            Vladimir Grubor
            submitted to nomenclature committee 12/30/2003
            55% to CYP305B1 
            324 aa, seq #7
            revised sequence name changed to 305B1

CYP305D1   Apis mellifera (honeybee)

CYP305D1   Linepithema humile (argentine ant)
           No accession number
CYP305D1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           62% to CYP305D1 Linepithema humile

CYP305D1   Pogonomyrmex barbatus (seed-harvester ant)
           No accession number
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           50% to CYP305D1 Apis mellifera
           66% to CYP305D1 Linepithema humile

CYP305D1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP305E1   Acyrthosiphon pisum (pea aphid)
           LOC100168939 SCAFFOLD13 coords:75476-86851
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           41% to CYP305A1 Drosophila melanogaster
           CYP2 clan

CYP305F1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            47% to CYP305A1 Tribolium castaneum

Cyp306a1    Drosophila melanogaster
            GenEMBL AC012373 154223-156412 also AC015216 AC012164 AC012376
            phantom phm gene

Cyp306a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            phantom phm gene

CYP306A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r6
            Ortholog of phantom phm gene

CYP306A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            46% to 306A1 Drosophila.  Note this sequence is 
            named in the same subfamily as other CYP306As since 
            there seems to be only one orthologous sequence per
            species and it does not make sense to name orthologs with 
            different subfamily names.
            Ortholog of phantom phm gene

CYP306A1   Linepithema humile (argentine ant)
           No accession number
CYP306A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           62% to CYP306A1 Apis mellifera

CYP306A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           79% to CYP306A1 Linepithema humile

CYP306A1   Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           62% to CYP306A1 Apis mellifera

CYP306A1    Bombyx mori (silkworm)
            BAAB01049676.1 BAAB01150476.1
            BAAB01016115.1 BAAB01136488.1 BAAB01075467.1
            Niwa,R., Matsuda,T., Yoshiyama,T., Namiki,T., Mita,K., Fujimoto,Y.
            and Kataoka,H.
            CYP306A1, a cytochrome P450 enzyme, is essential for ecdysteroid
            biosynthesis in the prothoracic glands of Bombyx and Drosophila
            J. Biol. Chem. (2004) In press
            See silkworm page for sequence
            Ortholog of phantom phm gene

CYP306A1    Manduca sexta (tobacco hornworm)
            GenEMBL DQ357066
            Rewitz,K.F., Rybczynski,R., Warren,J.T. and Gilbert,L.I.
            Identification, characterization and developmental expression of
            Halloween genes encoding P450 enzymes mediating ecdysone
            biosynthesis in the tobacco hornworm, Manduca sexta
            Insect Biochem. Mol. Biol. 36 (3), 188-199 (2006)

CYP306A1   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP306A1   Chilo suppressalis (striped rice stem borer)
           No accession number
           Jifeng Shi
           Submitted to nomenclature committee May 1, 2012
           80% to CYP306A1 Spodoptera littoralis

CYP306A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_197 79% to CYP306A1 Bombyx
            HAH005766 100% to Contig_197

CYP306A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            71% to CYP306A1 Spodoptera littoralis

CYP306A1    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            93% to CYP306A1 Helicoverpa armigera

CYP306A1    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            95% to CYP306A1 Helicoverpa armigera

CYP306A1   Spodoptera littoralis (cotton leafworm)

CYP306A1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           98% to CYP306A1 Spodoptera littoralis FJ010194

CYP306A1   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP306A1    Tribolium castaneum (red flour beetle)
            GenEMBL XP_968477, protein and AAJJ01000667.1 genomic
            46% to 306A1 Aedes, 49% to Apis 306A1
            Ortholog of phantom phm gene

CYP306A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 revised Nov. 22, 2011
           CYP2 clan
           Clone name seq 8
           56% to CYP306A1 Tribolium castaneum

CYP306A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            54% to CYP306A1 Leptinotarsa decemlineata

CYP306A1    Aedes aegypti (yellow fever mosquito)

CYP306A1    Culex pipiens

CYP306A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph306, phm phantom  51% to 306A1 Apis
            Pediculus genome site

CYP306A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP306A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           phm 25 hydroxylase
           CYP2 clan

CYP306A1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011
           N-term and C-term 50-51% to CYP306A1 Apis and Nasonia

CYP306A1v1 Trialeurodes vaporariourum (whitefly)

CYP306A1v2 Trialeurodes vaporariourum (whitefly)

CYP306A1   Daphnia pulex (water flea)

CYP306A1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           62% to CYP306A1 Trialeurodes vaporariourum (whitefly)

CYP306A1   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf58 C-terminal
           53% to CYP306A1 Apis

CYP306A2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee June 22, 2011
           Clone name scaffold22645 C-term
           52% to CYP306A1 Aedes
           note: species corrected from Sogatella frucifera 
           (white-backed plant hopper)

CYP306A2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Complete sequence sent by Jia Shuang
           Submitted to nomenclature committee Dec. 6, 2011

CYP306A1/2 Laodelphax striatellus (small brown planthopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee June 22, 2011
           Clone name scaffold30570 N-term
           49% to CYP306A1 Spodoptera littoralis
           note: species corrected from Sogatella frucifera 
           (white-backed plant hopper)

CYP306A2a   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            N-term part 93% to CYP306A2 Laodelphax striatellus
CYP306A2b   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            C-term part 84% to CYP306A2 Laodelphax striatellus
Cyp307a1    Drosophila melanogaster
            GenEMBL AC014810 comp(54284-52654) also AC007840
            spook spo (see Flybase)
307a1 AC014810 comp(54284-52654) also AC007840 revised 9/8/2000
sequence revised between PERF and heme, no intron is present

Cyp307a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            spook spo (see Flybase)
D. pseudoobscura ortholog of Cyp307a1 Jie Shen no introns

CYP307A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs1x4
            Ortholog of spook spo (see Flybase)

CYP307A1    Bombyx mori (silkworm)
            BAAB01102325.1 BAAB01020228.1
            51% to 307A1 probable ortholog
            See silkworm page for sequence
            Ortholog of spook spo (see Flybase)

CYP307A1    Manduca sexta
            GenEMBL DQ899315
            Ono,H., Rewitz,K.F., Shinoda,T., Itoyama,K., Petryk,A.F.,
            Rybczynski,R., Jarcho,M., Warren,J.T., Marques,G., Shimell,M.J.,
            Gilbert,L.I. and O'Connor,M.B.
            Spook and Spookier code for stage-specific components of the
            ecdysone biosynthetic pathway in Diptera
            Dev. Biol. (2006) 298, 555-70.

CYP307A1   Chilo suppressalis (striped rice stem borer)
           No accession number
           Jifeng Shi
           Submitted to nomenclature committee May 1, 2012
           79% to CYP307A1 Spodoptera littoralis
           frameshift near N-term and stop codon in heme region
           incomplete sequence, probably with two errors

CYP307A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_269 73% to CYP307A1 Bombyx, 56% to CYP307A1 Anopheles
            HAH014257 100% to Contig_269
            Submitted sequences contain an intron

CYP307A1   Plutella xylostella 
           Gene number CCG007583.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           77% to CYP307A1 Heliconius melpomene

CYP307A1    Tribolium castaneum (red flour beetle)
            GenEMBL AAJJ01000951.1  genomic
            55% to 307A1 Anopheles
            Ortholog of spook spo gene

CYP307A1 part 1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 21
           75% to CYP307A1 Tribolium castaneum
           aa 39-91

CYP307A1 part 2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 28
           67% to CYP307A1 Tribolium castaneum
           aa 226-360

CYP307A1 part 3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP2 clan
           Clone name seq 25
           60% to CYP307A1 Tribolium castaneum
           aa 432-482

CYP307A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            70% to CYP307A1 Tribolium castaneum

CYP307A1    Aedes aegypti (yellow fever mosquito)

CYP307A1    Culex pipiens

CYP307A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph307-2, spo spook  66% to 307A1 Tribolium
            Pediculus genome site

CYP307A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP307A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           Partial sequence
           63% to CYP307A1 Tribolium castaneum

CYP307A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee Oct. 12, 2011
           Complete sequence
           57% to CYP307A1 Pediculus humanus

CYP307A1a   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            N-term part 94% to CYP307A1 Laodelphax striatellus
CYP307A1b   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            C-term part 92% to CYP307A1 Laodelphax striatellus

CYP307A1    Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Luce0093H16 
            60% identical to Dm CYP307a1 ortholog

CYP307A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           85% to LOC100160738
           57% to CYP307A1 Tribolium, 49% to Cyp307a2 Drosophila melanogaster
           39% to CYP307B1 Tribolium
           CYP2 clan

CYP307A1v1 Tetranychus urticae (two-spotted spider mite, arachnid)
CYP307A1v1 Tetranychus urticae (two-spotted spider mite, arachnid)

CYP307A1   Daphnia pulex (water flea)

Cyp307a2    Drosophila melanogaster
            GenEMBL AC019383 comp(3284-3706) AL078186
            This sequence was originally predicted as a pseudogene,
            but recent work shows it is a functional gene called spookier (spok)
            Ono H, Rewitz KF, Shinoda T, Itoyama K, Petryk A, Rybczynski R, Jarcho 
            M, Warren JT, Marques G, Shimell MJ, Gilbert LI, O'Connor MB.
            Spook and Spookier code for stage-specific components of the ecdysone        
            biosynthetic pathway in Diptera.
            Dev Biol. 2006 Oct 15;298(2):555-70.
            This is a new member of the halloween genes
            AC019383 comp(3284-3706) AL078186
            AC019474 exon 2

Cyp307a2    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
Contig3286_Contig7811B.fa.9 66% to D. pseudoobscura ortholog of 307A1
first exon 67% to 307A2 55% to 307A1 so this is the ortholog of 307A2
sequence revised between PERF and heme (no intron), not a pseudogene

CYP307A3   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           52% to CYP307A1 Tribolium, 50% to Cyp307a2 Drosophila melanogaster
           37% to CYP307B1 Tribolium
           CYP2 clan

CYP307B1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs3r2
            Note: CYP307B sequences have been named spookiest 
            Ono H, Rewitz KF, Shinoda T, Itoyama K, Petryk A, Rybczynski R, Jarcho 
            M, Warren JT, Marques G, Shimell MJ, Gilbert LI, O'Connor MB.
            Spook and Spookier code for stage-specific components of the ecdysone        
            biosynthetic pathway in Diptera.
            Dev Biol. 2006 Oct 15;298(2):555-70.

CYP307B1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            55% to 307B1 Anopheles.  Note this sequence is given the
            same name as Anopheles 307B1 since 
            there seems to be only one orthologous sequence and it does 
            not make sense to name orthologs with different names.
            Note: CYP307B sequences have been named spookiest 
            Ono H, Rewitz KF, Shinoda T, Itoyama K, Petryk A, Rybczynski R, Jarcho 
            M, Warren JT, Marques G, Shimell MJ, Gilbert LI, O'Connor MB.
            Spook and Spookier code for stage-specific components of the ecdysone        
            biosynthetic pathway in Diptera.
            Dev Biol. 2006 Oct 15;298(2):555-70.

CYP307B1   Linepithema humile (argentine ant)
           No accession number
CYP307B1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           70% to CYP307B1 Apis mellifera

CYP307B1   Solenopsis invicta (fire ant)
           See Solenopsis page
           88% to CYP307B1 Pogonomyrmex barbatus

CYP307B1   Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           71% to CYP307B1 Apis mellifera

CYP307B1    Tribolium castaneum (red flour beetle)
            GenEMBL AAJJ01001163.1  genomic
            53% to 307B1 Anopheles, 55% to 307B Aedes, 51% to bee 307B1
            Note: CYP307B sequences have been named spookiest 
            Ono H, Rewitz KF, Shinoda T, Itoyama K, Petryk A, Rybczynski R, Jarcho 
            M, Warren JT, Marques G, Shimell MJ, Gilbert LI, O'Connor MB.
            Spook and Spookier code for stage-specific components of the ecdysone        
            biosynthetic pathway in Diptera.
            Dev Biol. 2006 Oct 15;298(2):555-70.
12198  KDTFTFKFVRR*  12163

CYP307B1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            61% to CYP307B1 Tribolium castaneum

CYP307B1    Aedes aegypti (yellow fever mosquito)
            Note: CYP307B sequences have been named spookiest 
            Ono H, Rewitz KF, Shinoda T, Itoyama K, Petryk A, Rybczynski R, Jarcho 
            M, Warren JT, Marques G, Shimell MJ, Gilbert LI, O'Connor MB.
            Spook and Spookier code for stage-specific components of the ecdysone        
            biosynthetic pathway in Diptera.
            Dev Biol. 2006 Oct 15;298(2):555-70.

CYP307B1    Culex pipiens

CYP307B1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph307-1, spookiest  47% to 307B1 Apis
            Pediculus genome site

CYP307B1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig5856_11021 546aa 
           53% TO CYP307B1 Anopheles, in the CYP2 clan

CYP307B1   Cimex lectularius (bedbug)
           No accession number
           Hemant Gujar
           Submitted to nomenclature committee Aug. 1, 2011

CYP307B1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Sept. 17, 2011
           57% to CYP307B1 Cimex lectularius

CYP307B1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           57% to CYP307B1 Cimex lectularius (presumed ortholog)

CYP307C1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           46% to CYP307B1 Tribolium, 43% to CYP307A1 Tribolium, 
           40% to CYP307A2 D. melanogaster
           42% to CYP307A1 aphid, 40% to CYP307A3 aphid
           CYP2 clan

CYP307D1    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

Cyp308a1    Drosophila melanogaster
            GenEMBL AC015216 72624-74273 also AC012164

Cyp308a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp309a1    Drosophila melanogaster
            GenEMBL AC019891 comp(47437-49308) also AC009909

Cyp309a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp309a2    Drosophila melanogaster
            GenEMBL AC009909 45541-45982 also AC019977

Cyp309a2    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP309B1    Bactrocera dorsalis (Oriental fruit fly) 
            No accession number
            Yong Huang
            submitted to nomenclature committee Sept. 13, 2012
            39% to Cyp309a1 D. pseudoobscura
            38% to Cyp309a2 D. melanogaster
            36% to Cyp28a5 D. melanogaster
            clone name 1138

Cyp310a1    Drosophila melanogaster
            GenEMBL AC017690 comp(12877-14650)

Cyp310a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp311a1    Drosophila melanogaster
            GenEMBL AC014186 2270-3910

Cyp311a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp312a1    Drosophila melanogaster
            GenEMBL AC015424 57845-59744 also AC009369 AC007573 AC010003

Cyp312a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp313a1    Drosophila melanogaster
            GenEMBL AC017740 comp(167857-169728) also AC007809 AC007928

Cyp313a2    Drosophila melanogaster
            GenEMBL AC017371 4100-5929 AC007724 AL057969 AL067059

Cyp313a3    Drosophila melanogaster
            GenEMBL AC017371 1890-3720 also AC007724

Cyp313a4    Drosophila melanogaster
            GenEMBL AC017336 153877-155807 also AC007752

Cyp313a4    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp313a5    Drosophila melanogaster
            GenEMBL AC017371 6352-8145 also AC007724

Cyp313a6    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            This is a paralog of 313a4, D. pseudoobscura has two genes
            To D. melanogasters one Cyp313a4

Cyp313b1    Drosophila melanogaster
            GenEMBL AC007571 comp(104264-106046) also AC013225

Cyp313b1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp313c1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp313c2    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp314a1    Drosophila melanogaster
            GenEMBL AC012699 22585-24723 also AC006496
            shade shd gene

Cyp314a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            shade shd gene

CYP314A1    Bactrocera dorsalis (oriental fruit fly)
            Lin Cong
            Submitted to nomenclature committee 12/5/2011
            69% to CYP314A1 D. melanogaster

CYP314A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r3
            Ortholog of shade shd gene

CYP314A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            43% to 314A1 Drosophila.  Note this sequence is 
            named in the same subfamily as other CYP314s since 
            there seems to be only one orthologous sequence per
            species and it does not make sense to name orthologs with 
            different subfamily names.
            Ortholog of shade shd gene

CYP314A1   Linepithema humile (argentine ant)
           No accession number
CYP314A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           92% to CYP314A1 Pogonomyrmex barbatus

CYP314A1    Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            87% to CYP314A1 Linepithema humile

CYP314A1    Acyrthosiphon pisum (pea aphid)
            GenEMBL CF588143
            48% to 314A1 Dros. Pseudoobscura aa 126-362
            Ortholog of shade shd gene

CYP314A1    Trialeurodes vaporariourum (whitefly)

CYP314A1   Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           65% to CYP314A1 Cimex lectularius (bedbug)

CYP314A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011

CYP314A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_972699, CB336479 CB336480 EST
           42% to 314A1 bee, 39% to 314A1 Aedes
           Ortholog of shade shd gene

CYP314A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 45
           52% to CYP314A1 Tribolium castaneum
           PKG to PERF fragment

CYP314A1    Aedes aegypti (yellow fever mosquito)

CYP314A1   Culex pipiens

CYP314A1   Culex_quinquefasciatus (southern house mosquito)
           No accession number
           Osamu Komagata
           submitted to nomenclature committee 7/25/07
           sequence 26
           62% to CYP314A1 Anoph., 76% to 314A1 Aedes
           Ortholog of shade shd gene a halloween gene in the Mito clan

CYP314A1    Bombyx mori (silkworm)
            BP179750 BP179443 BAAB01069738.1 BAAB01063661.1   
            BAAB01099804.1 BAAB01099804.1 BAAB01122030.1 BAAB01134118.1
            49% to 314A1 probable ortholog
            See silkworm page for sequence
            Ortholog of shade shd gene

CYP314A1    Manduca sexta (tobacco hornworm)
            GenEMBL DQ372988
            Rewitz,K.F., Rybczynski,R., Warren,J.T. and Gilbert,L.I.
            Developmental expression of Manduca shade, the P450 mediating the
            final step in molting hormone synthesis
            Mol. Cell. Endocrinol. 247 (1-2), 166-174 (2006)

CYP314A1   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP314A1   Plutella xylostella 
           Gene number CCG011058.5
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           79% to CYP314A1 Manduca sexta

CYP314A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph314, 51% to 314A1 Apis
            ortholog to shd shade
            Pediculus genome site

CYP314A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP314A1    Daphnia magna (water flea)
            GenEMBL AB257771
            Yoshinori Ikenaka
            Submitted to nomenclature committee 8/28/06
            CYP family-1, full length sequence
            41% to Cyp314a1 Drosophila, 40% to Apis CYP314A1
            probable ortholog so the same subfamily name is used

CYP314A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig11074 414aa 
           58% TO CYP314A1 aphid, in the mito clan

CYP314A1a  Acyrthosiphon pisum (pea aphid)
           LOC100167431 SCAFFOLD4030:67656..77815 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           45% to CYP314A1 Manduca sexta
           mito clan

CYP314A1b  Acyrthosiphon pisum (pea aphid)
           LOC100165833 SCAFFOLD10596 coords:34935-48215 (+) strand
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           94% to CYP314A1a aphid, 66% to CYP314A2 aphid
           44% to CYP314A1 Manduca sexta
           a recent gene duplication may include some flanking genes as well
           mito clan

CYP314A1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            54% to CYP314A1 Tribolium castaneum
            clone name DPO1117_G11

CYP314A1   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf48 and sf64 two pieces probably from the same gene
           ~60% to CYP314A1 aphid (partial sequence)

CYP314A    Sogatella frucifera (white-backed plant hopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           Complete seq. 95% to CYP314A1 Laodelphax striatellus
CYP314A1    Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

CYP314A1   Tetranychus urticae (two-spotted spider mite, arachnid)

CYP314A1   Daphnia pulex (water flea)

CYP314A2   Acyrthosiphon pisum (pea aphid)
           LOC100169172   SCAFFOLD543:7676..15068 (+ strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           40% to CYP314A1 Manduca sexta
           mito clan

Cyp315a1    Drosophila melanogaster
            GenEMBL AC015141 229-2538 also AC008307 AC007725 AC007648
            shadow sad gene

Cyp315a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser
            shadow sad gene

CYP315A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs1x1
            Note: in Drosophila Cyp315a1 is the shadow gene (sad), a C2 hydroxylase 
            in the ecdysteroid biosynthetic pathway from cholesterol
            Ortholog of shadow sad gene

