Phanerochaete chrysosporium cytochrome P450s
 
149 named intact gene sequences 
10 named pseudogenes
 
D. Nelson 
August 16, 2007
 
>CYP51F1 ug.2.6.1(CYP51) 
MSLSQYGPIAGLVGQAYDALASMSTSRLVLFLLINIPILSVVCNVIYQLLPKDK
SLPPVVWHWFPWFGSAAAYGEDPIKFFFDCKEKYGNVFTFILMGRKVTVALT
PAGNNFIMGGKHTTFSAEEVYGGLTTPVFGKDVVYDCPNELLMEQKKFVKF
GLSTENFRQYVGMIEEEVLQFMRNDASFKIYQMNDINEWGAFDVLKVMSEIT
ILTASRTLQGKEVRANITKDYAQVYNDLDGGFTPLHFMFPNLPLESYRKRDA
AHKKISDFYISIIRKRRENPGQEEHDMIAALMNQKYRVGRPLKDHEIAHIMIAL
LMAGQHTSSATGSWALLHIADRPDVAEALYEEQVKHFRQSDGSWRTPEYEE
LKELPVLDSVIRETLRIHPPIHSIMRAVREDVVVPPTLAAPSEDGRYVIPKGHV
VLSSAAISQVDPMLWKNANDWDPSRWSDPEGVAAQAYKQYDDAEGAKVDF
GFGLVSKGTDSPYQPFGAGRHRCIGEQFAYLQLGTIISTFVRHVEMRLPETGV
PPPNYHAMITLPKAPRNILYRRRNFD
 
>CYP53C2 ug.1.19.1= pc.1.261.1

 

MAVIEALTQLDLKSWLLLIPALAIVAHILIWLLDPHGIRSYPGPLLAKFSDAWL

GYVAAQGHRSEVVHDLHKQYGTFVRIAPNHLSIADPDALQVVYGHGTGTLK

SNFYDAFVSIQRGLFNTRSRSEHARKRKIVSHIFSQKSVLEFEPHVRLYVKQLI

QQWDRLYEAGAKGLVWLDCLPWYNYLAFDIIGDLAFGAPFGMLLAARDAA

PVAVDHEQAMASYGKEKSEVQYIPAVQVINDRGTYSASLGVLPPWMRPIVKL

FPWFRRGQKAVKQLAGIAVAAVAQRLTTPTDRVDLLGKLQEGRDDDGNLM

GKEELTAEALTQLIAGSDTTSNSSCAITYYLAKYPDAQRKLQQELDEALGSDD

EPVSTFDQVKRLPYLQAVIDEALRIHSTSGIGLPRLVPKGGMTVCGRFFPEGTV

LSVPTYTIHRDEEVWGKDPEVFRPERWFEQDKNAVQKTYNPFSFGPRSCIGRN

LANMELLIIVSSILRRYDF

VLEDPDKPFDTMEGFLRKPVECVVGIRRRTL

 

>CYP61A1 ug.78.18.1(CYP61) 
MASSQAAFPSTLSDSSRHSTDSPAFIGLLPTGSWFYTTAAILLSLLVIEQSVYRY
KKRHLPGDKWTIPLIGKFADSMKPTMEGYMKQWNSGALSAISVFNVRFIVM
ASTTEYARKILNSPTYAEPCLVHSAKQIILPDNWVFLTGKEHVEYRRGLNLLF
TRKALGYVLQYCLVLYAMLTHRRSLYLGIQDVITRKHFAKWLADAAKDPSA
KPIMMTARELNMETSLRVFCGNHIPEHGAKEISDKYWMITVALELVNFPLAIP
GTKVYNAIQARKAAMKWLELAARKSKESVAAGNPPECMLEEWVTILNDPAY
KGRREFSDHEMAMVVFSFLFASQDAMSSGLIYGFQHLADHPEVLAKVREEQE
RVRGGDYEKPLTLEMMDEMPYLRAMVKETLRVKPPVTMVPYKTTKAFPISQ
DYTVPSGSMVIPSFYNSLHDPAVFPDPDRFMPERWLDPNGSANTNPRNYLVF
GSGPHKCIGLEYAMMNIALVLANAAVLMNWEHELTPQSDKVQIIATLFPQDG
CKLKFSPRQHA
 

>CYP63A1 PC-1(ug.20.36.1)