CYP315A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            38% to 315A1 Drosophila.  Note this sequence is 
            named in the same subfamily as other CYP315s since 
            there seems to be only one orthologous sequence per
            species and it does not make sense to name orthologs with 
            different subfamily names.
            Ortholog of shadow sad gene

CYP315A1   Linepithema humile (argentine ant)
           No accession number
CYP315A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           60% to CYP315A1 Linepithema humile

CYP315A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           62% to CYP315A1 Linepithema humile

CYP315A1    Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            68% to CYP315A1 Linepithema humile

CYP315A1    Bombyx mori (silkworm)
            AB167737 BAAB01119643.1
            Niwa,R., Matsuda,T., Yoshiyama,T., Namiki,T., Mita,K., Fujimoto,Y.
            and Kataoka,H.
            CYP306A1, a cytochrome P450 enzyme, is essential for ecdysteroid
            biosynthesis in the prothoracic glands of Bombyx and Drosophila
            J. Biol. Chem. (2004) In press
            probable ortholog
            See silkworm page for sequence
            Ortholog of shadow sad gene

CYP315A1    Manduca sexta (tobacco hornworm)
            GenEMBL DQ357068
            Rewitz,K.F., Rybczynski,R., Warren,J.T. and Gilbert,L.I.
            Identification, characterization and developmental expression of
            Halloween genes encoding P450 enzymes mediating ecdysone
            biosynthesis in the tobacco hornworm, Manduca sexta
            Insect Biochem. Mol. Biol. 36 (3), 188-199 (2006)

CYP315A1   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP315A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970122
           41% to 315A1 Drosophila
           Ortholog of shadow sad gene

CYP315A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Nov. 22, 2011
           Complete seq. 49% to CYP315A1 Tribolium castaneum

CYP315A1v1  Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            50% to CYP315A1 Tribolium castaneum

CYP315A1v2  Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            3 aa diffs and a 5 aa deletion compared 
            to CYP315A1v1  Dentroctonus ponderosae

CYP315A1    Aedes aegypti (yellow fever mosquito)

CYP315A1   Culex pipiens

CYP315A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP315A1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           68% to CYP315A1 Trialeurodes vaporariourum (whitefly)

CYP315A1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           sad 2-hydroxylase
           mito clan

CYP315A1    Trialeurodes vaporariourum (whitefly)

CYP315A1   Laodephgax striatellus (small brown planthopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee June 22, 2011
           Clone name scaffold29888 
           39% to CYP315A1 Maduca sexta N-term 
           Missing C-term
           top hits are all CYP315A1, presumed ortholog
           note: species corrected from Sogatella frucifera

CYP315A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 6, 2011
           Missing C-term

CYP315A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           40% to CYP315A1 Tribolium castaneum

CYP315A1a   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            N-term part 91% to CYP315A1 Laodelphax striatellus
CYP315A1b   Sogatella frucifera (white-backed plant hopper)
            No accession number
            Jia Shuang
            Submitted to nomenclature committee Dec. 26, 2011
            C-term part 40% to CYP315A1 Tribolium
CYP315A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

CYP315A1   Tetranychus urticae (two-spotted spider mite, arachnid)

CYP315A1   Daphnia pulex (water flea)

CYP315A1   Chironomus tentans (aquatic midge)
           No accession number
           Kun Yan Zhu
           Submitted to nomenclature committee May 31, 2011
           46% to CYP315A1 Aedes aegypti, top 14 hits are all CYP315A1

Cyp316a1    Drosophila melanogaster
            GenEMBL AC017388 35538-37158 also AC010113 AC010557 AC010112

Cyp316a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

Cyp317a1    Drosophila melanogaster
            GenEMBL AC020477 126550-128106 no introns also AC009844 AL109349

Cyp317a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP317A2    Lucilia cuprina (Australian blowfly)
            No accession number 
            Zhenzhong Chen
            Submitted to nomenclature committee Dec. 18, 2007
            clone name Luce0114D11 
            47% identical to Dm Cyp317a1 probable ortholog

CYP317B1    Bactrocera dorsalis (Oriental fruit fly) 
            No accession number
            Yong Huang
            submitted to nomenclature committee Sept. 13, 2012
            49% to CYP317A2 Lucilia cuprina
            45% to Cyp317a1  Drosophila melanogaster
            clone name 2111

Cyp318a1    Drosophila melanogaster
            GenEMBL AC014186 comp(968-207) AA803931 AA803220 AA821188 N-terminal 
            AC019897 comp(2937-4007) C-terminal half

Cyp318a1    Drosophila pseudoobscura
            See D. pseudoobscura page on this server for sequence
            Obtained from UC Santa Cruz Browser

CYP319A1    Boophilus microplus (cattle tick)
            No accession number
            Haiqi He
            Submitted to nomenclature committee March 29, 2000

CYP319A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP319A7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

CYP320A1    snail
            No accession number
            Anne Lockyer
            C-terminal is 36% to 304a1 35% to rabbit 2E1
            Submitted to nomenclature committee Aug. 29, 2000

CYP321A1    Helicoverpa zea (earworm)
            No accession number
            Masataka Sasabe, Xianchun Li, May Berenbaum, and Mary Schuler
            Submitted to nomenclature committee June 15, 2001
            Clone name X14
            33% to CYP6B2

CYP321A1    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee July 17, 2007
            ortholog to H. zea 96%, 68% to 321A2

CYP321A2    Helicoverpa zea (corn earworm)
            No accession 
            Xianchun Li
            Submitted to nomenclature committee Oct. 3, 2005
            clone name: 321DL6-4
            67% to 321A1

CYP321A2    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee July 17, 2007
            97% to 321A2 H. zea, probable ortholog, 67% to 321A1

CYP321A3    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee July 17, 2007
            67% to 321A2 H. zea, 92% TO 321A1 H. armigera

CYP321A4    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee July 17, 2007
            66% to 321A2 H. zea, 67% w/o this seq
            95% to CYP321A1 H. armigera

CYP321A5    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH000216 100% to HAH013481 97% to CYP321A3, 94% to CYP321A1
            This might be CYP321A3v2

CYP321A6    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_212 94% to HAH000216 N-term region, 
            probably not the same gene
            97% to CYP321A3, This might be CYP321A3v3

CYP321A7    Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Nov. 21, 2008
            Clone name Sf321like-gp1
            65% to CYP321A2, 67% to 321A5, 67% to 321A3

CYP321A8    Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Nov. 21, 2008
            Clone name Sf321like-a
            66% to CYP321A2, 66% to 321A5, 66% to 321A1

CYP321A9    Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Nov. 21, 2008
            Clone name Sf321like-b
            64% to CYP321A2, 81% to 321A7,
            78% to CYP321A8, 67% to 321A1

CYP321A9    Spodoptera litura (a moth)
            Zihbin Xu, Sichun Zheng, Qili Feng
            submitted to nomenclature committee April 19, 2011
            96% to CYP321A9 Spodoptera frugiperda

CYP321A10   Spodoptera frugiperda (a moth)
            Rene Feyereisen
            Submitted to nomenclature committee Aug. 1, 2011
            81% CYP321A9 Spodoptera frugiperda

CYP321A11  Spodoptera littoralis (cotton leafworm)
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           88% to CYP321A9 Spodoptera frugiperda

CYP321A12  Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           93% to CYP321A9 Spodoptera frugiperda

CYP321A13  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP321B1    Spodoptera litura (a moth)
            66% to CYP321B1 Helicoverpa armigera

CYP321B1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_148 49% to CYP321A1, 46% TO CYP321A2
            HAH001868 4 aa diffs to Contig_148

CYP321B1    Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Aug. 1, 2011
            88% CYP321B1 Spodoptera litura
            64% to CYP321B1 Helicoverpa armigera
            presumed ortholog

CYP321C1    Amyelois transitella (Navel orangeworm)
            No accession number 
            Guodong Niu
            submitted to nomenclature committee May 27, 2008
            clone AL34-1
            53% to CYP321A1, less to the other CYP321As, 50% to CYP321B1

CYP321C2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            56% to CYP321C1 Amyelois transitella

CYP321D1   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP321E1   Plutella xylostella 
           Gene number CCG013958.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           48% to CYP321A8 Spodoptera frugiperda

CYP322A1   Perna canaliculus (New Zealand green lipped mussel) 
           No accession number
           Karl Herron
           Submitted to nomenclature committee Oct. 9, 2001
           47% to 4F12 partial seq. from I-helix to heme
           placement uncertain may be in the CYP4 family but 
           clusters outside the 4 family in some trees

CYP323A1   Saccostrea glomerata (Sydney rock oyster)
           No accession number
           Karl Herron
           Submitted to nomenclature committee Oct. 9, 2001
           41% to 4Y1 partial seq. from I-helix to heme

CYP324A1X  Trichoplusia ni Family: Noctuidae (caterpillar)
           Renamed CYP324A6
           No accession number
           Ping Wang
           Submitted to nomenclature committee May 20, 2002 
           32% to 6K1 33% to 6G1 (sequence 3)
           70% to CYP324A6 Helicoverpa armigera
           67% to CYP324A6 Spodoptera littoralis

CYP324A1X   Bombyx mori (silkworm)
            Renamed CYP324A8
            BAAB01098782.1 BAAB01016062.1
            BAAB01088903.1 BAAB01068119.1 BAAB01136435.1
            45% to 324A6 Trichoplusia ni 
            See silkworm page for sequence

CYP324A1X   Heliconius melpomene (common postman butterfly)
            Renamed CYP324A9
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            48% to CYP324A1 Helicoverpa armigera

CYP324A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_234 52% to CYP324A6 Trichoplusia ni 
            Contig_219 1 aa diff to Contig_234

CYP324A1   Helicoverpa armigera
           No accession number
           Rene Feyereisen
           Submitted to nomenclature committee May 2, 2013 
           Scaffold 343-1.33
           97% to CYP324A1 Helicoverpa armigera (from Heiko Vogel)

CYP324A1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           74% to CYP324A1 Helicoverpa armigera

CYP324A2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            51% to CYP324A1 Helicoverpa armigera

CYP324A3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            52% to CYP324A1 Helicoverpa armigera

CYP324A4    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            68% to CYP324A3 Heliconius melpomene

CYP324A5    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            65% to CYP324A3 Heliconius melpomene

CYP324A6   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           67% to CYP324A1 Trichoplusia ni

CYP324A6   Trichoplusia ni Family: Noctuidae (caterpillar)
           Formerly CYP324A1
           No accession number
           Ping Wang
           Submitted to nomenclature committee May 20, 2002 
           32% to 6K1 33% to 6G1 (sequence 3)
           70% to CYP324A6 Helicoverpa armigera
           67% to CYP324A6 Spodoptera littoralis

CYP324A6   Helicoverpa armigera
           No accession number
           Rene Feyereisen
           Submitted to nomenclature committee May 2, 2013 
           Scaffold 343-0.27a
           73% to CYP324A6 Spodoptera littoralis (cotton leafworm)
           70% to CYP324A6 Trichoplusia ni (probable ortholog)

CYP324A7   Helicoverpa armigera
           No accession number
           Rene Feyereisen
           Submitted to nomenclature committee May 2, 2013 
           Scaffold 343-0.27a
           92% to CYP324A1 Helicoverpa armigera (from Heiko Vogel)
           93% to CYP324A1 H. armigera scaffold 343-1.33

CYP324A8    Bombyx mori (silkworm)
            Formerly CYP324A1 but probably not an ortholog
            BAAB01098782.1 BAAB01016062.1
            BAAB01088903.1 BAAB01068119.1 BAAB01136435.1
            52% to CYP324A1 Helicoverpa armigera
            45% to CYP324A6 Trichoplusia ni 
            See silkworm page for sequence

CYP324A9    Heliconius melpomene (common postman butterfly)
            Formerly CYP324A1 but probably not an ortholog
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            53% to CYP324A3 Heliconius melpomene
            48% to CYP324A1 Helicoverpa armigera

CYP324A10   Amyelois transitella (navel orangeworm)

CYP324A11   Amyelois transitella (navel orangeworm)

CYP324A12   Chilo supressalis (striped rice stem borer)

CYP325A1    Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            94% to 325A2

CYP325A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r14

CYP325A2    Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            94% to 325A1

CYP325A2    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r12

CYP325A3    Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            89% to 325A1

CYP325A3    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r11

CYP325B1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r13

CYP325C1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r10
            Formerly named CYP327A1

CYP325C2    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r7

CYP325C3    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs3r3

CYP325D1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r9

CYP325D2    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r6

CYP325E1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r5

CYP325E2P   Aedes aegypti (yellow fever mosquito)

CYP325E3    Aedes aegypti (yellow fever mosquito)

CYP325E3    Culex pipiens

CYP325E4P   Culex pipiens

CYP325F1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r3
            Formerly named CYP326A1

CYP325F2    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r1
            Formerly named CYP326A2

CYP325G1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPd2r2

CYP325G2    Aedes aegypti (yellow fever mosquito)

CYP325G3    Aedes aegypti (yellow fever mosquito)

CYP325G4    Culex pipiens

CYP325H1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r2

CYP325J1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r1

CYP325K1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r4

CYP325K2    Aedes aegypti (yellow fever mosquito)

CYP325K3    Aedes aegypti (yellow fever mosquito)

CYP325K3v1  Culex pipiens

CYP325K3v2  Culex pipiens

CYP325L1v1  Aedes aegypti (yellow fever mosquito)

CYP325L1v2  Aedes aegypti (yellow fever mosquito)

CYP325L2    Culex pipiens

CYP325M1    Aedes aegypti (yellow fever mosquito)

CYP325M2    Aedes aegypti (yellow fever mosquito)

CYP325M3    Aedes aegypti (yellow fever mosquito)

CYP325M4    Aedes aegypti (yellow fever mosquito)

CYP325M5    Aedes aegypti (yellow fever mosquito)

CYP325N1    Aedes aegypti (yellow fever mosquito)

CYP325N2    Aedes aegypti (yellow fever mosquito)

CYP325N3v1  Culex pipiens

CYP325N3v2  Culex pipiens

CYP325P1    Aedes aegypti (yellow fever mosquito)

CYP325Q1    Aedes aegypti (yellow fever mosquito)

CYP325Q2    Aedes aegypti (yellow fever mosquito)

CYP325R1    Aedes aegypti (yellow fever mosquito)

CYP325S1    Aedes aegypti (yellow fever mosquito)

CYP325S2    Aedes aegypti (yellow fever mosquito)

CYP325S3    Aedes aegypti (yellow fever mosquito)

CYP325T1    Aedes aegypti (yellow fever mosquito)

CYP325T2    Aedes aegypti (yellow fever mosquito)

CYP325U1    Aedes aegypti (yellow fever mosquito)

CYP325V1    Aedes aegypti (yellow fever mosquito)

CYP325V2    Culex pipiens

CYP325V3    Culex pipiens

CYP325V4    Culex pipiens

CYP325V5v1  Culex pipiens

CYP325V5v2  Culex pipiens

CYP325W1    Aedes aegypti (yellow fever mosquito)

CYP325X1    Aedes aegypti (yellow fever mosquito)

CYP325X2    Aedes aegypti (yellow fever mosquito)

CYP325X3P   Aedes aegypti (yellow fever mosquito)

CYP325X4    Aedes aegypti (yellow fever mosquito)

CYP325X5P   Culex pipiens

CYP325X6    Culex pipiens

CYP325X7    Culex pipiens

CYP325X8P   Culex pipiens

CYP325X9    Culex pipiens

CYP325Y1    Aedes aegypti (yellow fever mosquito)

CYP325Y2v1  Aedes aegypti (yellow fever mosquito)

CYP325Y2v2  Aedes aegypti (yellow fever mosquito)

CYP325Y3    Aedes aegypti (yellow fever mosquito)

CYP325Y4    Culex pipiens

CYP325Y5    Culex pipiens

CYP325Y6    Culex pipiens

CYP325Y7    Culex pipiens

CYP325Y8    Culex pipiens

CYP325Y9    Culex pipiens

CYP325Y10   Culex pipiens

CYP325Z1    Aedes aegypti (yellow fever mosquito)

CYP325Z2    Culex pipiens

CYP325Z2-de2b3b  Culex pipiens

CYP325AA1   Aedes aegypti (yellow fever mosquito)

CYP325AA2   Culex pipiens

CYP325AB1   Culex pipiens

CYP325BB1   Culex pipiens

CYP325BB2   Culex pipiens

CYP325BC1   Culex pipiens

CYP325BC2   Culex pipiens

CYP325BD1   Culex pipiens

CYP325BE1   Culex pipiens

CYP325BF1v1 Culex pipiens

CYP325BF1v2 Culex pipiens

CYP325BF1-de1b  Culex pipiens

CYP325BG1   Culex pipiens

CYP325BG2P  Culex pipiens

CYP325BG3   Culex pipiens

CYP325BH1   Culex pipiens

CYP325BJ1   Culex pipiens

CYP325BK1   Culex pipiens

CYP325BK2   Culex pipiens

CYP325BL1   Culex pipiens

CYP325BM1   Culex pipiens

CYP325BN1   Culex pipiens

CYP326A1X   Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            80% to 326A2
            retired number renamed CYP325F1

CYP326A2X   Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            80% to 326A1
            retired number renamed CYP325F2

CYP327A1X   Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            retired number renamed CYP325C1

CYP328A1X   Anopheles gambiae (mosquito)
            no accession number
            Rene Feyereisen
            submitted to nomenclature committee 7/5/02
            low 30% range to all drosophila not CYP4, 6 or 9
            retired number renamed CYP325H1

CYP329A1    Anopheles gambiae (malaria mosquito)
            Submitted by Christelle Abgrall, Hilary Ranson and Rene Feyereisen
            See the paper: Evolution of supergene families associated with 
            insecticide resistance.
            Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J.
            Sharakhova, M.V., Unger, M.F., Collins, F.H. and Feyereisen, R.
            Science 298, 179-181 (2002)
            Anopheles map name CYPs2r5

CYP329B1    Aedes aegypti (yellow fever mosquito)

CYP329B1    Culex pipiens

CYP330A1    Carcinus maenas (shore crab) 
            GenENMBL AY328466
            Kim Rewitz
            submitted to nomenclature committee 6/18/2003
            37% to 2J2

CYP331A1    Capitella capitata (polychaete worm)
            No accession number
            Bo Li
            submitted to nomenclature committee 2/3/2004
            most similar to CYP5 and CYP3 sequences (low 30% range)
            in the CYP3 clan

CYP332A1    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee June 13, 2007
            3 aa diffs to HaCypZ004a-v2Pep CYP332A1v1 Helicoverpa armigera, 
            64% to 332A1 silkworm

CYP332A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_202 100% to CYP332A1 from Rene Feyereisen
            Contig_203 1 aa diff to Contig_202
            Contig_204 contains duplication, 1 aa diff to Contig_202, 
            2 aa diffs to Contig_203
            HARM_contig_1 contains duplication

CYP332A1v1  Helicoverpa armigera (cotton bollworm)
            No accession number
            Vladimir Grubor
            submitted to nomenclature committee 12/30/2003
            33% to members of CYP6, in the CYP3 clan
            505 aa seq #1 HaCypZ004a-v2Pep

CYP332A1v2  Helicoverpa armigera (cotton bollworm)
            No accession number
            David G. Heckel 
            submitted to nomenclature committee Feb. 21, 2005
            1 amino acid difference with CYP332A1v1

CYP332A1    Spodoptera frugiperda (the fall armyworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee June 22, 2007
            77% to 332A1 H. armigera, 70% to 332A2 H. armigera, 
            64% to 332A1 Bombyx, probable ortholog

CYP332A1    Spodoptera frugiperda (the fall armyworm)
            ESTs DV078358.1, FP381982.1

CYP332A1    Bombyx mori (silkworm)
            ESTs CK502566 CK518690 CK526599 CK522682 
            BAAB01119140.1 BAAB01018054.1 BAAB01100160.1 BAAB01098663.1
            64% to CYP332A1 probable ortholog
            See silkworm page for sequence

CYP332A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            58% to CYP332A4 Manduca sexta

CYP332A1    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            95% to CYP332A1 Heliothis virescens

CYP332A1    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011

CYP332A1    Heliothis virescens (tobacco budworm)
            85% to CYP332A1 Helicoverpa armigera
            ESTs GT055981.1 GT129546.1

CYP332A1   Trichoplusia ni 
           EST FF376408.1
           69% to CYP332A1 Helicoverpa armigera

CYP332A2    Helicoverpa armigera (Australian cotton bollworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee June 13, 2007
            71% to CYP332A1v2 Helicoverpa armigera 
            58% TO 332A1 silkworm

CYP332A2    Helicoverpa armigera (Australian cotton bollworm)
            FP340428.1 (BAC clone)
83113 FTIK 83102

CYP332A2    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            89% to CYP332A2 Helicoverpa armigera

CYP332A2    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            85% to CYP332A2 Helicoverpa armigera

CYP332A3   Zygaena filipendulae (zygaenid moth, Lepidoptera)
           No accession number
           Mika Zagrobelny Larsen
           Submitted to nomenclature committee Feb. 4, 2009
           Clone name Zygae_P450-3 
           55% to CYP332A1 Bombyx mori

CYP332A4   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP332A5   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP332A6   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP333A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Vladimir Grubor
            submitted to nomenclature committee 12/30/2003
            38% to members of CYP12, in the mitochondrial clan
            243 aa seq #6 HaCypZ009a-v2Pep
            note: seq. Revised, 95% identical to older version

CYP333A1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_213 58% to CYP333A2, 45% to CYP333B2
            Note: this sequence overlaps with Grubors seq by 10 aa
            Together they form a complete P450 sequence
            HAH003861 100% to Contig_213
            HAH003861_2 100% to Contig_213
            Contig_244 100% to HAH003861

CYP333A1    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            87% to CYP333A1 Helicoverpa armigera

CYP333A1    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            84% to CYP333A1 Helicoverpa armigera

CYP333A2    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP333A3   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP333A4    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            65% to CYP333A3 Manduca sexta

CYP333A5   Plutella xylostella 
           Gene number CCG007344.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           61% to CYP333A1   Heliothis virescens
           missing the N-term 32 aa

CYP333A6   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           72% to CYP333A1 Heliothis virescens

CYP333A7   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP333B1    Bombyx mori
            AADK01000081.1, AADK01010165.1, EST BJ985225.1
            39% to 12B2 mito BAAB01158176.1 BAAB01035519.1
            BAAB01083643.1 BAAB01120305.1 39% to 49A1 39% to 12F2
            47% to CYP333A1 75% to combined (BAAB01158865.1 + BAAB01136746)
            N-terminal is upstream of a repeat seq.  I cannot identify it.
            Bmb006234 from Li Bin

CYP333B2    Bombyx mori
            BAAB01158865.1 AADK01000081.1 BAAB01179470 BAAB01136746.1
            whole seq 61% to 333B1
4119 KEYNILGYHVPKG 4081 (0)

CYP333B3    Spodoptera frugiperda (the fall armyworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee June 22, 2007
            50% to CYP333A1 C-term fragment from H. armigera, 
            85% to 333B3 H. armigera EST, 74% to CYP333B4, 

CYP333B3   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           91% to CYP333B3 Spodoptera frugiperda (probable ortholog)

CYP333B3    Helicoverpa armigera (cotton bollworm)
            EST E399501 
            85% to CYP333B3 Sf-41I04-Ekg, probable ortholog
            82% to CYP333B4 Sf-41I04-Dkg

CYP333B3 frag. Helicoverpa armigera (cotton bollworm)
            Same as EST EE399501
            Vladimir Grubor
            submitted to nomenclature committee 12/30/2003
            55% to CYP333A1, in the mitochondrial clan
            92 aa, seq #15, HaCypZ015a-v1Pep
            two frameshifts in EST shown below

CYP333B3    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH004245 77% to CYP333B1, 100% to CYP333B3

CYP333B3    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            93% to CYP333B3 Helicoverpa armigera

CYP333B4    Spodoptera frugiperda (the fall armyworm)
            No accession number
            Rene Feyereisen
            submitted to nomenclature committee June 22, 2007
            45% to CYP333A1, 82% to CYP333B3, 36% to Cyp12f2 Anopheles

CYP333B5  Plodia interpunctella (Indianmeal moth, Lepidoptera) 
          EB823285.1 cDNA clone N-term, 
          51% to CYP333B1
602  NNMLKSNLT  628

CYP333B6    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_182 53% to CYP333B1 mito clan, 54% to CYP333B4
            HAH004275 100% to Contig_182
            Contig_183 3 aa diffs to Contig_182

CYP333B7    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_280 95% to contig_182, 54% to CYP333B1 mito clan

CYP333B8   Zygaena filipendulae (zygaenid moth, Lepidoptera)
           No accession number
           Mika Zagrobelny Larsen
           Submitted to nomenclature committee Feb. 4, 2009
           Clone name Zygae_4757 
           Mitochondrial, 56% to CYP333B2 Bombyx, 55% to 333B1 Bombyx

CYP333B9   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP333B10  Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP333B11  Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP333B12  Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP333B13   Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            65% to CYP333B11 Manduca sexta

CYP333B14   Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            62% to CYP333B13 Heliconius melpomene

CYP333B15  Plutella xylostella 
           Gene number CCG007344.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           61% to CYP333A1   Heliothis virescens

CYP333B16  Plutella xylostella 
           Gene number CCG007339.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           60% to CCG007338.1 CYP333B15

CYP333B17  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP333B18  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP334A1    Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            34% to 12A5 Drosophila.  In the mitochondrial clan

CYP334A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           62% to CYP334A1 Apis mellifera

CYP334A1    Pogonomyrmex barbatus (seed-harvester ant)
            See Pogonomyrmex page
            Reed Johnson 
            Submitted to nomenclature committee June 3, 2010
            63% to CYP334A1 Apis mellifera

CYP334A1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP334B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_971083, protein , AAJJ01000115.1 genomic
           30% to 301A1 Drosophila, 30% to CYP301A1 Tribolium
           42% to 334A1 bee

CYP334C1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph334-2, 41% to  334B1 Tribolium, 41% to CYP334D1P
            Pediculus genome site

CYP334D1P   Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph334-1P, 34% to 334B1 Tribolium, 32% to 334A1 Apis, 41% to CYP334C1
            Pediculus genome site

CYP334E1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            50% to CYP334B1 Tribolium castaneum
            clone name DPO011_J18

CYP334E2    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            50% to CYP334B1 Tribolium castaneum
            clone name DPO021_D04

CYP334E3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 6
           57% to CYP334E1 Dendroctonus ponderosae
           N-term to PKG

CYP335A1X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            40% to Cyp9f2 Drosophila melanogaster. 50% to 9J8 partial seq.
            63% to CYP9P2
            renamed CYP9P1

CYP335A2X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            40% to CYP9K1 Drosophila melanogaster. 54% to 9J7 partial seq.
            63% to CYP9P1
            renamed CYP9P2

CYP335B1X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            39% to CYP9E 42% to 335A1 
            57% to CYP9Q2
            renamed CYP9Q1

CYP335B2X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            57% to CYP9Q1
            renamed CYP9Q2

CYP335B3X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            58% to CYP9Q2
            renamed CYP9Q3

CYP335C1X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            44% to CYP9Q2
            renamed CYP9R1

CYP335D1X   Apis mellifera (honeybee)
            WGS section genbank
            Submitted by May Berenbaum 2/11/04
            49% to CYP9R1
            renamed CYP9S1

CYP336A1    Apis mellifera (honeybee)
            WGS section genbank
            EST BI946448
            Submitted by May Berenbaum 2/11/04
            34% to CYP6AH1

CYP336A2P  Linepithema humile (argentine ant)
           No accession number
CYP336A3P  Linepithema humile (argentine ant)
           No accession number
CYP336A4   Linepithema humile (argentine ant)
           No accession number
CYP336A5   Linepithema humile (argentine ant)
           No accession number
CYP336A6   Linepithema humile (argentine ant)
           No accession number
CYP336A7   Linepithema humile (argentine ant)
           No accession number
CYP336A8   Linepithema humile (argentine ant)
           No accession number
CYP336A9   Linepithema humile (argentine ant)
           No accession number
CYP336A10P  Linepithema humile (argentine ant)
           No accession number
CYP336A11P  Linepithema humile (argentine ant)
           No accession number
CYP336A12P  Linepithema humile (argentine ant)
           No accession number
CYP336A13  Linepithema humile (argentine ant)
           No accession number
CYP336A14P  Linepithema humile (argentine ant)
           No accession number
CYP336A15  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           68% to CYP336A8 Linepithema humile

CYP336A16  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           62% to CYP336A5 Linepithema humile

CYP336A17  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           63% to CYP336A4 Linepithema humile

CYP336A18P Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           61% to CYP336A4 Linepithema humile

CYP336A19  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           66% to CYP336A8 Linepithema humile

CYP336A20  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           60% to CYP336A5 Linepithema humile

CYP336A21  Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           70% to CYP336A7 Linepithema humile

CYP336B1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP336C1   Nasonia vitripennis (jewel wasp)
           See wasp page

CYP336D1   Nasonia vitripennis (jewel wasp)
           See wasp page, formerly CYP336-un1

CYP337A1    Bombyx mori (silkworm)
            BAAB01181176.1 BAAB01007828.1 BAAB01049389.1
            60% to 337A2 29% TO 6A21 30% to 6P3 36% to CYP321A1
            See silkworm page for sequence

CYP337A2    Bombyx mori (silkworm)
            BAAB01100580.1 BAAB01137171.1 BP123442 EST
            60% to 337A1 31% TO CYP6as 35% to CYP6AB1 37% to CYP321A1
            See silkworm page for sequence

CYP337A3   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP337B1v1  Helicoverpa armigera (cotton bollworm)
            No accession number
            Vladimir Grubor
            submitted to nomenclature committee Dec. 30, 2003
            51% to 6P5 (58/113aa), C-term frag. 144 aa 
            seq #8 HaCypZ011a-v2Pep, also called CYP337B1-a
            formerly CYP6AP1 54% (76/140aa) to 337A1 over a longer range
            this partial sequence clusters with CYP337A1 and A2 on trees.
            Note revised sequence 2/21/05 is complete 50% to 337A1

CYP337B1v2  Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_180 has 3 aa diffs to HAH000584 and 4 aa diffs to CYP337B1v1, 
            50% to CYP337A1 N-term
            Contig_151 part of it has 2 aa diffs to Contig_180, 
            part = 100% to HAH011223
            Contig_214 100% to Contig_151

CYP337B1v3  Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            2 aa diffs to CYP337B1v2

CYP337B1v4  Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            7 aa diffs to CYP337B1v1 and CYP337B1v3

CYP337B2v1  Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            seq. s3-a
            2 aa diffs to CYP337B2v2, 6 aa diffs to CYP337B2v3
            75% to CYP337B1v4

CYP337B2v2  Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            seq. s3-c
            2 aa diffs to CYP337B2v1

CYP337B2v3  Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            seq. s3-b
            5 aa diffs to CYP337B2v2

CYP337B3    Helicoverpa armigera (cotton bollworm)
            No accession number
            David Heckel
            submitted to nomenclature committee Oct. 25, 2011
            seq. s2, a natuarrly occuring hybrid seq between
            CYP337B1 and CYP337B2
            Aa 171-end has only 1 aa diff to CYP337B1v1
            The fist 189 aa have only 1 aa diff to CYP337B2v3

CYP337B4   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP337C1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            51% to CYP337B1 Helicoverpa armigera

CYP337C2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            95% to CYP337C1 Heliconius melpomene

CYP337C3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            90% to CYP337C4 Heliconius melpomene

CYP337C4    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            90% to CYP337C3 Heliconius melpomene

CYP337C5    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            83% to CYP337C1 Heliconius melpomene

CYP338A1    Bombyx mori (silkworm)
            See silkworm page for sequence

CYP338A1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           60% to CYP338A1 Bombyx mori
           renamed as the ortholog, formerly CYP338A2

CYP338A1   Amyelois transitella (navel orangeworm)

CYP338A1   Helicoverpa armigera (cotton bollworm)

CYP338A1   Chilo supressalis (striped rice stem borer)

CYP338B1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            45% to CYP338A1 Bombyx mori

CYP338C1   Plutella xylostella 
           Gene number CCG009572.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           49% to CYP338A1 Bombyx mori
           37% to CYP338B1 Heliconius melpomene

CYP339A1    Bombyx mori (silkworm)
            CK534983 CK537464 CK535691  BAAB01021114.1 31% to 301A1 anoph. 
            BAAB01141557 BAAB01170021.1 BAAB01154229
            See silkworm page for sequence

CYP339A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            61% to CYP339A1 Bombyx mori
            renamed as the ortholog, formerly CYP339A2

CYP339A1    Plutella xylostella
            renamed as the ortholog, formerly CYP339A3

CYP340A1    Bombyx mori (silkworm)
            Many seqs but chromosome order and assembly incomplete
            See silkworm page for sequence

CYP340A1-de9b   Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340A2    Bombyx mori (silkworm)
            Many seqs but chromosome order and assembly incomplete
            See silkworm page for sequence

CYP340A2-de9b  Bombyx mori (silkworm)
            nscaf2330 1296468-1296620 (-)

CYP340A3    Bombyx mori (silkworm)
            Many seqs but chromosome order and assembly incomplete
            See silkworm page for sequence

CYP340A4    Bombyx mori (silkworm)
            Many seqs but chromosome order and assembly incomplete
            See silkworm page for sequence

CYP340A5P   Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340A6    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340B1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340C1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340D1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340E1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340F1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP340G1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_181 44% to CYP340A3, 42% to CYP340A4, 44% to CYP340D1, 
            29% to CYP4L5
            HAH015944 100% to Contig_181

CYP340H1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH012927 40% to CYP340A4, 32% to CYP4V2 danio
            Contig_250 100% to HAH012927
            Contig_222 after aa 52 is 100% to Contig_250 
            The first 52 aa is only 72% to Contig_250 
            (hybrid or alternative splice?)

CYP340H2    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH010140 56% to CYP340H1, 36% TO CYP340A2, 28% to CYP4G11

CYP340J1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH001912 40% to CYP340H1, 38% to HAH010140, 
            36% TO CYP340A3, 29% to CYP4L5

CYP340K1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_189 this one has the correct C-term 44% to CYP340G1, 
            42% to CYP340F1, 36% to CYP340A4, 28% to CYP4M6, 30% to CYP4V2
            HAH015382 100% to Contig_189 except at the ends 
            (retained intron in HAH015382?)

CYP340K2    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            72% to CYP340K1 Helicoverpa armigera

CYP340K3    Heliothis virescens (tobacco budworm)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            72% to CYP340K1 Helicoverpa armigera

CYP340K4   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           52% to CYP340K1 Helicoverpa armigera

CYP340L1    Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Nov. 21, 2008
            44% to CYP340H1, 41% to CYP340A4
            40% to CYP340J1 (N-term half), 38% to CYP340A2, 

CYP340M1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details, formerly CYP340-un1

CYP340N1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            42% to CYP340G1 Helicoverpa armigera

CYP340P1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            43% to CYP340C1 Bombyx mori

CYP340Q1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            47% to CYP340D1 Bombyx mori

CYP340Q2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            77% to CYP340Q1 Heliconius melpomene

CYP340R1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            49% to CYP340D1 Bombyx mori

CYP340R2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            87% to CYP340R4 Heliconius melpomene

CYP340R3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            90% to CYP340R4 Heliconius melpomene

CYP340R4    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            87% to CYP340R2 Heliconius melpomene

CYP340R5    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            81% to CYP340R4 Heliconius melpomene

CYP340S1v1 Plutella xylostella 
           Gene number CCG002082.2a
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           46% to CCG010920.1
           43% to CYP340C1 Bombyx mori
           missing the C-term (see CCG002082.2b last line for a similar seq)

CYP340S1v2 Plutella xylostella 
           Gene number CCG013063.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           99% to CCG002082.2
           48% to CCG010920.1
           49% to CCG008537.1
           46% to CYP340C1 Bombyx mori
           missing N-term

CYP340T1   Plutella xylostella 
           Gene number CCG002082.2b
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           42% to CYP340C1 Bombyx mori

CYP340U1v1 Plutella xylostella 
           Gene number CCG007213.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           44% to CCG010920.1

CYP340U1v2 Plutella xylostella 
           Gene number CCG008532.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           99% to CCG007213.1

CYP340V1v1 Plutella xylostella 
           Gene number CCG000924.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           40% to CYP340C1
           missing the N-term 82 aa

CYP340V1v2 Plutella xylostella 
           Gene number CCG002776.1b
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           Second gene C-term half
           97% to CYP340V1v1

CYP340V2   Plutella xylostella 
           Gene number CCG002776.1a
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           Adjacent to CCG002776.1b

CYP340W1v1 Plutella xylostella 
           Gene number CCG008537.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
45% TO CCG010920.1
43% to CYP340C1 Bombyx mori

CYP340W1v2 Plutella xylostella 
           Gene number CCG004867.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
98% to CCG008537.1
42% to CYP340C1 Bombyx mori 

CYP340X1   Plutella xylostella 
           Gene number CCG006839.1a
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           48% to CCG002082.2
           41% to CYP340C1

CYP340X1-frag1   Plutella xylostella 
           Gene number CCG006839.1b
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           100%  TO CCG006839.1a, 92% (3 DIFFS) TO CCG006839.1C
           58% to CYP340G1 Helicoverpa armigera

CYP340X1-frag2   Plutella xylostella 
           Gene number CCG006839.1c
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           55% to CCG002083.1
           53% to CYP340A3 Bombyx mori 

CYP340Y1   Plutella xylostella 
           Gene number CCG002083.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           42% to CYP340C1

CYP340Z1   Plutella xylostella 
           Gene number CCG010920.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           41% to CYP340D1 Bombyx mori
           missing N-term 24 aa

CYP340AA1  Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           49% to CYP340H1 Helicoverpa armigera

CYP340AB1  Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           49% to CYP340L1 Spodoptera frugiperda

CYP340AC1  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP340AD1  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP340AE1  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP341A1    Bombyx mori (silkworm)
            BAAB01068196.1 BAAB01181661.1 BAAB01053162.1 
            BAAB01098630.1 BAAB01068157.1 BAAB01166031.1 BAAB01162916.1
            39% to 4C3 
            See silkworm page for sequence

CYP341A2    Papilio xuthus (swallowtail butterfly)
            No accesion number
            Hajime Ono
            Submitted to nomenclature committee Jan. 4, 2005
            61% to 341A1

CYP341A3    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341A4    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341A5    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341A6    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341A6-ie5b  Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341A7X   Bombyx mori (silkworm)
            No acession number
            See silkworm page for details
            Seems to be a chimera, not a true gene

CYP341A8    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            74% to CYP341A3 Bombyx mori

CYP341A9    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            86% to CYP341A10 Heliconius melpomene

CYP341A10   Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            86% to CYP341A9 Heliconius melpomene

CYP341A11   Spodoptera frugiperda (a moth)
            No accession number
            Rene Feyereisen
            Submitted to nomenclature committee Aug. 1, 2011
            70% CYP341A1 Bombyx mori

CYP341A12  Plutella xylostella 
           Gene number CCG013707.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           69% to CYP341A1 Bombyx mori

CYP341A13  Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           87% to CYP341A11 Spodoptera frugiperda

CYP341B1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341B2    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH001776 56% TO CYP341B1, 44% to CYP341A3 Bombyx, 
            32% to CYP4L5, 33% to CYP325G3

CYP341B3   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           73% to CYP341B2 Helicoverpa armigera

CYP341B4   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP341C1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP341D1    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            HAH014764 48% TO CYP341C1, 47% TO CYP341B1, 31% to CYP325G1

CYP341E1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            52% to CYP341B1 Bombyx mori

CYP341E2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            60% to CYP341E1 Heliconius melpomene

CYP341E3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011

CYP341F1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            43% to CYP341B1 Bombyx mori

CYP341G1   Plutella xylostella 
           Gene number CCG000631.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           46% to CYP341B1   Bombyx mori
           missing the N-term 55 aa

CYP341H1   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP341-un1  Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP342A1    Nereis virens (annelid polychaete worm, clamworm, sandworm)
            GenEMBL AY453408.1 (partial seq)
            Rewitz KF, Kjellerup C, Jorgensen A, Petersen C, Andersen O. 
            Identification of two Nereis virens (Annelida: Polychaeta)
            cytochromes P450 and induction by xenobiotics.
            Comp Biochem Physiol C Toxicol Pharmacol. 138, 89-96 2004.
            Clone name CYP4(2), CYP42 in abstract
            Submitted to nomenclature committee April 29, 2005 (full seq)
            Only 35% to CYP4BB1 from the same worm
            34% to Cyp4f14 mouse

CYP343A1    Apis mellifera

CYP343A1   Linepithema humile (argentine ant)
           No accession number
CYP343A1   Atta cephalotes (leafcutter ant)
           See Atta cephalotes page
           58% to CYP343A1 Apis mellifera

CYP343A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           83% to CYP343A1 Pogonomyrmex barbatus

CYP343A1   Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           57% to CYP343A1 Apis mellifera

CYP344A1    Hypsibius dujardini (water bear, Tardigrade)
            GenEMBL CO741715
            David Drane
            2clan 32% to 18A1
            N-term only 

CYP345A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970561, protein, AAJJ01001436 genomic
           88% to CYP345A2 Tribolium, CYP3 clan

CYP345A2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970633, protein, 
           AAJJ01001436 exon 1 only
           AAJJ01003559 exons 2-4
           88% to CYP345A1 Tribolium, CYP3 clan

CYP345B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970485, protein, AAJJ01001436 genomic
           45% to CYP345A2 Tribolium, CYP3 clan

CYP345C1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970418
           46% to CYP345B1 Tribolium, CYP3 clan

CYP345D1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_966774
           63% to CYP345D2 Tribolium, CYP3 clan

CYP345D2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_969536
           63% to CYP345D1 Tribolium, CYP3 clan

CYP345D3   Tribolium castaneum (red flour beetle)
           no accession number
           Jiang Hongbo
           submitted to nomenclature committee June 19, 2007
           91% to CYP345D1

CYP345E1   Dendroctonus ponderosae (mountain pine beetle, bark beetle)
           No accession number
           Christopher I. Keeling
           Submitted to nomenclature committee Oct. 21, 2009
           84% to DPO043_F01, 49% to CYP345A2
           42% to CYP6AT1 Cyp6Pd (antennae-rich 507aa Walter Leal scarab beetle
           clone name DPO012_M11

CYP345E2   Dendroctonus ponderosae (mountain pine beetle, bark beetle)
           No accession number
           Christopher I. Keeling
           Submitted to nomenclature committee Oct. 21, 2009
           84% to DPO012_M11, 50% to CYP345A2
           43% to CYP6AT1 Cyp6Pd (antennae-rich 507aa Walter Leal scarab beetle
           clone name DPO043_F01

CYP345E3    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            84% to CYP345E2 Dendroctonus ponderosae

CYP345F1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            42% to CYP345D1 Tribolium castaneum
            40% to CYP345A1
            clone name DPO1126_E15

CYP345F2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP3 clan
           Clone name seq 9
           59% to CYP345F1 Dendroctonus ponderosae
CYP345F3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           62% to CYP345F1 Dendroctonus ponderosae
           partial seq.