MGLTQAQRLVLGQLARLVAPALAVCVLLAAARRTQLVRAPVWADALIALIA

IPLFHVGRAHWRYARLARKAARLGAALPPRWEGKLPGSVDVLQLVDEAYRR

GFLSDYFYEKFGELGHTYNFYVLWDMDYCTEDAAVIKAVLATDFNNWVKG

ERFDSYMHSVLGTGVFNADGELWKFHRSMTRPFFARERITDFETFNRHAEEAI

LKMKERLREGFAVDFADLISRFTLDAATEFLFGACVHSLAGALPYPHGAPAH

LHTTRARIPADDFAAAFRAAQDAVSHRARLVWLWPWFELARSRTDTPMRTV

DRYLTPIIERAL

AMSRAAKQAPQGEKEEVADGETLLDHLARYTTDPTILHDEILNIMIAGRDTTG

GTLTFVIYFLTQHPDVLQRLRQEILDVVGPSNLPTYDDIKQMKYLRAVLNETQ

RLYPPVPWNMRYAVEDSIVPNSEPEGKPWFIPAGASVSYSVHCMHRRKDYW

GPDAEEFDPDRFLDERLHKYLTPNPFIFLPFNAGPRICLGQQFAYNEMSFFLVK

LLQTFEDISFERDAFEPNALPPAEWAKFPGRKGKEKFWPRAHLTLYSEGGMW

VKMREAQAMGQVA

 

>CYP63A2 PC-2(ug.20.35.1)

MLVSVDALALRTLVYELTYLLYPAVPTAAALILLQRFGNVWLPTWTIVLLSL

CNVPVAHRILVWLKDGRAARKAASMGAILPPRLKGRWPGSIDLLRQLTQTFE

TGFLSEMLWGYMHVLGQTFEVYILWDSNYVTSDANVIKTILATDFDNFVKGE

KLDVCVRPVLGTGVFNSDGEMWKFHRSMTRPFFTRERISHFDLFDRHADAT

MAKMKARLAEGFAVDFQDLISRFTLDSATEFLFGQCVHSLASVLPYPHDAPA

HLQTTGASRTEDFARAFAEAQDAVSFRLRMGWLWPWFELFGSRTKAPMAV

VDAFLDPILRDAVARADKIKRENGGRVPEVKGEIEEDETLLDHLVNVVQTKIL

HDEVLNIMIAGRDTTGGTLTSAVYFLSQYPEVLRRLREEILEKVGPTRRPTYD

DIREMKYLRAFINETLRLYPAVPWNVRYPVKDTTIPGPHPDKPYFIPANTPVSY

SVHCMHRRTDYWGPDAEAFDPDRFLDARVQRYLTPNPFIFLPFNAGPRICLG

QQFAYNEMSFFVIRLLQHFDEVQLCEDALAPDCRVPDAWRGAPGRKGVERF

WPKAHLTLYAKGGLWVKMREASTSEAVV

 

>CYP63A3 PC-3(ug.20.34.1)

MPSSIDFPDRLVLRVIAYELVFLFYPAVPAAAGLVLLRRLTDIWLPTWAIVLLS

VCSLPVVHGLSIWRNHWRAARKAARMGAVLPPRLKGRWPGSIDLLMRLTDA

FETGFMSDLLWEYMHTIGQTFEVYVLWDSNYVTSDANVVKAILATDFTSFVK

GKK

FDVCMRSVLGTGVFNSDGDMWKFHRTMTRPFFTRERISHFDLFDRHADDAM

AKMKARFAEGYAVDFQDLISRFTLDSATEFLFGQCVHSLASVLPYPHNAPAH

LQTTSASAAEDFARAFAEAQTVLNFRIRMGWLWPWFELFGSRTKAPMAVVD

AFLDPI

LKAAVERADQIKHENGGKVPEAKEEIDEDETLLDHLVKYTNDPKILHDEVLNI

MIAGRDTTAGTLTSAVYFLSQYPEVLRRLREEILEKVGPTRRPTYDDIREMKY

LRAFINETLRLYPAVPWNVRYPVKDTTIPGPEPDKPYFIPANTPVSYSVHCMH

RRTDYWGPDAEAFDPDRFLDARVQRYLTPNPFIFLPFNAGPRICLGQQFAYNE

MSFFVIRLLQHFDEVQLCEDALAPDCRVPDAWRGAPGRKGVERFWAKAHLT

LYAKGGLWVKMREAPTSEAV

 