CYP345G1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011

CYP345G2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           83% to CYP345G1 Leptinotarsa decemlineata
           partial seq.

CYP345H1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           47% to CYP345A2 Tribolium
           nearly complete seq.

CYP345H2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           64% to CYP345H1 Leptinotarsa decemlineata
           partial seq.

CYP345J1   Rhynchophorus ferrugineus (red palm weevil)
           No accession number
           Praveen Mamidala
           Submitted to nomenclature committee Jan. 26, 2012
           53% to CYP345E2 Dendroctonus ponderosae

CYP345 fragment    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP3 clan
           Clone name P-6-14
           51% to CYP345F1 I-helix region
           44% to CYP6AQ1 Apis mellifera (aa 255-346)
           too short to name yet.
           These two fragments might be from CYP345F2

CYP345 fragment    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP3 clan
           Clone name P-6-10
           66% to CYP345A2 Tribolium castaneum
           65% to CYP345E1 Dendroctonus ponderosae           
           too short to name yet.
           These two fragments might be from CYP345F2

CYP346A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_967901
           63% to CYP346A2 Tribolium, CYP3 clan

CYP346A2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968966
           63% to CYP346A1 Tribolium, CYP3 clan

CYP346B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968751
           77% to CYP346B3 Tribolium, CYP3 clan

CYP346B2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968823
           86% to CYP346B1 Tribolium, CYP3 clan

CYP346B3   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968894
           73% to CYP346B2 Tribolium, CYP3 clan

CYP347A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970992, AAJJ01005243.1
           36% to CYP6BQ11, 35% to Cyp28d1
           gene model too long, shortened at C-term

CYP347A2   Tribolium castaneum (red flour beetle)
           GenEMBL AAJJ01002940
           57% to CYP347A1

CYP347A3   Tribolium castaneum (red flour beetle)
           GenEMBL AAJJ01002940, AAJJ01006489
           62% to CYP347A2
 1300 ACL (1)

CYP347A4   Tribolium castaneum (red flour beetle)
           GenEMBL AAJJ01003892, DT790783.1 DT800167.1 = ESTs
           59% to CYP347A1
     HKYNESEIV 3747

CYP347B1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            42% to CYP347A2 Tribolium castaneum
            clone name DPO0817_H01

CYP347C1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP3 clan
           Clone name P-6-6
           50% to CYP347A1 Tribolium castaneum, 41% to CYP347B1

CYP347C fragment    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011
           92% to CYP347C1

CYP347D1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            41% to CYP347B1 Dendroctonus ponderosae

CYP347E1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            51% to CYP347B1 Dendroctonus ponderosae

CYP348A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_967784, AAJJ01002935.1
           73% to CYP346B2 Tribolium, CYP3 clan
           weak match to other P450s, new family, short
           missing some large seq blocks in the mid region, 
           No Cys at heme signature, 
           no I-helix, probable pseudogene or non-functional as a P450

CYP349A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973153
           60% to CYP349A2 Tribolium, CYP4 clan

CYP349A2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973195
           AAJJ01007805.1 (1302-549), POSSIBLE AT BOUNDARY INSTEAD OF AG AT SETI
           AAJJ01008257.1 (293-855)
           68% to CYP349A1 Tribolium, CYP4 clan


CYP349A3P  Tribolium castaneum (red flour beetle)
           GenEMBL XP_968399
           AAJJ01001569.1 pseudogene
           Tribolium, CYP4 clan

CYP349B1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            42% to CYP349A1 Tribolium castaneum
            44% to CYP4CA1 Nasonia (might be missnamed, may be CYP349 seq)
            clone name DPO0710_J17

CYP349B2    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            85% to CYP349B1 Dendroctonus ponderosae

CYP349C1X  Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011
           53% to CYP349A1 I-helix to heme
           renamed CYP412A1v3, 95% to CYP412A1v1

CYP350A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968884
           40% to CYP350C1
           deleted small intron after LCS

CYP350B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_968812, AAJJ01000155.1 
           42% to CYP350A1
           CYP350A1 is also on this contig 

CYP350C1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_967642
           40% to CYP350A1

CYP350D1    Leptinotarsa decemlineata (Colorado potato beetle)
            No accession number
            Jianhua Zhang
            Submitted to nomenclature committee April 2, 2006
            Clone name P341A2407
            63 amino acids from heme to end
            48% to 4C34, 44% to 4c3, 42% to 341A2, 52% to CYP350C1

CYP350D2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP4 clan
           Clone name P-4-8 
           69% to CYP350D1 Leptinotarsa decemlineata (Colorado potato beetle) 
           82% to CYP350D3 P-4-7

CYP350D3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP4 clan
           Clone name P-4-7 
           65% to CYP350A1 Tribolium castaneum
           56% to CYP349B1
           82% to CYP350D2 P-4-8

CYP350D3   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           CYP4 clan
           Clone name seq 19
           100% to CYP350D3 Leptinotarsa decemlineata

CYP350D4   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011

CYP351A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973429, AAJJ01001080.1
           59% to CYP351A8 

CYP351A2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973464, AAJJ01001080.1
           60% to CYP351A8

CYP351A3   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973499
           84% to CYP351A4

CYP351A4   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973531
           84% to CYP351A3

CYP351A5   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973568 + XP_973599
           56% to CYP351A8

CYP351A6   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973634
           66% to CYP351A5

CYP351A7   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973664 AAJJ01001080.1
           73% to CYP351A8

CYP351A8   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973698
           73% to CYP351A7 

CYP351B1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_973400, AAJJ01004605.1
           first exon on AAJJ01001080.1

CYP351C1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_969850, AAJJ01003994.1
           43% to CYP351A8 

CYP351D1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_969258 AAJJ01003014.1
           44% to CYP351A7

CYP352A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970947, AAJJ01003994.1
           35% to CYP9G14 

CYP352A2   Tribolium castaneum (red flour beetle)
           GenEMBL XP_970893, AAJJ01004849.1 
           63% to CYP352A1 
           runs off the end of the contig

CYP352B1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            46% to CYP352A1 Tribolium castaneum

CYP353A1   Tribolium castaneum (red flour beetle)
           GenEMBL XP_974117, protein , AAJJ01000087.1 genomic
           35% to CYP314A1 Tribolium, mito clan 

CYP353A2 part 1    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 4
           56% to CYP353A1 Tribolium castaneum
           aa 74-195

CYP353A2 part 2    Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Dec. 10, 2010 
           mito clan
           Clone name seq 29
           56% to CYP353A1 Tribolium castaneum
           aa 297-461

CYP353A2     Leptinotarsa decemlineata (Colorado potato beetle)
             GO270917.1 C-term EST
             53% to CYP353B1 aphid
             100% to CYP353A2 part 2 C-term
             Mito clan

CYP353B1   Acyrthosiphon pisum (pea aphid)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           45% to Tribolium castaneum XM_969024.1 CYP353A1
           mito clan

CYP353C1   Trialeurodes vaporariourum (whitefly)

CYP353D1   Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           54% to CYP353C1 Trialeurodes vaporariourum
           EXXR to heme region

CYP353D1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011

CYP354A1   Bombyx mori (silkworm)
           AV399740.1 EST N-term 203 amino acids
           BAAB01211873.1 exons 1,2
           AADK01025884.1 exons 3,4,5,6
           BAAB01157630.1 exon 7
           AADK01034838.1 exons 7,8
           AADK01018486.1 exons 8,9
           This sequence assembled from genomic DNA and ESTs
           A tree of 155 CYP6 and 9 sequences places it outside CYP6 and CYP9, but
           It is a CYP3 clan member.
           The stop codon in exon 4 seems to be a seq error
           when compared to the CYP354A2 cDNA sequence.

CYP354A2   Antheraea yamamai (Japanese oak silkmoth)
           GenEMBL AB265182.1
           Yang, UP., Onodera, CO., and Suzuki, K.
           67% to CYP354A1 of Bombyx mori
31 amino acids of EXXR exon missing here

CYP354A3    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_159, 97% to Contig_266 68% to CYP354A1, 
            38% to CYP9E2, 35% to CYP6P10v1
            HAH007118 100% to Contig_159
            HAH014359 1 aa diff to Contig_159

CYP354A3    Heliothis subflexa (moth)
            No accession number
            Hanna Heidel-Fischer
            submitted to nomenclature committee June 30, 2011
            98% to CYP354A3 Helicoverpa armigera

CYP354A4    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_266 62% to CYP354A1
            HAH010529 100% to Contig_266, 97% to Contig_159 354A3

CYP354A5   Manduca sexta 
           No accession number
           Yannick Pauchet
           Submitted to nomenclature committee April 7, 2009

CYP354A6    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            56% to CYP354A1 Bombyx mori

CYP354A7    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            52% to CYP354A6 Heliconius melpomene

CYP354A8   Plutella xylostella 
           Gene number CCG014440.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           66% to CYP354A3 Helicoverpa armigera 
           missing the N-terminal 68 aa

CYP354A9   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           71% to CYP354A3 Helicoverpa armigera

CYP354A10  Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP355A1  Litopenaeus vannamei (Pacific white shrimp)
          No accession number
          Shirley Chan
          Submitted to nomenclature committee August 29, 2006
          37% to rat 3A1, 55% to CYP355A4 (DY307252.1 DW584917.1 DY656871.1    
          DY656786.1 Green Shore Crab Carcinus maenas ESTs)
          Note: first CYP3 clan member from a crustacean
          Clone name Lv01

CYP355A2  Litopenaeus vannamei (Pacific white shrimp)
          No accession number
          Shirley Chan
          Submitted to nomenclature committee August 29, 2006
          89% to 355A1, 69% to 355A3, 39% to 9E2 in 3 clan
          Clone name Lv02

CYP355A3  Metapenaeus ensis (shrimp)
          No accession number
          Shirley Chan
          Submitted to nomenclature committee August 29, 2006
          69% to 355A2
          Clone name Me01

CYP355A4  Carcinus maenas (Green Shore Crab) 
          GenEMBL DY307252.1 DW584917.1 DY656871.1 DY656786.1 cDNA
          55% to 355A1, 35% to 6a17 Drosophila N-term, 37% to 9L1

CYP355A5  Litopenaeus vannamei (Pacific white shrimp)
          No accession number
          Yuan Liu
          Submitted to nomenclature committee Jan. 4, 2010
          85% to CYP355A2

CYP356A1  Crassostrea gigas (Pacific oyster)
          No accession number
          Alfonso Bainy
          Submitted to nomenclature committee Jan. 19, 2007
          Similar to CYP17 sequences and CYP1 sequences
          In the CYP2 clan
          34% to CYP17A1 of zebrafish,  38% to an unnamed sea urchin 
          sequence XP_789963

CYP357A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph6-1, 36% to CYP6AG3 Aedes
            Pediculus genome site

CYP357B1    Laupala kohalensis (cricket)
            GenEMBL EH642348.1 EH638304.1, EH632898.1 EST 
            82% to CYP357B2 42% to CYP357A1, 38% to 6AG2, 40% to 6AG3 N-term only

CYP357B2    Laupala kohalensis (cricket)
            GenEMBL EH629712
            82% to CYP357B1 EH642348.1 EH638304.1, EH632898.1, 36% to CYP357A1

CYP357C1    Blattella germanica (German cockroach)
            No accession number
            Ameya D. Gondhalekar and Mike Scharf
            submitted to nomenclature committee Nov. 21, 2010
            47% to CYP357B2 in the N-terminal only
            CYP3 clan member

CYP358A1    Pediculus humanus humanus (body louse)
            XM_002422874, predicted mRNA not completely correct
            Revised seq given below
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph6-2P, 40% to 6BE1 Apis (no cys), 
            probably not a pseudogene since Locusta migratoria and 
            Homalodisca vitripennis also have similar P450s as ESTs
            EG367165.1, CO826097.1, resmbles CYP408 family
            Pediculus genome site

CYP359A1    Pediculus humanus humanus (body louse)
            No accession number
            Reed Johnson and Barry Pittendrigh
            Submitted to nomenclature committee March 14, 2007
            Ph343, 34% to 343A1 Apis, 36% to 15A1 Diploptera punctata
            Pediculus genome site

CYP360A1   Daphnia pulex (water flea)

CYP360A2P  Daphnia pulex (water flea)

CYP360A3   Daphnia pulex (water flea)

CYP360A4   Daphnia pulex (water flea)

CYP360A5   Daphnia pulex (water flea)

CYP360A6   Daphnia pulex (water flea)

CYP360A7   Daphnia pulex (water flea)

CYP360A8   Daphnia pulex (water flea)

CYP360A9   Daphnia pulex (water flea)

CYP360A10  Daphnia pulex (water flea)

CYP360A11P Daphnia pulex (water flea)

CYP361A1   Daphnia pulex (water flea)

CYP361B1   Daphnia pulex (water flea)

CYP362A1   Daphnia pulex (water flea)
           JGI Protein ID:212880

CYP362A2   Daphnia pulex (water flea)
           JGI Protein ID:245478

CYP362B1   Capitella capitata (Gallery worm, polychaete worm, annelid)
           JGI Protein ID:125634
           41% to CYP362A1 Daphnia
           42% to 362A2

CYP363A1   Daphnia pulex (water flea)

CYP364A1   Daphnia pulex (water flea)

CYP364A2   Daphnia pulex (water flea)

CYP364A3   Daphnia pulex (water flea)

CYP365A1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP365A1   Plutella xylostella 
           Gene number CCG009934.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           74% to CYP365A1 Bombyx mori
           missing the C-term 139 aa
           renamed as the ortholog, formerly CYP365A2

CYP365A2P  Plutella xylostella 
           Gene number CCG016740.1, CCG009935.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           69% to CYP365A1 Bombyx mori
           renamed as a pseudogene, formerly CYP365A3P
           C-term part of this gene is CCG009935.1 (old CYP365A5)

CYP365A1   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012
           renamed as the ortholog, formerly CYP365A3

CYP365A1   Helicoverpa armigera (cotton bollworm)

CYP365A1   Chilo suppressalis (striped rice stem borer)

CYP366A1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP366B1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            44% to CYP366A1 Bombyx mori

CYP366B2    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            80% to CYP366B1 Heliconius melpomene

CYP366C1   Plutella xylostella 
           Gene number CCG005514.4
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           68% to CCG005515.2
           46% to CYP366A1 Bombyx mori
           38% to CCG010920.1

CYP366C2   Plutella xylostella 
           Gene number CCG005515.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           68% to CCG005514.4
           43% to CYP366A1 Bombyx mori

CYP366D1   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           53% to CYP366A1 Bombyx mori

CYP367A1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP367A2    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_265 57% to CYP367A1, 35% to 4D17 N-term
            HAH010069 100% to Contig_265

CYP367A3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011

CYP367A4   Plutella xylostella 
           Gene number CCG000833.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           63% TO CYP367A1 Bombyx mori
           MISSING FIRST 60 AA

CYP367A5   Plutella xylostella 
           Gene number CCG004650.2
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           96% TO CCG000833.1

CYP367A6   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           70% to CYP367A2 Helicoverpa armigera

CYP367A7   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP367B1    Bombyx mori (silkworm)
            No acession number
            See silkworm page for details

CYP367B2    Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_188 53% to CYP367B1 partial N-term seq., 
            42% TO CYP367A1 whole seq, 29% to CYP4M7

CYP367B3    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011

CYP367B4   Plutella xylostella 
           Gene number CCG006271.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           96% to CCG000834.1
           59% to CYP367B2 Helicoverpa armigera

CYP367B5   Plutella xylostella 
           Gene number CCG000834.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           96% to CCG000834.1

CYP367B6   Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           77% to CYP367B2 Helicoverpa armigera

CYP367B7   Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP368A1    Hypsibius dujardini (water bear, Tardigrade)
            GenEMBL CO742010, CO508667, CF544158
            David Drane
            2clan 33% to 2J2 partial seq N-term to I-helix
            name conflict with Apis formerly CYP343A1

CYP368A2    Hypsibius dujardini (water bear, Tardigrade)
            GenEMBL CO741868.1
            David Drane
            2clan 46% to 343A1
            N-term only 
            name conflict with Apis formerly CYP343A2

CYP368B1    Hypsibius dujardini (water bear, Tardigrade)
            GenEMBL CF075875.1
            David Drane
            2clan 42% to 343A1
            N-term only 
            name conflict with Apis formerly CYP343B1

CYP369A1    Apis mellifera
            Name conflict with Nereis, formerly CYP342A1

CYP369A1   Linepithema humile (argentine ant)
           No accession number
CYP369A1   Pogonomyrmex barbatus (seed-harvester ant)
           See Pogonomyrmex page
           Reed Johnson 
           Submitted to nomenclature committee June 3, 2010
           54% to CYP369A1 Apis mellifera

CYP369A1   Solenopsis invicta (fire ant)
           See Solenopsis page
           79% to CYP369A1 Pogonomyrmex barbatus

CYP369A2   Solenopsis invicta (fire ant)
           See Solenopsis page
           78% to CYP369A1 Pogonomyrmex barbatus