>CYP63A4 PC-4(pc.151.16.1)

MALPPGLQYLLPQLPLLLAPPAAVLLAAHAARAFAGTAAPAWALALACVLS

WPVALTALVQLRAHRVAREAAARGARLPPAVEARYPGGVDLMRRNNSEVE

EHIPGYRLSEFGRQYGWTYNFRMLFQDRVRGRPRPRPPGRILATDFTSYEKGA

VFSAQMKSLLGTGVFNADGDLWKFHRAMTRPFFSRDRISHFDVFDRHAEDA

LKLAKARLSEGVPIDWQDLVSRFTLDSATEFLFGQDVRSLSAPLPHPPTAPQA

QHDTHDAEHPANRFAHAFLQAQLASARRSRYTAAWPLWEFWENKVEKHTR

VMDEFIQPLLRDALARKAKGADAQAEEAVADGETLLEHLVKLTDDPQIIHDE

TLNILLAGRDTTAITLTMAGYMLAEHPDILQRLRKEILDTVGTRRPTYDDIRD

MKYLRAFINEVLRMYPPVPFNVRFSTAPTVWPSPEGDFYVPAGTRCMYSVFV

MHRRKDLWGPDADKFDPDRFLDERLGKYLTPNPFIFLPFNAGPRICLGQQFA

YNETSFMLIRLLQRVSKIELHPEVSPQSVAPPGWAASSISDGKDKVVFKSHLT

MYVQGGLWVTMQFENPEEH

 

>CYP63B1 PC-7(genscan.57.18.1) (genewise.57.16.1) 

MPHPFSRYRLRVFGDFVRIVLAPSFVFWSAVQILKLRLGLLSPAAWLTFLFAA

SYARVQYRGFLQRQEARRRGGVLPPEVVGRWPGNIDILIKLGKASLTAYPGSF

YLDLFEEYQSTTLNLKLLWSDLVRCLSFCRLSAVLKTLSQIITMDEEHIKHILT

TGFNHFWRGRRQKERMYAPSGASRRHDTDSQGDVSQEWKKHRALARPFFA

RDRISDFDLFEKYAGATLGILGGLAGRGAAVDVQDLYARFTLDAAAEFLFGE

RLDTLHGALPVAGQAKLGSKGAATDDAFGAFVRAFEASQDIITTRQVRGYFW

PVRELFQDKVAPHAAVIGAFLEPIVQRTLDRKAKMRAAGVSPTTEHDTFLDY

LADHTEDPKVIRDQLLNILMAGRDTTACLLTYVTYVMAMYPDIMQKMRQEV

LHVCGHDAPNFEKLKALRYVHAVLNETLRVFPPVPMNVREVRARGVVLPHA

DPTYAAAPAPLYVPGGTVVMYLPVLTQRNTALWGDDADVFDPDRWLDARL

RRFTENPMMYTPFSGGPRICIGQNYARNEATYLLVRLLQQFDAVALAPEAQP

AGSLPPPEWRHARGRAAEERIWPAYAITLYVKVRLSLQWLYC

 
>CYP63C1 PC-5(pc.101.32.1) 

MELHPRQYRLRFLLDVLRAIVWPQLVFNAALYLAGFHPGAFLRVVASVLAVP

LLGTVRTAISQRRNKIQAGAALGAKEVPCVRGKWPGNLDIVLGFVRSLKEAY

LMQFLDDLFREYDCKTLNMRLLWEDQIWTIDEAHVRYMLAGPGFEWFHKG

YYWQERMESFLGNGIFNRWAQRAIARPWFVKDRISDLNIFDRHTTTTLALISE

FVDRREAFDAQDLFARFTLDSASEFLFGRCLDTLHGTLPVAGRAKMGPKGTA

IEDAFGSFARAFEDVQVQIARRTRIGKPWPLFELFTDKTAPSVAVIHDWLRPIV

HEALAKKSAASAEKESGEDSTFLSHLANSTDDPQDIAYSVLNMLLAGRDTTA

SVLSFVVYFLALHPHVTEKLRAEILQAYGPDGRPSVEDMKDLKYVRAVLNET

MRLFPPVPMNLRLSDAHPRIFPASGSAPKYYVAPRTVILYSIFLVQRRTDLWG

ADALEFRPERWLEPATARLLADHPFAFTPFHAGPRLCLGQNFAYNEMTFFIVR

LLQRVSGFELAPDAQPEGSLPPARWKYGEGRQAVEKIWPASSVTTFIKVSLAS

MPCCGERWLKRRRQGGLWVRAVPA

 