CYP370A1   Daphnia pulex (water flea)
           formerly CYP15D1

CYP370A2   Daphnia pulex (water flea)
           formerly CYP15D2

CYP370A3P  Daphnia pulex (water flea)
           formerly CYP15D3P

CYP370A4   Daphnia pulex (water flea)
           formerly CYP15D4

CYP370A5   Daphnia pulex (water flea)
           formerly CYP15D5

CYP370A6   Daphnia pulex (water flea)
           formerly CYP15D6

CYP370A7   Daphnia pulex (water flea)
           formerly CYP15D7

CYP370A8   Daphnia pulex (water flea)
           formerly CYP15D9

CYP370A9   Daphnia pulex (water flea)
           formerly CYP15D9

CYP370A10  Daphnia pulex (water flea)
           formerly CYP15D10

CYP370A11  Daphnia pulex (water flea)
           formerly CYP15D11

CYP370A12  Daphnia pulex (water flea)
           formerly CYP15D12

CYP370A13  Daphnia pulex (water flea)
           formerly CYP15D13

CYP370B1   Daphnia pulex (water flea)
           formerly CYP15E1

CYP370B2   Daphnia pulex (water flea)
           formerly CYP15E2

CYP371A1   Helobdella robusta (leech, annelid worm)
           JGI Protein ID: 81128
           47% to CYP371B1, 35% to human CYP27A1

CYP371B1    Capitella capitata (Gallery worm, polychaete worm, annelid)
            JGI Protein ID:199669
            47% to CYP371A1, 37% to human CYP27A1, 

CYP371C1    Lottia gigantea (owl limpet)
            JGI Protein ID:239424 
            42% to CYP371B1

CYP372A1    Capitella capitata (Gallery worm, polychaete worm, annelid)
            JGI Protein ID:201165
            32% to 235674LotGi, 34% to 125634CapCa
            36% to CYP372B1, 31% to 235674LotGi,
            33% to CYP373A1 Aplysia
            note revised from JGI gene model, exon 43 lengthened
            exon 6 shortened

CYP372B1    Capitella capitata (Gallery worm, polychaete worm, annelid)
            JGI Protein ID:136114
            JGI gene model modified

CYP373A1    Aplysia californica (California sea hare) 
            GENSCAN_predicted_peptide from gi|112609286|gb|AASC01065054.1
            added first exon to model

CYP373B1   Lottia gigantea (owl limpet)
           JGI Protein ID:235674 36% to Aplysia

CYP374A1v1    Branchiostoma floridae (amphioxus)
              JGI Protein ID:155528 
              Model short at N-term and C-term added missing parts
              scaffold_501:440590-430771 (-) strand

CYP374A1v2   Branchiostoma floridae 
             JGI Protein ID:73459,       
             scaffold_44:2304248-2294891 (-) strand)
             allele 3 aa diffs to CYP374A1v1 
2299467 PTIDLDAELRKWSLE 2299423
(gap of 111 aa)

CYP374A2   Branchiostoma belcheri (Japanese lancelet)
           side chain cleavage enzyme
           87% to CYP374A1v1, 31% to 27B1 hum, 
           38% to CYP374B1 Strongylocentrotus purpuratus
  1 mkralhqhlv arklgadaat igrtggdsgt fspptsvlgh adhvgtgptt qpcsarpfde
 61 mpgpkglpli gslmdytplg pfrlkklhes fferyrqfgk isketignkr fvsvydphdi
121 etlfrtegpn pswmqlmalg evrkrlgksl gminetgekw rqlryaaqsk llnpknvccf
181 vpilddiaqg fvenmrvgrt atlepsidmd aelrkwsles vvsatlgirl gclqtnrqip
241 dkdtedlles sdafletwpt lelgpplyml yptktwrkfl raneqwlsaa griidrslds
301 ngsqrdplqp evtllehivt rkeltpddiv miitelifag iestavamty nlytmaknqa
361 vqenarrevn avvgkggkit hdalkslkyv kaciketfrv fpvfsmrnri ldreivlsgy
421 rvppnviirv lshvtgqlpe yvpepdrfap erwlrddtsm pkphpfavrp fgvgsrscig
481 qrlaeqelti llakmvqqfh iecdgemdqi fniankpdls gtfkftelln

CYP374B1   Strongylocentrotus purpuratus (purple sea urchin)

CYP375A1    Nematostella vectensis (starlet sea anemone, Cnidarian) 
            JGI protein ID:107622

CYP375B1    Nematostella vectensis (starlet sea anemone, Cnidarian) 
            JGI protein ID:102678
            51% to CYP375C1, 49% to CYP375A1
            41% to CYP375D1, 39% to Lottia gigantea CYP371C1

CYP375C1    Nematostella vectensis (starlet sea anemone, Cnidarian) 
            JGI protein ID:83609
            51% to CYP375B1

CYP375D1    Nematostella vectensis (starlet sea anemone, Cnidarian) 
            JGI protein ID:140839
            36% to human CYP27A1

CYP376A1    Capitella capitata (Gallery worm, polychaete worm, annelid)
            JGI Protein ID:117101
            37% to human CYP27A1

CYP376B1   Helobdella robusta (leech, annelid worm)
           JGI Protein ID:117142
           39% to CYP376A1

CYP377A1    Nematostella vectensis (starlet sea anemone, Cnidarian) 
            JGI protein ID:162389
            36% to CYP10A3

CYP378A1    Lottia gigantea (owl limpet)
            JGI Protein ID:152935
            30% to CYP302, 32% to 362B1

CYP379A1X  Epiphyas postvittana (Light brown apple moth)
           ESTs EV809285.1, EV808377.1
           Renamed CYP405A1 due to a name conflict

CYP379A1   Carcinus maenas (green shore crab)
           ESTs DY657564.1, DN796669.1, DY308678.1, DN796206.1,
           Kim Rewitz 
           Sequence 1
           41% to 2L1, 38% to 2N2 Fundulus AF090435, 34% to 18A1 Daphnia, 
           35% to 2E1 human, 49% to CYP379B1, 48% to CYP379B2, 47% to CYP379B6, 
           53% to CYP379B5 C-term,
           50% to CYP379B3, 53% to CYP379B7 C-term, 50% to CYP379B4

CYP379A2X  Zygaena filipendulae (zygaenid moth, Lepidoptera)
           Mika Zagrobelny Larsen
           Submitted to nomenclature committee Feb. 4, 2009
           Clone name Zygae_P450-1  
           only 32% to Cyp4e1 Droso., 58% to CYP379A3, 
           53% to Light brown apple moth CYP379A1 
           Epiphyas postvittana EST EV809285.1
           Renamed CYP405A2 due to a name conflict

CYP379A3X  Zygaena filipendulae (zygaenid moth, Lepidoptera)
           Mika Zagrobelny Larsen
           Submitted to nomenclature committee Feb. 4, 2009
           Clone name Zygae_P450-4 
           only 30% to Cyp4e3 Droso. 58% to CYP379A2
           Renamed CYP405A3 due to a name conflict

CYP379B1   Petrolisthes cinctipes (crab)
           FE820627.1 FE823472.1, FE806612.1, FE829403.1, FE821762.1
           FE806917.1 FE823784.1 FE781035.1 FE823784.1 FE781035.1
           FE782980.1, FE778648.1, FE797671.1, FE790532.1
           FE783351.1, FE763716.1, FE791800.1,
           Sequence 7
           55% to CYP379B3, 51% to CYP379B6, 59% to CYP379B4, 49% to CYP379A1
           67% to CYP379B2, 54% to CYP379B5, 50% to CYP379B7
           41%  to 2L1

CYP379B2   Petrolisthes cinctipes (crab)
           FE793642.1, FE765331.1, FE768218.1 (5 aa diffs), FE792515.1
           Sequence 8
           67% to CYP379B1, 51% to CYP379B6, 46% to CYP379B3, 48% to CYP379A1, 
           55% to CYP379B4

CYP379B3   Petrolisthes cinctipes (crab) 
           FE798452.1 57% to CYP379B5, 65% to CYP379B7, 66% to CYP379B4, 
           50% to CYP379A1
           Opp end FE798453
           FE774456.1, FE809818.1 opp end = FE809817 = N-term
           FE766093.1 opp end = FE766092 = N=term
           51% to CYP379B1, 53% to CYP379B2, 54% to CYP379B6, 47% to CYP379A1
           Sequence 5
(31 aa gap)

CYP379B4   Petrolisthes cinctipes (crab)
           Sequence 6
           66% to CYP379B3, 59% to CYP379B1, 54% to CYP379B6, 50% to CYP379A1, 
           55% to CYP379B2

CYP379B5   Petrolisthes cinctipes (crab) 
           FE812260.1 CCAG30364.b1, FE839854.1 CCAG48763.b1, FE795110.1 
           opp. End = FE795111 (non-coding)
           54% to CYP379A1, 54% to CYP379B1, 57% to CYP379B3, 57% to CYP379B7
           Sequence 4

CYP379B6   Carcinus maenas (green Shore Crab)
           DY307501.1, DY656714.1, DW249163.1, DN634739.1,
           DY657052.1, DY308481.1, DV944423.1, DY307476.1,
           DN635373.1, DY656037.1, DV642767.1 (extends)
           46% to CYP379A1, 51% to CYP379B1
           Sequence 2

CYP379B7   Homarus americanus (lobster)
           59% to CYP379B8 Litopenaeus vannamei
           65% to CYP379B3, 57% to CYP379B5
           Sequence 3

CYP379B8   Litopenaeus vannamei
           EST FE129632.1
           59% to 379B7, short, may need to be renamed
           sequence 9

CYP380A1   Acyrthosiphon pisum (pea aphid)
           LOC100165004 SCAFFOLD17282:20108..54426 (- strand) top half only
           N-term is on SCAFFOLD11661:5770-6260 (-) strand
           see EST EE264487.1 Myzus persicae to confirm N-term
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           CYP4 clan

CYP380A2P  Acyrthosiphon pisum (pea aphid)
           LOC100167018.pro SCAFFOLD17282:20108..54426 (- strand) 
           bottom half only
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           55% to CYP380A1
           CYP4 clan

CYP380B1   Acyrthosiphon pisum (pea aphid)
           LOC100161319    SCAFFOLD11137:17306..28967 (+ strand)
           SCAFFOLD11137:AUG4_SCAFFOLD11137.g1.t1 = LOC100161319
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           39% to CYP4G14 C-term half
           52% to LOC100165004, 50% to LOC100167889
           CYP4 clan

CYP380C1   Acyrthosiphon pisum (pea aphid)
           LOC100162836.pro    SCAFFOLD10061:3374..10265 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           small sequence gap
           CYP4 clan

CYP380C2   Acyrthosiphon pisum (pea aphid)
           LOC100160808 SCAFFOLD10061:16344..23495 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           49% to CYP380A1
           CYP4 clan

CYP380C3   Acyrthosiphon pisum (pea aphid)
           LOC100158738.pro SCAFFOLD10061:35318..41755 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           CYP4 clan
(seq gap)

CYP380C4   Acyrthosiphon pisum (pea aphid)
           LOC100159590   SCAFFOLD17803:1..16255 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           missing C-term in a seq gap
           CYP4 clan

CYP380C5v1 Acyrthosiphon pisum (pea aphid)
           LOC100162710.pro SCAFFOLD12542:91226..95809 (+ strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           runs off the end of the contig
           & =  frameshift
           74% to CYP380C2 LOC100160808
           CYP4 clan

CYP380C5v2 Acyrthosiphon pisum (pea aphid)
           aLOC100167486   SCAFFOLD4690:1..2605 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           runs off the end of the contig
           96% to CYP380C5v1
           CYP4 clan

CYP380C6   Acyrthosiphon pisum (pea aphid)
           LOC100167889 SCAFFOLD12103:1756..16564 (+ strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           49% to LOC100165004
           CYP4 clan

CYP380C7   Acyrthosiphon pisum (pea aphid)
           LOC100168315 SCAFFOLD2534:44976..48195 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           CYP4 clan

CYP380C8   Acyrthosiphon pisum (pea aphid)
           LOC100165148p SCAFFOLD1571:20813..37353 (-strand)
           also SCAFFOLD17147:5399..9863 (- strand) C-term
           see EST ES224491.1 Myzus persicae for N-term match
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           CYP4 clan

CYP380C9   Acyrthosiphon pisum (pea aphid)
           LOC100162179  SCAFFOLD17731:37803..45605 (- strand)
           Genome set of sequences submitted by Rene Feyereisen Aug. 6, 2009
           N-term may be too long
           CYP4 clan

CYP380C10  Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf4
           62% to CYP380C5 aphid

CYP380C11  Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           N-term, incomplete

CYP380D1   Trialeurodes vaporariourum (whitefly)

CYP380E1   Trialeurodes vaporariourum (whitefly)

CYP381A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP381A2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP382A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP383A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP384A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385B1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C3   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C4   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C5   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP385C6   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP386A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP387A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP387A2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP388A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389B1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C3   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C4   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C5   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C6   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C7   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C8   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C9   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C10P Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C11  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C12  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP389C13  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP390A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP390B1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP391A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A3P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A4   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A5   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A6   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A7   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A8   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A9   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A10  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A11  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A12  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A13  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A14  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A15  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A16  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A17  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A18  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A19  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A20  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A21  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392B1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392A1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392B2P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392B3P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392B4   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392B5   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392C1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D3   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D4   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D5P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D6   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D7   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D8   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D9P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392D10P Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E1   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E2   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E3   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E4P  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E5   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E6   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E7   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E8   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E9   Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E10  Tetranychus urticae (two-spotted spider mite, arachnid)
CYP392E11  Tetranychus urticae (two-spotted spider mite, arachnid)

CYP393A1   Dendroctonus ponderosae (mountain pine beetle, bark beetle)
           No accession number
           Christopher I. Keeling
           Submitted to nomenclature committee Oct. 21, 2009
           Very poor match
           clone name DPO047_M16

CYP393A2    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            82% to CYP393A1 Dendroctonus ponderosae

CYP394A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig4030 575aa 26% TO CYP49A1, 
           29% to CYP334B1, in the mito clan
           This seq has a damaged Heme signature, 
           no conserved CYS (possible frameshifted region) 

CYP395A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig20452 454aa, in the CYP3 clan
           35% TO CYP6A14, 91% to contig18794, 90% to contig18793, 
           90% to contig22097, 70% to contig22737
           70% to contig22006, 69% to contig1426, 68% to contig7981
           34% to CYP6CE1, 37% to CYP6M3

CYP395A2   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig18794 505aa 
           35% TO CYP6A14, in the CYP3 clan

CYP395A3   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig18793 505aa 
           36% TO CYP6A14, in the CYP3 clan

CYP395A4   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig22097 506aa 
           35% TO CYP6A14, in the CYP3 clan

CYP395A5   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig22737_20384 516aa 
           35% TO CYP6A14, in the CYP3 clan

CYP395A6   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig22006 505aa 
           35% TO CYP6A14, in the CYP3 clan

CYP395A7   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig1426 516aa 
           36% TO CYP6A14, in the CYP3 clan

CYP395A8   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig7981 516aa 
           34% TO CYP6A14, in the CYP3 clan

CYP395B1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig5015 512aa 
           33% TO CYP6D5, 35% to CYP6AX1, in the CYP3 clan

CYP396A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig13956 510aa 34% TO CYP6A21, 
           33% TO CYP6BQ13 Tribolium, in the CYP3 clan

CYP397A1v1 Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig19527 458aa 
           26% TO CYP9J, 31% to 347A4, 31% to 9Q2, in the CYP3 clan

CYP397A1v2 Cimex lectularius (bedbug)
           No accession number
           Praveen Mamidala
           Submitted to nomenclature committee June 9, 2011
           6 amino acid diffs to CYP397A1v1.

CYP398A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig2453 493aa 
           33% TO CYP6AG3, in the CYP3 clan

CYP399A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig5575 509aa 
           31% TO CYP6A17, 33% to CYP6N5, in the CYP3 clan

CYP400A1   Cimex lectularius (bedbug)
           No accession number
           Zach N. Adelman
           Submitted to nomenclature committee Dec. 1, 2009
           contig8295 315aa 
           34% to CYP345D1, 33% to CYP6J1, in the CYP3 clan

CYP401A1   whitefly Trialeurodes vaporariorum

CYP402A1   whitefly Trialeurodes vaporariorum

CYP402B1v1 whitefly Trialeurodes vaporariorum

CYP402C1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           39% to CYP402B1v1 Trialeurodes vaporariourum (whitefly)

CYP402C2   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           71% to CYP402C1 Bemisia tabaci

CYP402D1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           45% to CYP402C1 Bemisia tabaci

CYP403A1   whitefly Trialeurodes vaporariorum

CYP403A2   whitefly Trialeurodes vaporariorum

CYP404A1   whitefly Trialeurodes vaporariorum

CYP404A2   Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           57% to CYP404A1 whitefly Trialeurodes vaporariorum

CYP404A2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           N-term, incomplete, 57% to CYP404A1 whitefly Trialeurodes vaporariorum

CYP404B1   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf18
           49% to CYP404A1 whitefly Trialeurodes vaporariorum

CYP404B2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           incomplete, 89% to CYP404B1 Sogatella furcifera 

CYP405A1 old name = CYP379A1 Epiphyas postvittana (Light brown apple moth)
           EST EV809285.1, EV808377.1
           Had a name conflict with crab P450s

CYP405A2 old name = CYP379A2 Zygaena filipendulae (zygaenid moth, Lepidoptera)       
           Zygae_P450-1  only 32% to Cyp4e1 Droso., 58% to CYP379A3, 
           53% to Light brown apple moth CYP379A1 Epiphyas postvittana 
           EST EV809285.1
           Had a name conflict with crab P450s

CYP405A3 old name = CYP379A3 Zygaena filipendulae (zygaenid moth, Lepidoptera) 
           Zygae_P450-4 only 30% to Cyp4e3 Droso. 58% to CYP379A2
           Had a name conflict with crab P450s

CYP405A4    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee Feb. 9, 2011
            54% to CYP405A1 Epiphyas postvittana

CYP405A5    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            77% to CYP405A4 Heliconius melpomene

CYP405A6    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            83% to CYP405A4 Heliconius melpomene

CYP406A1   confidential

CYP407A1   confidential

CYP408A1   Nilaparvata lugens (brown planthoppper)
           33% to CYP358A1 Pediculus humanus corporis
           53% to EST fragment Homalodisca vitripennis EG367165.1
           (no Cys at heme signature)

CYP408A2   Corn planthopper Peregrinus maidis maidis 
           72% to CYP408A1, 42% to CYP408B1 N-term

CYP408A3   Sogatella frucifera (white-backed plant hopper)
           No accession number
           Shi Xiaoqin
           Submitted to nomenclature committee March 25, 2011
           Clone name sf16 and sf3-f
           88% to CYP408A1 Nilaparvata lugens

CYP408B1   Locusta migratoria manilensis
           No accession number
           Enbo Ma and Yanqiong Guo
           38% to CYP408A1 Nilaparvata lugens GQ911996.1
           45% to EST fragment Homalodisca vitripennis EG367165.1
           1 amino acid difference with ESTs CO826097, CO852058

CYP408frag  Homalodisca vitripennis (syn. H. coagulata) Glassy-winged Sharpshooter
            EG367165.1 EST DN198142.1 
            No Cys 53% to CYP408A1, 46% to CYP358A1

CYP408frag  Lepismachilis y-signata (jumping bristletail) 
            EST FN220044.1
            37% to CYP408B1 N-term

CYP409A1   Locusta migratoria manilensis
           No accession number
           Enbo Ma and Yanqiong Guo
           35% to CYP347A3  Tribolium castaneum
           35% to CYP6BK4   Tribolium castaneum

CYP410A1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            30% to CYP350C1 Tribolium castaneum
            clone name DPO0820_N05

CYP410A2    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            65% to CYP410A1 Dendroctonus ponderosae

CYP410B1   Rhynchophorus ferrugineus (red palm weevil)
           No accession number
           Praveen Mamidala
           Submitted to nomenclature committee Jan. 26, 2012
           41% to CYP410A1 Dendroctonus ponderosae
           missing N-term. This name may change when full length seq is known

CYP410C1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            47% to CYP410A1 Dendroctonus ponderosae

CYP411A1    Dendroctonus ponderosae (mountain pine beetle, bark beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee April 30, 2010
            34% to CYP352A1 Tribolium castaneum
            35% to CYP4BZ1
            clone name DPO0112_O08 CYP4 clan

CYP412A1v1 Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Nov. 22, 2011
           Complete seq. 93% to CYP412A1v2 partial seq
           95% to CYP412A1v3 C-term fragment 

CYP412A1v2 Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP4 clan
           Clone name P-4-3 N-term part only 93% to CYP412A1v1 
           36% to CYP380C7 Acyrthosiphon pisum (N-terminal)
           61% to CYP412A2 (P-4-11)

CYP412A1v3 Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011
           53% to CYP349A1 I-helix to heme
           formerly CYP349C1, 95% to CYP412A1v1

CYP412A2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP4 clan
           Clone name P-4-11 
           39% to CYP349A1 Tribolium castaneum N-term
           61% to CYP412A1

CYP412A2   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Nov. 22, 2011
           Complete seq. 41% to CYP349A1, 58% to CYP412A1 

CYP412B1   Rhynchophorus ferrugineus (red palm weevil)
           No accession number
           Praveen Mamidala
           Submitted to nomenclature committee Jan. 26, 2012
           42% to CYP412A2 Leptinotarsa decemlineata
           CYP4 clan

CYP413A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Liu Ping 
           Submitted to nomenclature committee June 10, 2010 
           CYP3 clan
           Clone name P-6-12
           32% to CYP348A1 Tribolium castaneum
           34% to CYP393A1 Dendroctonus ponderosae 

CYP413A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Shi Xiaoqin 
           Submitted to nomenclature committee Nov. 22, 2011
           Complete seq.

CYP414A1   Ruditapes philippinarum (Japanese littleneck clam, mollusc)
           GenEMBL HQ234335
           Linbao Zhang
           CYP35% to CYP2K19 Danio rerio
           alternative name Venerupis philippinarum

CYP415A1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           36% to CYP6CX1v2 Bemisia tabaci

CYP416A1   Bemisia tabaci (sweet potato whitefly)
           No accession number
           Yidong Wu
           Submitted to nomenclature committee March 2, 2011
           36% to CYP401A1 Trialeurodes vaporariorum

CYP417A1   Nilaparvata lugens (brown planthopper)
           No accesion number
           Chris Bass
           Submitted to nomenclature committee April 27, 2011
           In the CYP4 clan but less than 40% to any known sequence
CYP417A2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           complete, 77% to CYP417A1 Nilaparvata lugens 

CYP417B1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           complete, 43% to CYP417A1 

CYP418A1   Nilaparvata lugens (brown planthopper)
           No accesion number
           Chris Bass
           Submitted to nomenclature committee April 27, 2011
           In the CYP3 clan but less than 40% to any known sequence
CYP418A2   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           complete, 75% to CYP418A1   Nilaparvata lugens 

CYP419A1v1 Laodephgax striatellus (small brown planthopper)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee May, 15, 2011
           33% to CYP334C1 Pediculus humanus

CYP419A1v2 Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           6 amino acid diffs to CYP419A1v1 

CYP420A1   Chironomus tentans (aquatic midge)
           No accession number
           Kun Yan Zhu
           Submitted to nomenclature committee May 31, 2011
           34% to CYP6AG11 Culex pipiens

CYP421A1    Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            33% to CYP340D1 Bombyx mori

CYP422A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Fang Zhu
           Submitted to nomenclature committee May 26, 2011
           33% to CYP4BR3

CYP422A1   Leptinotarsa decemlineata (Colorado potato beetle)
           No accession number
           Jia Shuang
           Submitted to nomenclature committee Dec. 26, 2011
           100% to CYP422A1 Leptinotarsa decemlineata
           nearly complete seq.

CYP423A1    Perinereis nuntia (polychaete worm)
            No accession number
            Senlin Zheng
            Submitted to nomenclature committee Feb. 22, 2011
            26% to CYP356A1 Crassostrea gigas (oyster)
            30% to CYP1A1 human
            in the CYP2 clan

CYP424A1    Perinereis nuntia (polychaete worm)
            No accession number
            Senlin Zheng
            Submitted to nomenclature committee Feb. 22, 2011
            35% to an unnamed Branchiostoma sequence in the CYP4 clan

CYP425A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           36% to CYP380C6 Acyrthosiphon pisum, complete 

CYP426A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           32% to CYP4CA1 Nasonia, 
           34% to CYP349B1 Dendroctonus ponderosae, complete 

CYP427A1   Laodelphax striatellus (small brown planthopper)
           No accession number
           Yue-Liang Zhang
           Submitted to nomenclature committee Oct. 19, 2011
           36% to CYP418A1 Nilaparvata lugens, incomplete 

CYP428A1   Plutella xylostella 
           Gene number CCG013091.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           58% to CYP333-un1/CYP428A1 Heliconius melpomene
           61% to CYP428A1 Monarch butterfly

CYP428A1P   Bombyx mori (silkworm
            Jun-wen Ai 
            Pseudogene fragment missing three aa in heme signature 
            Formerly CYP333-un1

CYP428A1P   Heliconius melpomene (common postman butterfly)
            No accession number
            Ritika Chauhan and Richard ffrench-Constant
            Submitted to nomenclature committee June 2, 2011
            65% to CYP333-un1  Bombyx mori
            missing sme three aa in heme signature as CYP333-un1 seqs
            Formerly CYP333-un1

CYP428A1P   Helicoverpa armigera (cotton bollworm)
            No accession number
            Heiko Vogel 
            submitted to nomenclature committee Feb. 6, 2008
            Contig_258 67% to CYP333-un1 Bombyx mori, mito clan C-term
            Pseudogene fragment missing the same three aa in heme signature 
            Probable ortholog to Bombyx pseudogene
            Formerly CYP333-un1

CYP428A1P  Spodoptera littoralis (cotton leafworm)
           No accession umber
           Martine Maibeche
           Submitted to nomenclature committee Jan. 20, 2012
           67% to CYP428A1P Plutella xylostella
           missing the same three aa in the heme signature
           Is this a new type of P450 with a distorted heme region?

CYP428A1v1 Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP428A1v2 Lymantaria dispar (Asian gypsy moth)
           No accession number
           Chuanwang Cao
           Submitted to nomenclature committee Oct. 17, 2012

CYP429A1   Plutella xylostella 
           Gene number CCG011483.1
           Weiyi He
           Submitted to nomenclature committee Dec. 4, 2011
           38% to CYP347A1 Tribolium castaneum

CYP430A1   Ruditapes philippinarum (Japanese littleneck clam, mollusc)
           GenPept ADP24121
           30% to CYP18A1 Daphnia pulex

CYP431A1    Perinereis nuntia (polychaete worm)
            No accession number
            Eun-Ji Won
            Submitted to nomenclature committee Feb. 16, 2012
            34% to CYP18A1 Daphnia pulex

CYP432A1    Perinereis nuntia (polychaete worm)
            No accession number
            Eun-Ji Won
            Submitted to nomenclature committee Feb. 16, 2012
            35% to CYP30B1 Mytilus edulis

CYP433A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            34% to CYP4BN11 Tribolium

CYP434A1    Dentroctonus ponderosae (mountain pine beetle)
            No accession number
            Christopher I. Keeling
            Submitted to nomenclature committee March 30, 2012
            34% to CYP352A1 Tribolium

CYP435A1    Harmonia axyridis (ladybug)

CYP436A1    Harmonia axyridis (ladybug)

CYP436A2    Harmonia axyridis (ladybug)

CYP437A1    Glossina morsitans morsitans (tsetse fly)

CYP437A2    Lucilia sericata (sheep blowfly)

CYP437A3    Bactrocera dorsalis (Oriental fruit fly) 
            No accession number
            Yong Huang
            submitted to nomenclature committee Sept. 13, 2012
            53% to CYP437A1 Glossina morsitans morsitans
            clone name 3087

CYP438A1    Lucilia sericata (sheep blowfly)

CYP438A2    Delia antiqua (onion fly)

CYP438A3    Rhagoletis pomonella (apple maggot)

CYP439A1v1  Laodelphax striatellus (small brown planthopper)
            No accession number
            Lu Xu
            Submitted to nomenclature committee June 11, 2012
            N-term only, 32% to CYP417A1 Nilaparvata lugens

CYP439A1v2  Laodelphax striatellus (small brown planthopper)
            No accession number
            Lu Xu
            Submitted to nomenclature committee June 11, 2012
            3 aa diffs to CYP439A1v1 

CYP74 clan animal P450s are grouped together in the CYP440 to CYP499 region

CYP74 clan members have been found in lancelet (Branchiostoma floridae)
Nematostella vectensis (sea anemone), Acropora species (corals),
Tricoplax adhaerens (a placozoan). 

CYP440A1v1  Branchiostoma floridae (lancelet, amphioxus)
            THIS SEQ IS 98% IDENTICAL TO ACD88492,
            CYP74-like seq epoxyalcohol synthase
            between PRDX1 ZCCHC4 SLIT1 and RRM2
            84% to estExt_fgenesh2_pg.C_4350040 (next to JUN)
            note: PRDX1 is adjacent to JUN in medaka
            PRDX1 is next to SLIT1 in lancelet
            PRDX2 is next to JUNB and HOOK2 in humans
            frameshift = &
            Note: SLIT1 on chr15 and chr 1 in medaka is near GOT1 CNNM1
CYP440A1-de6b7b   Branchiostoma floridae (lancelet, amphioxus)
                  chrUn:849800964-849801772 (-) strand
                  Pseudogene fragments downstream, LAST TWO EXONS

CYP440A1v2   Branchiostoma floridae (lancelet, amphioxus)
             missing the first exon 99% to CYP440A1 (only 1 aa diff)
(seq gap)

CYP440A2     Branchiostoma floridae (lancelet, amphioxus)
             chrUn:734687979-734694391 (-) STRAND
             25% to CYP8b.c, 23% to CYP7B1 human
             This is CYP74 like with 9 aa insert in heme region
             NEAR JunB or JunD
             Jun is next to a CYP2 like gene

CYP440A3P    Branchiostoma floridae (lancelet, amphioxus)
             chrUn:748632437-748635296 (+) strand
             70% to CYP440A1
             missing last two exons

CYP440A4P    Branchiostoma floridae (lancelet, amphioxus)
             chrUn:748668374-748674804 (+) strand
             92% to CYP440A2, 82% to CYP440A1
             no start MET, missing last three exons

CYP440A5    Branchiostoma floridae (lancelet, amphioxus)
            chrUn:631107406-631111508 (+) strand
            95% to CYP440A3, 75% to CYP440A1

CYP440A5-de5b   Branchiostoma floridae (lancelet, amphioxus)
                chrUn:631100697-631100849 (-) strand
                85% to CYP440A5

CYP440A6   Branchiostoma floridae (lancelet, amphioxus)
           chrUn:174738028- 174742047 (-) strand
           about 400kb from a CYP4 seq that is about 250kb from another CYP4

CYP440A6-de6b    Branchiostoma floridae (lancelet, amphioxus)

CYP440A7P        Branchiostoma floridae (lancelet, amphioxus)
                 52% to CYP440A1, extension part only. 
                 Stand alone lipoxygenase?

CYP440A8         Branchiostoma floridae (lancelet, amphioxus)
                 missing the last three exons
                 82% to CYP440A6

CYP440A9P       Branchiostoma floridae (lancelet, amphioxus)
                chrUn:289421392-289429096 (-) strand
                missing the last three exons with frameshifts = &
                88% to CYP440A3P, 87% to CYP440A6

CYP440A10P      Branchiostoma floridae (lancelet, amphioxus)
                94% to CYP440A8
(seq gap)
(seq gap)
(seq gap)

CYP440A11P      Branchiostoma floridae (lancelet, amphioxus)
                73% to CYP440A1v1
E (?)

CYP440A12P       Branchiostoma floridae (lancelet, amphioxus)
                 chrUn:82568948-82571407 (-) strand
                 86% to CYP440A11P

CYP440A13P       Branchiostoma floridae (lancelet, amphioxus)
                 79% to CYP440A6, lipoxygenase part only
                 97% to CYP440A15P 1 aa diff

CYP440A14P       Branchiostoma floridae (lancelet, amphioxus)
                 73% to CYP440A1v2, lipoxygenase part only

CYP440A15P       Branchiostoma floridae (lancelet, amphioxus)
                 lipoxygenase part only
                 97% to CYP440A13P 1 aa diff

CYP440A16P       Branchiostoma floridae (lancelet, amphioxus)
                 lipoxygenase part only
                 68% to CYP440A7P

CYP440A17P       Branchiostoma floridae (lancelet, amphioxus)
                 lipoxygenase part only
                 95% to CYP440A16P 1 aa diff

CYP441A1         Branchiostoma floridae (lancelet, amphioxus)
                 chrUn:369420088-369423879 (+) strand
                 22% to CYP74B2, 25% to CYP74F1 rice
                 (29% to Nematostella XM_001636310.1 12 exons)
                 next to SLC24A5  (P450) FCNB/FCN2 (P450)  MEIS2
                 note: amphioxus has a CYP4F seq between GALTN12 and FCNB
                 note CYP19 is about 400kb from SLC24A5 in medaka

CYP441A2      Branchiostoma floridae (lancelet, amphioxus)
              Two genes nearly identical (3 aa diffs) 
              45 kb apart (possible assembly error?)  
1307061 VHEG 1307072
end in a sequence gap

CYP442A1      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:867286912-867289314 (+) STRAND
              fgenesh2_pg.scaffold_781000005 [Brafl1:110589] 
              23% to CYP74B2
              Scaffold 781
              96% to fgenesh2_pg.scaffold_402000022
              between TFCP2 and MDH1B
LTEAADL   (frameshift)  

CYP442A2      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:711402302-711404745 (-) STRAND
              fgenesh2_pg.scaffold_402000022 [Brafl1:102192]
              Scaffold 402
              57% to fgenesh2_pg.scaffold_107000039
              96% to fgenesh2_pg.scaffold_781000005|Brafl1 (probable allele)
              between SAP18, salmo mk67i, mdh1b and UBP1/TFCP2
              NOTE: IN ZEBRAFISH mki67ip is near tfcp2l1, ddx18 and ccdc93

CYP442A3      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:342749929-342752450 (+) STRAND
              fgenesh2_pg.scaffold_107000039 [Brafl1:81984] 27% to CYP7D1
              Scaffold 107
              61% to fgenesh2_pg.scaffold_402000022|Brafl1
              51% to estExt_fgenesh2_pg.C_1950037
              next to GALNTL6

CYP442A4      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:494336246-494338984 (-) strand
              estExt_fgenesh2_pg.C_1950037 [Brafl1:125761] two genes fused
              Scaffold 195, 27% to CYP7D1, 30% to CYP7B1
              Neighbor to amphioxus on right side scaffold 195 
              also on another scaffold
              P450 like Nematostella/CYP74
              Between GALNT5 and DDX42 GALC

CYP442A5      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:654010626-654013026 (-) STRAND
              estExt_fgenesh2_pg.C_3320046 [Brafl1:128846] 3 exons, 27% to CYP7D1
              Scaffold 332 also 98% identical to estExt_fgenesh2_pg.C_1950037 
              but gene neighbors are different
              next to GALNTL5 

CYP442A6P     Branchiostoma floridae (lancelet, amphioxus)
              chrUn:444909462-444916776 (-) strand
              fgenesh2_pg.scaffold_163000045 [Brafl1:87575]
              Scaffold 163
              73% to estExt_fgenesh2_pg.C_1940045 pseudogene
              next to GLUL, CYP26 IS NOT TOO FAR OFF
LQVLEKHGGVS  (frameshift)
KENIQ  (bad boundary)

CYP442A7P     Branchiostoma floridae (lancelet, amphioxus)
              chrUn:444940017-444940794 (-) strand 
              24kb from CYP442A6P
              Second pseudogene nearby 86% to fgenesh2_pg.scaffold_163000045
              next to GLUL

CYP442A8      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:493364785-493367391 (-) STRAND
              estExt_fgenesh2_pg.C_1940045 [Brafl1:125747] 
              81% to estExt_fgenesh2_pg.C_1950037, 27% to CYP7D1
              scaffold 194 between PIGM and CLIC1 UNC93A

CYP442A9      Branchiostoma floridae (lancelet, amphioxus)
              chrUn:203694611-203697283 (-) STRAND
              estExt_fgenesh2_pg.C_510020 [Brafl1:120723]
              Scaffold 51 30% to CYP4V6
              87% to estExt_fgenesh2_pg.C_1940045
              83% to estExt_fgenesh2_pg.C_1950037
              90% to estExt_fgenesh2_pg.C_1940045|Brafl1
              87% to estExt_fgenesh2_pg.C_3320046|Brafl1
              87% to estExt_fgenesh2_pg.C_1950037|Brafl1

CYP443A1   Acropora millepora  
           96% to Acropora palmata EU541487.1

CYP443A1   Acropora palmata 
           EU541487.1 ortholog
  1 mdlfhvaelv mkghgyfykr rrkykssvfk vnmgvkgihv cdkkamkvff dmskiykepa
 61 fgrlhynicl ldgytpsmfs ngiphqkqka flveickiaq rskifdtslk likeysrnwe
121 kadsqlratw elsimdlisd ifteaflgtr ldqkymynfl kgswgkgrvl kkameaagcl
181 kqtlqgtkgs sdvieilkla vnagitedqa lmdilfmlnf nayggvsgvl r tclarlyvl
241 eedykqrmkn elktilsnke lseasleemi llhnfilevl rmhppvpvff grarddfsle
301 tecgtfivrk dqllvgnvhm ahrdssifdq pdkfmp srfe desvidhiiy gygpfhqeat
361 pqnqrcpgqd itlqilkvcl sfilqnceya ladapkwtgk rlrrigcpdk piklsyfktk
421 kqeavgplqv eem

CYP443A1    Acropora digitifera
            aug_v2a.20154.t1 scaf12319:44267-52394(+)
            96% to EU541487.1| Acropora palmata cytochrome P450 74A (CYP74A)
            97% to CYP443A1 Acropora millepora EZ012168
            36% to XM_001636310 Nematostella vect 
            35% to CYP74F1 rice in C-term part, 
            9aa insert in heme region YGYG PFHQEATPQ NHRCPG
            31% to 4. aug_v2a.20153.t1
            CYP74 clan
            note: upstream sequence is another CYP74 clan member CYP443D1

CYP443B1   Aiptasia pallida (Sea Anemone)
           GH573482.1 = CCAS1861.g1_c
           44% to CYP443A1 N-term

CYP443B1   Aiptasia pallida (Sea Anemone) 
           GH573481.1 = CCAS1861.b1_c
           45% to CYP443A1

CYP443C1   Nematostella vectensis
           FC187176.1 CAAB7309.rev opp end of FC187177.1
           FC210715.1 CAGF12396.fwd
           47% to CYP443A1, 47% to CYP443B1
           note: adjacent gene in first 4000bp of this contig is a FAM20 member
           The region in Amphioxus near FAM20 is also close to 
           PRDX1, RAD23A and AK3
           FAM20C in chicken is near PDGFA, PRKAR1B, HEATR2 and CYP2W1
           FAM20A in chicken is near PRKAR1A, WIPI1, KCNJ14
10189 NLRMCPPVPLFFGRAR (2) 10142

CYP443D1    Nematostella vectensis
            ABAV01006594.1 contains two P450s about 1kb apart both on (-) strand
            36% to CYP443A1, 33% to CYP443C1 
TRDK (0) 17406

CYP443D2   Anemonia viridis (Symbiotic sea anemone)
           71% to CYP443D1

CYP443D3   Acropora digitifera
           aug_v2a.20153.t1 scaf12319:23525-39513(+) 
           54% to CYP443D1 XM_001636310 Nematostella vectensis
           60% to CYP443D2 Symbiotic sea anemone (Anemonia viridis)
           upstresam gene similar to carnitine acetyltransferase
           [aug_v2a.20152.t1 scaf12319:10723-19622(-)]
           upstream of that is dolichyldiphosphatase 1-like DOLPP1 
           [aug_v2a.20151 scaf12319:2689-8802(+)]

CYP444A1   Trichoplax adhaerens
           CYP74 clan.a Trichoplax
           28% to CYP443A1
           36% to CYP444C1

CYP444B1P   Trichoplax adhaerens 
            CYP74 clan
            (second of 4 in a cluster) XM_002109926.1
            heme region is incomplete, no Cys

CYP444C1   Trichoplax adhaerens 
           CYP74 clan (third of 4 genes in a cluster)

CYP444D1   Trichoplax adhaerens 
           CYP74 clan (fourth of 4 genes in a cluster) 
           This gene model is fused to adjacent gene XAB2 (assembly error
           P450 part 39% to CYP441C1, 38% to CYP444A1
           All ARE ON MINUS STRAND

CYP445A1   Clytia hemisphaerica (Cnidaria; Hydrozoa)
           CU428092.1, CU430258.1, CU433515.1

CYP445A2   Clytia hemisphaerica (Cnidaria; Hydrozoa)
           CU428303.1, CU431206.1
           59% to CYP445A1

Unnamed CYP74 clan seq   Hydractinia echinata 
           32% to CYP443D1 XM_001636310Nematostella vect 

CYP3001A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001A7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B8   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001B9   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001C1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001C2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001D1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001D2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001D3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001D4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001D5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001E1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001F1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001F2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001G1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001G2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001H1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001H2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001J1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001K2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001L1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001L2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001L3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001L4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001M1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001M2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001M3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001M4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001N1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001N2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001N3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001N4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001P1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001P2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001P3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001Q1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001Q2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001Q3v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001Q3v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001R1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001R2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3001S1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3002A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3002A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A5-de1b  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A8P  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3003A9   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004C1v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004C1v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004C2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004C3P  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004D1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3004D2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A8   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A9   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A10  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A11  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A12  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A13  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A14  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A15v1  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A15v2  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A16  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A17  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A18  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A19  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A20  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3005A21  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006C1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006D1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006E1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006F1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006G7P  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3006H1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3007A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3007A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3007A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3007A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3007A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008A1v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008A1v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008A1v3 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3008B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A5   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A8   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A9   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A9-de11b12b  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A10  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A10-de6b  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A11  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A12  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A13  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009A14  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009B2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009B3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009C1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D2v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D2v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D5P  Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D6   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D7   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3009D8   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3010A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3010B1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3011A1   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3011A2v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3011A2v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3011A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A1v1 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A1v2 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A1v3 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A1v4 Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A2   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A3   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)
CYP3012A4   Ixodes scapularis (deer tick, arthropod, arachnid, ecdysozoa)

CYP3013 to CYP3015 Chronimidae sp.

CYP3016 to CYP3019  Meligethes aeneus (pollen beetle)

CYP3020 to CYP3041 Tigriopus japonicus (marine copepod)
CYP3042 to CYP3049 Brachionus koreanus (monogont rotifer)

CYP3050A1   Schistosoma mansoni (Platyhelminthes)
            No accession number
            David Williams
            Submitted to nomenclature committee April 24, 2013
            24% to CYP370A12 Daphnia pulex
            23% to CYP330A1 Carcinus maenas (shore crab) 
            probable CYP2 clan member

Note: three digit names for lower eukaryotes are reserved from CYP501-CYP699.

CYP501     Candida albicans
           no accession number see What's New of Dec. 2 on the C. albicans 
           server CYP99
           265137G06.x1.seq from the Candida albicans genome project

          3rd frame on complementary strand.  
          last 50 bases not reliable sequence.  EXXR motif shows as DTLR with 
          D probably wrong here.
          This sequence is incorrectly named as CYP99 which is a plant sequence.

CYP501A1v1   Candida albicans
             GenEMBL XM_706447
             allele of CaO19.8987 XM_706426.1 (5 aa diffs)
             best hits are to CYP504, but only low 30% range
             in CYP64 clan
             putative phenylacetate hydroxylase

CYP501A1v2   Candida albicans
             GenEMBL XM_706426.1
             allele of CaO19.1411 XM_706447 (5 aa diffs)
             Gene sequence has no introns AACQ01000193.1, AACQ01000194.1
             best hits are to CYP504, but only low 30% range
             in CYP64 clan
             putative phenylacetate hydroxylase

CYP501A2   Candida tropicalis MYA-3404 cont1.80
           GenEMBL AAFN01000033.1 
           62% to 501A1 in CYP64 clan
           putative phenylacetate hydroxylase

CYP501A3   Candida dublinensis
           89% to CYP501A1v1 Candida albicans
           See fungal pages for sequence

CYP501A4   Candida parapsilosis
           50% to CYP501A2 Candida tropicalis
           See fungal pages for sequence

CYP501B1   Candida lusitaniae
           38% to CYP501A3 with some indels removed
           See fungal pages for sequence

CYP501C1   Candida guilliermondii
           43% to CYP501A2
           See fungal pages for sequence

CYP501D1   Debaryomyces hansenii
           GenPept CAG86740.1
           45% to CYP501A2 Candida tropicalis
           See fungal pages for sequence

CYP501D2   Pichia stipitis
           JGI gene model e_gwh1.
           56% to CYP501D1 Debaryomyces hansenii
           See fungal pages for sequence

CYP502A1   Coprinus cinereus(homobasidiomycete mushroom)
           GenEMBL AB013443
           Muraguchi,H., Takemaru,T. and Kamada,T.
           The eln2 gene of the mushroom Coprinus cinereus, a dominant
           mutation of which renders the fruit-body dumpy, encodes a
           cytochrome P450 enzyme
           Unpublished (1998)
           gene name eln2

CYP502B1    Phanerochaete chrysosporium (white rot fungus)
            JGI gene model pc.5.187.1

CYP502B2   Postia placenta (brown rot basidiomycete fungi)
CYP502B3v1 Postia placenta (brown rot basidiomycete fungi)
CYP502B3v2 Postia placenta (brown rot basidiomycete fungi)
CYP502B4   Postia placenta (brown rot basidiomycete fungi)
CYP502B5   Postia placenta (brown rot basidiomycete fungi)

CYP502B6   confidential basidiomycete

CYP503A1   Gibberella fujikuroi (rice fungal pathogen)
           GenEMBL Y17243 (3090bp)
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           Malonek S, Rojas MC, Hedden P, Gaskin P, Hopkins P, Tudzynski B. (2005) 
           Functional characterization of two cytochrome P450 monooxygenase genes, 
           P450-1 and P450-4, of the gibberellic acid gene cluster in Fusarium 
           proliferatum (Gibberella fujikuroi MP-D).
           Appl Environ Microbiol. 71, 1462-1472.
           p450-4 gene

CYP503A1   Gibberella proliferatum (teleomorph sexual form)
           Fusarium proliferatum (anamorph asexual form)
           GenEMBl AJ628021
           Malonek S, Bomke C, Bornberg-Bauer E, Rojas MC, Hedden P, Hopkins P, 
           Tudzynski B. (2005) Distribution of gibberellin biosynthetic genes and 
           gibberellin production in the Gibberella fujikuroi species complex. 
           Phytochemistry. 2005 Jun;66(11):1296-1311. 
           Malonek S, Rojas MC, Hedden P, Gaskin P, Hopkins P, Tudzynski B. (2005) 
           Functional characterization of two cytochrome P450 monooxygenase genes, 
           P450-1 and P450-4, of the gibberellic acid gene cluster in Fusarium 
           proliferatum (Gibberella fujikuroi MP-D).
           Appl Environ Microbiol. 71, 1462-1472.
           Ortholog to Gibberella fujikuroi CYP503A1
           ent-kaurene oxidase"

CYP503A2  Aspergillus niger
          JGI gene model e_gw1.4.275.1|Aspni1
          54% to CYP503A1
          See fungal pages for sequence

CYP503B1  Aspergillus nidulans 
          45% to 503A1 in 54 clan
          revised 7/18/07

CYP503B2  Uncinocarpus reesii
          54% to CYP503B1
          See fungal pages for sequence

CYP503B3  Coccidioides immitis
          74% to CYP503B2 Uncinocarpus reesii
          See fungal pages for sequence

CYP503B4  Neosartorya fischeri
          92% to CYP503B1 A. nidulans
          Note: this seq does not have an ortholog in A. fumigatus
          See fungal pages for sequence

CYP503C1  Aspergillus niger
          JGI gene model e_gw1.10.655.1|Aspni1
          42% to CYP503B1
          See fungal pages for sequence

CYP503D1  Mycosphaerella graminicola
          51% to CYP503A1, 45% to CYP503B1 
          alt N-term from JGI model e_gw1.1.487.1|Mycgr3
          See fungal pages for sequence

CYP503E1   Metarhizium anisopliae var. anisopliae Ma23

CYP504A1   Aspergillus nidulans (fungus)
           GenEMBL AJ132442
           Mingot JM, Penalva MA, Fernandez-Canon JM
           Disruption of phacA, an aspergillus nidulans gene encoding a novel
           cytochrome P450 monooxygenase catalyzing phenylacetate
           2-hydroxylation, results in penicillin overproduction.
           J Biol Chem 274, 14545-50 1999
           gene name phacA

CYP504A2v1 Penicillium chrysogenum strain Wisconsin 54-1255
           GenEMBL AF056978.1
           phenylacetate hydroxylase (pahA) gene
           Rodriguez-Saiz M, Barredo JL, Moreno MA, 
           Fernandez-Canon JM, Penalva MA, Diez B.
           Reduced function of a phenylacetate-oxidizing cytochrome p450 caused 
           strong genetic improvement in early phylogeny 
           of penicillin-producing strains.
           J Bacteriol. 2001 Oct;183(19):5465-71.
           Rodriguez-Saiz,M., Barredo,J.L. and Diez,B.
           The phenylacetate hydroxylase encoding gene from Penicillium
           Unpublished 1999

CYP504A2v2 Penicillium chrysogenum strain NRRL1951
           GenEMBL AF057558
           Rodriguez-Saiz M, Barredo JL, Moreno MA, 
           Fernandez-Canon JM, Penalva MA, Diez B.
           Reduced function of a phenylacetate-oxidizing cytochrome p450 caused 
           strong genetic improvement in early phylogeny 
           of penicillin-producing strains.
           J Bacteriol. 2001 Oct;183(19):5465-71.
           Rodriguez-Saiz,M., Barredo,J.L. and Diez,B.
           The phenylacetate hydroxylase encoding gene from Penicillium
           chrysogenum NRRL1951
           Unpublished 2000
           1 amino acid difference to CYP504A2v1

CYP504A2v3 Penicillium chrysogenum strain NRRL1951
           GenEMBL AF057559
           Rodriguez-Saiz M, Barredo JL, Moreno MA, 
           Fernandez-Canon JM, Penalva MA, Diez B.
           Reduced function of a phenylacetate-oxidizing cytochrome p450 caused 
           strong genetic improvement in early phylogeny 
           of penicillin-producing strains.
           J Bacteriol. 2001 Oct;183(19):5465-71.
           Rodriguez-Saiz,M., Barredo,J.L. and Diez,B.
           The phenylacetate hydroxylase encoding gene from Penicillium
           Unpublished 2000
           Note: the species in the title does not match 
           the species in the Genbank entry
           2 amino acid differences to CYP504A2v1

CYP504A3   Aspergillus terreus
           GenEMBL AF141925.1
           Kennedy,J., Auclair,K., Kendrew,S.G., Park,C., Vederas,J.C. and
           Accessory Proteins Modulate Polyketide Synthase Activity During
           Lovastatin Biosynthesis
           Science 284, 1368-1372 1999
           lovastatin biosynthesis gene cluster
           72% identical to CYP504A2v1

CYP504A3v2 Aspergillus terreus
           6 aa diffs to 504A3v1

CYP504A4  Magnaporthe grisea
          MG04684.4  71% to CYP504A1 AACU01001145 cont2.876
          See fungal pages for sequence

CYP504A5  Fusarium graminearum
          AACM01000162.1 revised GC boundary at KLNE old name = 504A3
          See fungal pages for sequence

CYP504A6  Nectria haematococca (Fusarium solani group)
          e_gw1.24.52.1 same gene as fgenesh1_pg.scaffold_24000130
          72% to CYP504A1 Aspergillus nidulans (probable ortholog)
          85% to 504A5 Fusarium graminearum
          See fungal pages for sequence

CYP504A7  Aspergillus fumigatus Af293
          GenEMBL XP_748171.1 also
          phenylacetate 2-hydroxylase (predicted)
          85% to 504A1

CYP504A7   Neosartorya fischeri
           XM_001266358.1, XP_001266359.1 
           77% to 504A3, 97% to CYP504A7 Aspergillus fumigatus
           Name revised from CYP504A10

CYP504A8  Aspergillus oryzae
          GenEMBL BAE58419.1
          86% to 504A1, 45% TO 504B6

CYP504A8  Aspergillus flavus
          99% to CYP504A8  Aspergillus oryzae
          See fungal pages for sequence

CYP504A9  Aspergillus terreus  
          XM_001218406.1 XP_001218407.1
          79% to 504A3

CYP504A11  Aspergillus clavatus NRRL 1
           74% to 504A3

CYP504A12  Coccidioides immitis RS
           71% to 504A3

CYP504A13  Phaeosphaeria nodorum SN15
           64% to 504A3

CYP504A14  Gibberella moniliformis 
           partial cDNA DR661198 87% to 504A3

CYP504A15  Aspergillus niger
           JGI gene model fgenesh1_pm.C_scaffold_7000252|Aspni1
           88% to CYP504A8
           See fungal pages for sequence

CYP504A16  Mycosphaerella graminicola
           67% to CYP504A12 Coccidioides immitis
           See fungal pages for sequence

CYP504A17  Yarrowia lipolytica
           GenPept CAG77765.1
           49% to CYP504A6   Nectria haematococca
           See fungal pages for sequence

CYP504A18  Uncinocarpus reesii
           94% to CYP504A12 Coccidioides immitis
           See fungal pages for sequence

CYP504A19  Histoplasma capsulatum G217B
           ABBT01000061.1 Ajellomyces capsulatus G217B
           80% to CYP504A12 Coccidioides immitis
           See fungal pages for sequence

CYP504A20  Fusarium oxysporum
           85% to CYP504A5 Fusarium graminearum
           See fungal pages for sequence

CYP504A20P  Fusarium verticillioides
            96% to CYP504A20 Fusarium oxysporum = ortholog 
            with 3 frameshifts
            See fungal pages for sequence

CYP504A21   Metarhizium anisopliae var. acridum Ma102
CYP504A21   Metarhizium anisopliae var. anisopliae Ma23

CYP504A22  Grosmannia clavigera

CYP504B1   Aspergillus nidulans (fungus)
           No accession number
           Jose M. Fernandez-Canon
           61% to 504B3
           43% identical to CYP504A1, CYP504A2 and CYP504A3
           submitted to nomenclature committee Feb. 24, 2003
           revised sequence sent Sept. 21, 2005 with changed C-term

CYP504B2   Magnaporthe grisea
           MG03352.4  63% to 504B1 Aspergillus nidulans
           AACU01000699 cont2.663
           See fungal pages for sequence

CYP504B3   Fusarium graminearum
           FG06447.1 AACM01000259 FGcontig1.259_scaffold4
           See fungal pages for sequence

CYP504B4   Nectria haematococca (Fusarium solani group)
           JGI gene model e_gw1.24.45.1
           79% to 504B3 F. gram.
           43% to e_gw1.24.52.1,  66% to 504B1 Aspergillus nidulans
           See fungal pages for sequence

CYP504B5   Aspergillus fumigatus Af293
           GenEMBL XP_752247.1 also EAL90209.1
           phenylacetate hydroxylase predicted
           68% to 504B4

CYP504B5  Neosartorya fischeri
          98% to CYP504B5 Aspergillus fumigatus = ortholog
          See fungal pages for sequence

CYP504B6  Aspergillus oryzae
          GenEMBL BAE56546.1
          82% to 504B1


CYP504B6  Aspergillus flavus
          100% to CYP504B6  Aspergillus oryzae
          See fungal pages for sequence

CYP504B7  Aspergillus niger
          JGI gene model estExt_fgenesh1_pm.C_30542|Aspni1
          85% to CYP504B5
          See fungal pages for sequence

CYP504B8  Uncinocarpus reesii
          77% to CYP504B5
          See fungal pages for sequence

CYP504B9  Coccidioides immitis
          91% to CYP504B8
          See fungal pages for sequence

CYP504B10  Fusarium oxysporum
           87% to CYP504B4 Nectria haematococca
           See fungal pages for sequence

CYP504B10  Fusarium verticillioides
           98% to CYP504B10 Fusarium oxysporum = ortholog
           See fungal pages for sequence

CYP504B11  Fusarium oxysporum
           63% to 504B9 Coccidioides immitis
           FOXG_10783 revised with gc boundary at EXXR motif
           No ortholog found in Fusarium verticillioides
           See fungal pages for sequence

CYP504B12  Aspergillus clavatus
           89% to CYP504B5
           See fungal pages for sequence

CYP504B13  Aspergillus terreus
           85% to CYP504B5
           See fungal pages for sequence

CYP504B14  Mycosphaerella fijiensis
           JGI gene model fgenesh1_pg.C_scaffold_22000145
           68% to CYP504B8 Uncinocarpus reesii
           See fungal pages for sequence

CYP504B15  Metarhizium anisopliae var. acridum Ma102
CYP504B15  Metarhizium anisopliae var. anisopliae Ma23

CYP504C1   Ustilago maydis
           GenEMBL XM_399039.1 
           in the CYP64 clan 46% to 504A1
           See fungal pages for sequence

CYP504D1   Ustilago maydis
           GenEMBL XM_402689.1 
           in the CYP64 clan 48% to 504C1
           See fungal pages for sequence

CYP504E1   Nectria haematococca (Fusarium solani group)
           JGI gene model e_gw1.40.25.1
           86% to CYP504E2 Aspergillus nidulans (probable ortholog)
           86% to AAJN01000191.1 Aspergillus terreus
           72% to XM_654859.1 Aspergillus nidulans (pseudogene)
           45% to e_gw1.24.52.1, 45% to 504A1 Aspergillus nidulans
           46% to XM_743078.1 Aspergillus fumigatus
           See fungal pages for sequence

CYP504E2   Aspergillus terreus
           GenEMBL AAJN01000191.1 
           86% to 504E1
        N-term exon not clear, does not match other related genes

CYP504E3   Phaeosphaeria nodorum
           GenEMBL AAGI01000160.1 
           68% to 504E1

CYP504E4P  Aspergillus nidulans add to nomen.
           AN2347.3 76% to CYP504E2
(gap 40 aa)

CYP504E5  Aspergillus niger
          JGI gene model gw1.9.669.1|Aspni1
          84% to CYP504E1 aa 219-331
          See fungal pages for sequence

CYP504E6  Aspergillus niger
          JGI gene model e_gw1.112.2.1|Aspni1
          84% to CYP504E2 aa 279-590
          See fungal pages for sequence

CYP504E7  Mycosphaerella graminicola
          JGI gene model gw.1.2625.1 revised N-term
          71% to CYP504E1   Nectria haematococca
          See fungal pages for sequence

CYP504E8P Mycosphaerella graminicola
          JGI gene model gw1.9.803.1|Mycgr3 N-term piece
          68% to 504E7
          See fungal pages for sequence

CYP504E9P Mycosphaerella fijiensis
          76% to CYP504E7 Mycosphaerella graminicola
          See fungal pages for sequence

CYP504E10  Grosmannia clavigera

CYP504F1   Nectria haematococca (Fusarium solani group)
           JGI gene model fgenesh1_pg.scaffold_33000056
           44% to CYP504B1 Aspergillus nidulans
           See fungal pages for sequence

CYP504G1   Candida guilliermondii
           38-39% to many CYP504 sequences, 
           also 39% to CYP5054A1 and 41% to CYP5054A2
           See fungal pages for sequence

CYP504H1   Metarhizium anisopliae var. anisopliae Ma23
CYP504J1   Metarhizium anisopliae var. anisopliae Ma23

CYP505A1   Fusarium oxysporum
           GenEMBL AB030037
           Naoki Takaya and H. Shoun
           P450foxy, a fused reductase-P450 similar to CYP102

CYP505A1   Fusarium oxysporum 
           98% to CYP505A1 Fusarium oxysporum AB030037, 
           only 13 aa diffs
           See fungal pages for sequence

CYP505A1   Fusarium verticillioides
           98% to CYP505A1 Fusarium oxysporum CYP505
           See fungal pages for sequence

CYP505A2   Neurospora crassa
           No accession number
           Neurospora crassa sequence contig 1.388  (supercontig 50)   
           9a27.tfa_140cg@9A27 like P450foxy
           58% identical to 505A1 over 505 aa N-term part
Neurospora crassa sequence contig 1.388 (supercontig 50) Length = 87086
Start of reductase part

CYP505A2   Neurospora discreta
           JGI gene model estExt_fgenesh3_pm.C_120016
           95% to CYP505A2 N. crassa
           See fungal pages for seq

CYP505A3   Aspergillus oryzae
           GenEMBL AB078738
           Masahiko Kaya
           Aspergillus oryzae fatty acid hydroxylase
           Submitted to nomenclature committee Jan. 22, 2002
           58% to CYP505A2
           55% to CYP505A1
           a fused reductase-P450 similar to CYP102

CYP505A3   Aspergillus oryzae
           GenEMBL BAC55896.1, BAE56963.1

CYP505A3  Aspergillus flavus
          99% to CYP505A3 Aspergillus oryzae 4 aa diffs
          See fungal pages for seq

CYP505A4  Magnaporthe grisea
          MG05401.4  53% to CYP505A2 AACU01000504 cont2.993
          See fungal pages for seq

CYP505A5  Magnaporthe grisea
          MG01925.4  55% to 505A2 AACU01000373 cont2.362
          See fungal pages for seq

CYP505A6  Magnaporthe grisea
          MG10879.4  59% to 505A2 AACU01001802 cont2.2099
          See fungal pages for seq

CYP505A7  Fusarium graminearum
          FG01972.1 AACM01000107 FGcontig1.107_scaffold1
          See fungal pages for seq

CYP505A8  Aspergillus nidulans
          AN6835.1 55% to 505A1 505 clan
          See fungal pages for seq

CYP505A9   Nectria haematococca (Fusarium solani group)
           JGI gene model fgenesh1_pg.scaffold_12000374 [Necha1:90392]
           77% to 505A7, 79% to CYP505A1 Fusarium oxysporum
           See fungal pages for seq

CYP505A10P Nectria haematococca (Fusarium solani group)
           JGI gene model fgenesh1_pg.scaffold_160000001
           74% to CYP505A9 pseudogene exon 1 only

CYP505A11  Nectria haematococca (Fusarium solani group)
           JGI gene model fgenesh1_pg.scaffold_53000030 [Necha1:96758]
           59% to 505A7, 60% to 505A1
           58% to fgenesh1_pg.scaffold_12000374 
           See fungal pages for seq

CYP505A12  Nectria haematococca (Fusarium solani group)
           JGI gene model fgenesh1_pg.scaffold_23000101 [Necha1:93347]
           57% to 505A7, 56% to 505A1
           57% to fgenesh1_pg.scaffold_12000374
           Note: unusual exon 1 codes for 2 amino acids, this matches with
           other CYP505 sequences. 
           See fungal pages for seq

CYP505A13  Aspergillus fumigatus Af293
           GenEMBL XP_754698.1 also EAL92660.1
           fatty acid hydroxylase predicted
           60% to 505A8

CYP505A13  Neosartorya fischeri
           97% TO CYP505A13  Aspergillus fumigatus = ortholog
           See fungal pages for seq

CYP505A14  Aspergillus oryzae
           GenEMBL BAE56245.1
           61% TO 505A3
           revised 3/19/2009

CYP505A14  Aspergillus flavus
           99% to CYP505A14  Aspergillus oryzae
           See fungal pages for seq

CYP505A15  Aspergillus niger
           JGI gene model fgenesh1_pm.C_scaffold_7000162|Aspni1
           72% to CYP505A13
           See fungal pages for seq

CYP505A16  Fusarium oxysporum
           57% to CYP505A12 Nectria haematococca
           no ortholog in F. verticillioides
           See fungal pages for seq

CYP505A17  Fusarium oxysporum
           86% to CYP505A11
           See fungal pages for seq

CYP505A18  Aspergillus clavatus
           87% to CYP505A13 Aspergillus fumigatus
           See fungal pages for seq

CYP505A19  Aspergillus terreus
           65% to CYP505A18
           See fungal pages for seq

CYP505A20  Mycosphaerella fijiensis
           JGI gene model e_gw1.27.10.1
           55% to CYP505A9 Nectria haematococca
           See fungal pages for seq

CYP505A21  Metarhizium anisopliae var. acridum Ma102
CYP505A21   Metarhizium anisopliae var. anisopliae Ma23

CYP505A22  Grosmannia clavigera

CYP505A23  Cryphonectria parasitica

CYP505A24  Cryphonectria parasitica

CYP505A25  Trichoderma reesei

CYP505A26  Stagonospora nodorum

CYP505A27  Cochliobolus lunatus

CYP505A28  Ophiostoma novo-ulmi

CYP505A29  Macrophomina phaseolina

CYP505A30  Myceliophthora thermophila 
           GenPept AEO58402

CYP505B1   Fusarium verticillioides (Gibberella moniliformis, synonym)
           No accession number
           Jeong-Ah Seo and Robert H. Proctor
           Gene name FUM6 a second fused reductase-P450 similar to CYP102

CYP505B1   Gibberella moniliformis (Fusarium verticillioides, synonym)
           GenEMBL AF155773 
           Proctor,R.H., Seo,J.-A. and Plattner,R.D.
           Characterization of four clustered and coregulated genes associated
           with fumonisin biosynthesis in Fusarium verticillioides
           100% identical to 505B1 above after 1st exon, same authors, same gene
           part of a 15 gene fumonisin biosynthetic cluster 

CYP505B2  Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_1000650|Aspni1
          62% to CYP505B1
          See fungal pages for seq

CYP505C1  Magnaporthe grisea
          MG07953.4  42% to 505A1
          AACU01000977 cont2.1474
          See fungal pages for seq

CYP505C2  Fusarium graminearum
          FG07596.1 AACM01000315 FGcontig1.315_scaffold4
          See fungal pages for seq

CYP505C3  Aspergillus oryzae
          GenEMBL BAE63564.1
          54% to 505C2, 50% to 505A8, 45% to 505A3, 47% to 505B1

CYP505C3  Aspergillus flavus
          99% to CYP505C3 Aspergillus oryzae
          See fungal pages for seq

CYP505C4  Aspergillus flavus
          46% to CYP505C3
          Note: this seq has no ortholog in A. oryzae
          See fungal pages for seq

CYP505D1    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model ug.73.17.1

CYP505D2    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.73.4.1

CYP505D3    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model ug.73.15.1

CYP505D4    Phanerochaete chrysosporium (white rot fungus)
            JGI geme models ug.73.16.1 and pc.73.11.1

CYP505D5    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.73.14.1

CYP505D6    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model pc.17.40.1

CYP505D7    Phanerochaete chrysosporium (white rot fungus)
            JGI geme model gx.187.5.1
            Partial, needs more work

CYP505D8v1 Postia placenta (brown rot basidiomycete fungi)
CYP505D8v2 Postia placenta (brown rot basidiomycete fungi)
CYP505D9   Postia placenta (brown rot basidiomycete fungi)

CYP505D10  confidential basidiomycete
CYP505D11  confidential basidiomycete
CYP505D12  confidential basidiomycete
CYP505D13  confidential basidiomycete

CYP505E1  Aspergillus niger
          JGI gene model fgenesh1_pg.C_scaffold_3000014|Aspni1
          77% to CYP505E2, 48% to CYP505C3
          See fungal pages for sequence

CYP505E2  Neosartorya fischeri
          ~77% to CYP505E1
          Note: this seq does not have an ortholog in A. fumigatus
          one stop codon
          See fungal pages for sequence

CYP505E3  Aspergillus terreus NIH2624
          79% to CYP505E2
          See fungal pages for sequence

CYP505F1  Mycosphaerella graminicola
          JGI model estExt_fgenesh1_pm.C_chr_30459 [Mycgr3:99701] 
          JGI model Mycgr3/chr_3:2874198-2877434
          47% to CYP505A1   AB030037 Fusarium oxysporum
          49% to CYP505A2   N. crassa, 52% to 505A13 Aspergillus fumigatus
          52% to CYP505G1 in this genome
          See fungal pages for sequence

CYP505G1  Mycosphaerella graminicola
          JGI gene model estExt_fgenesh1_pm.C_chr_70227 [Mycgr3:100796] 
          JGI gene model Mycgr3/chr_7:1478709-1482337
          52% to CYP505F1 in this genome, 46% to 505A1 Fusarium oxysporum
          See fungal pages for sequence

CYP505G2P Fusarium verticillioides
          53% to CYP505G1, pseudogene, 
          possible orthoog of CYP505G1 Fusarium oxysporum
          See fungal pages for sequence

CYP505H1  Fusarium oxysporum
          46% to CYP505B2
          See fungal pages for sequence

CYP505H1  Fusarium verticillioides
          94% to CYP505H1 Fusarium oxysporum = ortholog
          See fungal pages for sequence

CYP505J1  Aspergillus clavatus
          46% to CYP505A15
          See fungal pages for sequence

CYP505K1  Mycosphaerella fijiensis
          JGI gene model e_gw1.1.1150.1
          48% to CYP505A2 N. crassa
          See fungal pages for sequence

CYP505L1  Mycosphaerella fijiensis
          JGI gene model estExt_fgenesh1_pg.C_180062
          46% to CYP505A2   N. crassa
          46% to CYP505K1 Mycosphaerella fijiensis
          See fungal pages for sequence

CYP505M1   Metarhizium anisopliae var. anisopliae Ma23

CYP506A1   Fusarium oxysporum
           GenEMBL X82490
           Mouyna,I. and Brygoo,Y.
           Disruption of a Fusarium oxysporum f.sp. elaeidis cytochrome P450
           gene by a repetitive sequence.

CYP506A1   Fusarium oxysporum
           93% to CYP506A1P rev Gibberella moniliformis
           See fungal pages for sequence

CYP506A1P  Gibberella moniliformis 7600
           GenEMBL AAIM01003201.1 
           Note this seq has only 1 aa diff to 506A2 at 10017, 
           but then a large gap
           Like a pseudogene
           77% to 506A2
           formerly CYP506A3P
           also = Fusarium verticillioides FVEG_09850
10845  SQRFNSPDL (1)

CYP506A2   Fusarium graminearum
           AACM01000093 Gibberella zeae
           See fungal pages for sequence

CYP506-un1  Nectria haematococca (Fusarium solani group)
            JGI gene model gw1.28.129.1
            pseudogene probably from a CYP506 sequence, subfamily not assigned
            35% to 506A2 mid to heme, 38% to CYP506A3P Gibberella moniliformis
            the top part of this seq seems to be missing
            See fungal pages for sequence

CYP507A1   Neurospora crassa
           GenEMBL AA902084, AA902085, AA902086
           Nelson, M. A., Kang, S., Braun, E. L., Crawford, M. E., Dolan, P. L., 
           P. M., Mitchell, J., Armijo, A. M., Bean, L., Blueyes, E., Cushing, 
           T., Errett, A., 
           Fleharty, M., Gorman, M., Judson, K., Miller, R., Ortega, J.,
           Pavlova, I., Perea, J., Todisco, S., Trujillo, R., Valentine, J., 
           Wells, A., Werner- 
           Washburne, M., Yazzie, S., and Natvig, D. O. 
           Expressed sequences from conidial, mycelial and sexual stages of 
           Neurospora crassa. 
           Fungal Genetics and Biology 21, 348-363 (1997).
           Neurospora genome project
           Sequence data
           most like CYP57A1 (36% over 129 amino acids)
           NM1B1-T7, NC4D11-T7 and NM1D12-T7

CYP507A1   Neurospora crassa
           No accession number
           Neurospora crassa sequence contig 1.80   (supercontig 10)

CYP507A1   Neurospora discreta
           JGI gene model estExt_fgenesh2_pg.C_170074
           89% to CYP507A1 N. crassa
           See fungal pages for seq

CYP508A1    Dictyostelium discoideum (cellular slime mold)
            GenEMBL 16 ESTs C92049, C89925, C90052, C91122, C25600
            C94043, C94448, AU034703, AU033852, AU037735, AU034252
            AU037979, C92378, C24684 and clones SSC755, SLJ668 from 
            The Tsukuba dictyostelium genome project.  
            31% identical to fish 1A sequences and CYP73 sequences

CYP508A2     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 22+45+69+86+88

CYP508A3     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 21+67+72+82+87

CYP508A4     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 66+70

CYP508B1     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 15+77

CYP508B2P    Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 60

CYP508C1     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 4+23+24+83

CYP508D1     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 59+81

CYP508E1     Dictyostelium discoideum (cellular slime mold)
             See lower eukaryote section for accessions and sequences
             Formerly seq 71+85

CYP509A1     Cunninghamella elegans  (a fungus)
             GenEMBL AF249299
             Wang,R.F., Cao,W.W., Khan,A.A. and Cerniglia,C.E.
             Cloning, sequencing, and expression in Escherichia coli of a
             cytochrome P450 gene from Cunninghamella elegans
             FEMS Microbiol. Lett. 188 (1), 55-61 (2000)
             Submitted to nomenclature committee Feb. 29, 2000

CYP509B1     Rhizopus oryzae RA 99-880 (Zygomycete fungus, Mucoromycotina)
             GenEMBL AACW02000089.1
             43% to CYP509A1 
        GLFASPTIQGWVSIHLNSNHEIPSIEHT (instead of the third exon above)
        GFDFHAIEDKE  290807
290298  KELDYINMIIKE (0) 290263

CYP509C1 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         in CYP56 clan 
         93% to P450-33, 90% to P450-30var1, 89% to P450-31, 87% to P450-34_var1
         87% to P450-29, 84% to P450-7_var1, 65% to P450-39, 59% to P450-36
         56% to P450-42, 53% to P450-20a, 53% to P450-12, 40% to 509B1 =P450-15, 
         38% to CYP509A1
         See fungal pages for seq

CYP509C2 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         93% to P450-32 in CYP56 clan
         See fungal pages for seq

CYP509C3 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         87% to P450-29 in the CYP56 clan
         See fungal pages for seq

CYP509C4 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         89% to P450-30var1 in the CYP56 clan
         See fungal pages for seq

CYP509C5 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         87% to P450-32 in CYP56 clan
         See fungal pages for seq

CYP509C6 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         in the CYP56 clan 
         83% to P450-7_var1
         See fungal pages for seq

CYP509C7P Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          37% to CYP509B1 Rhizopus oryzae, in the CYP56 clan
          P450-7_var1 has a stop codon in the I-helix
          86% to P450-33, 85% to P450-32, 84% to P450-30var1, 84% to P450-31
          84% to P450-29, 83% TO P450-34_var1, 62% TO P450-39,
          58% TO P450-36, 53% TO P450-20a, 55% TO P450-42, 53% TO P450-12
          See fungal pages for seq

CYP509C8 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         66% to P450-33 in CYP56 clan
         See fungal pages for seq

CYP509C9 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
         60% to P450-33 in CYP56 clan
         See fungal pages for seq

CYP509C10 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          60% to P450-36 in the CYP56 clan
          See fungal pages for seq

CYP509C11 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          62% to P450-12, in the CYP56 clan 35% to 509B1
          See fungal pages for seq

CYP509C12 Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
          52% to P450-7_var1 in the CYP56 clan, 36% to 509B1
          See fungal pages for seq

CYP509C13P Rhizopus oryzae (Zygomycete fungus, Mucoromycotina)
           53% to CYP509C10
           45% to CYP509C9 in the CYP56 clan
           AACW02000137.1 (-) strand
           See fungal pages for seq

CYP509C14  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
           JGI gene model fgeneshPB_pg.49__3
           40% to CYP509C4 Rhizopus oryzae
           first amino acid is I = ATA instead of M = ATG
           conserved location for M in CYP509C15 and CYP509C16
           See fungal pages for seq

CYP509C15  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
           JGI gene model e_gw1.3.167.1
           67% to CYP509C14 Phycomyces blakesleeanus
           See fungal pages for seq

CYP509C16  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
           JGI gene model fgeneshPB_pg.3__395 revised
           67% to CYP509C14   Phycomyces blakesleeanus
           See fungal pages for seq

CYP509C17  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
           JGI gene model e_gw1.3.168.1
           76% to CYP509C14   Phycomyces blakesleeanus
           See fungal pages for seq

CYP509D1  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model fgeneshPB_pg.25__98
          49% to CYP509B1 Rhizopus oryzae over the last 405 aa region
          See fungal pages for seq

CYP509E1  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model e_gw1.11.60.1
          43% to CYP509D1 Phycomyces blakesleeanus
          See fungal pages for seq

CYP509F1  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model e_gw1.20.54.1
          51% to CYP509D1 Phycomyces blakesleeanus
          See fungal pages for seq

CYP509F2  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model e_gw1.20.55.1
          53% to CYP509F1, 53% to CYP509F3
          See fungal pages for seq

CYP509F3  Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model fgeneshPB_pg.20__100
          54% to CYP509F1 Phycomyces blakesleeanus
          See fungal pages for seq

CYP509F4P Phycomyces blakesleeanus (Zygomycete fungus, Mucoromycotina)
          JGI gene model fgeneshPB_pg.20__103
          54% to CYP509F3 Phycomyces blakesleeanus
          See fungal pages for seq

CYP510A1     Lentinula edodes (a basidiomycete fungi)
             GenEMBL AB045779 
             Akiyama,R., Sato,Y., Kajiwara,S. and Shishido,K.
             Cloning of novel Cytochrome P450 gene family from Basidiomycete
             Lentinus edodes
             Submitted to nomenclature committee July 17, 2000 

CYP510A2P    Lentinula edodes (a basidyomycete fungi)
             GenEMBL AB015310 
             Partial sequence called SHP1 for small heme binding protein
             This is clearly part of a P450.  It appears to be 
             Interrupted by an insertion so it is a pseudogene
             About 70% identical to 510A1

CYP510A3     Lentinula edodes (a basidiomycete fungi)
             GenEMBL AB049963 (still confidential on Feb. 14 2001)
             Susumu Kajiwara
             Submitted to nomenclature committee Feb. 12, 2001 
             Clone name Le. CYP2 (499 aa)
             67% to 510A2P 87 % identical to 510A1
             100% identical to 510A1 from 286-483

CYP511A1     Botrytis cinerea (a plant-pathogenic fungus infecting over 200 
             plant species)
             GenEMBL AL114463.1, AL113894.1, AL112730.1
             These cDNAs overlap and cover most of the intact sequence
             Bettina Tudzynski
             Submitted to nomenclature committee Nov. 20, 2000

CYP511A1     Botryotinia fuckeliana strain T4
             GenEMBL AY277723
             Viaud,M., Brunet-Simon,A., Brygoo,Y., Pradier,J.-M. and Levis,C.
             Cyclophilin A and calcineurin functions investigated by gene
             inactivation, cyclosporin A inhibition and cDNA arrays approaches
             in the phytopathogenic fungus Botrytis cinerea
             Mol. Microbiol. 50 (5), 1451-1465 (2003)

CYP511A2P    Fusarium oxysporum
             44% to CYP511A1 Botrytis cinerea, N-term, cannot find whole seq
             78% to CYP511A2P Fusarium verticillioides, 
             probable ortholog of the pseudogene
             See fungal pages for seq

CYP511A2P    Fusarium verticillioides
             78% to CYP511A2P Fusarium oxysporum
             probable ortholog to CYP511A2P Fusarium oxysporum
             See fungal pages for seq

CYP511A3     Metarhizium anisopliae var. acridum Ma102
CYP511A3     Metarhizium anisopliae var. anisopliae Ma23

CYP512A1     Coriolus versicolor (a Basidiomycete fungus)
             GenEMBL  AB057426
             Ichinose,H., Wariishi,H. and Tanaka,H.
             Identification and characterization of novel cytochrome P450 genes
             from the white-rot basidiomycete, Coriolus versicolor
             Appl. Microbiol. Biotechnol. 58 (1), 97-105 (2002)
             Submitted to nomenclature committee Feb. 14, 2001
             Clone name P450Cv365
             Most similar to AL355928.2|NCB1D4 Neurospora crassa unnamed P450
             (35% over 364 amino acids) 16/17 identical amino acids at heme 
             signature region.  This same region also conserved in 
             CYP54 from Neurospora crassa

CYP512A2   confidential basidiomycete
CYP512A3   confidential basidiomycete
CYP512A4   confidential basidiomycete
CYP512A5   confidential basidiomycete
CYP512A6   confidential basidiomycete
CYP512A7   confidential basidiomycete
CYP512A8   confidential basidiomycete
CYP512A9   confidential basidiomycete
CYP512A10P confidential basidiomycete
CYP512A11  confidential basidiomycete
CYP512A12P confidential basidiomycete
CYP512A13  confidential basidiomycete

CYP512B1    Phanerochaete chrysosporium (white rot fungus)
            JGI geme models pc.30.92.1 and genewise2nd.30.46.1