>CYP63C2 PC-6(pc.101.28.1) 
 

QRAIARPWFAKDRISDLNIFDRHTSTTLALIADFADRREAFDAQDLFARFTLDS

ASEFLFGKCAETLHGTLPVAGRAKLGPKGSSVEDEFGSFAWAFEELFHDKTA

KHRKVIQDWLQPIVREALHSKAAAARGEDTGEGTFLSHLTKTTDDPQDIAYSI

LNMLLAGRDTTAAALSFTVYLLALHPEVVEKLRAEVVQAYGSDGRPSVEDM

KSLKYLRAVLNETMRLFPPVPLNIRTSDDTPRVFPASAGAPKYYVPPRTPVVY

SSVIIQRRKDLWGADALDFRPERWLEPETARRLAENPFMFMPFHAGPRLCLG

QNFAYNEMSFFVVRLLQRVAALELAPDAQPEGSLPPARWKNGEGRQAVEKI

WPGSSVTTYIKVSSTRSRPCG

 

>CYP502B1 pc.5.187.1  

MDTVLVGLFVALALYAWSRSSKRSALPVPPGPKPVPLLGNIFDLTAKELWLR

VTGWSKQYDIVYIHLLGQGLVFCNTYEVAQDLLEKKGSIYSDKCGCQNMVA

FTRYGDFARRQRKLMNTAFGISAVKRYRPLLANESVLLLKRILADPQDYMGY

IRRYAGGLTLQSVYGYRVETNDDPLLELGTECVDILSNKIASGGGIWPVDIFPF

LQHLPTWFPGAGFKRKAAVWRAKMEEFVDKPYEMVLERMRSGATVPCFVT

TLLEEARDEKGGAVDAQRDFDIRWTANSMYSASMDTTITVVQLFLLAMILHP

EVLRKAQAELDAVVGPARLPTFADRPALPYLDAVMSEVLRWGVPVPLGLPH

RLMEDDVYRGTHLRAGTLVFANIWNMLRNEAIWAQPDVFRPERFLEPVDEA

TAKRRDPRPYVFGFGRRRCPGLHLIEESLWIVMATLLATTDILAEKDESGKPV

MPHVDFTNSLVVPFSTPAPFKCDIRPRSEQALQLVRLAE

 

>CYP505D1 ug.73.17.1
 
MTHEIPCPPAWPFLGHMTSIDPEYPTLSLHLFTKQYGEIYRLRLPGRDLVVVNS
QELVHEVSDDKRFKKSPKGGLQELRPLIGDSLLTADYPREENWGIAHRVISPS
FNPIGLRGFFDDMVDVISQLVLKWERFGPHYKIDIAEDFTAATFEVIALCCASY
RMNTFYTGGTHPVATAVVDYGVEGFARGKRGRLLSWLMRSATAKFEQDKE
TLLQYADELLEERKAHPTDRKDVLWAMMNRADPVTGKKMTDLSVKQNLLT
LLTAGHETTSAFMSIIIYYLIKYPEAMRKLREEIDTVLGDRQMTADDLARLPYL
LAVMRETLRLTPVAPGRVIEAIEATTLKGGQYAIDKGQDILVAVHSSHRDPKV
WGDDVDDFRPERMLDGKFEALPPDSWQPFSAGLRACIGRAIAWQEAQIMITF
LVQHFTFTLADPQYELRIKQAFTLRVHDLYVHARRRTDRRGCVTLLPPAPAP
GVGLAEAKGAPHDGGEGALPMHVFYGSNMGTCEAFAQRIVADAGRHGFKA
SLAALDAAVANLPTDGPVVIVTASYEGQPPDNAAHFVEWATNMRGSGAPAL
AGVVYALFGCGNRDWVQTYQRVPTLVDGALAAAGAERLLPRAEGDAGSGG
FFEAFARWEGALWAALETRYATMKSGSAEGAVDVEVLDAGVSRADVLRQP
DTMMGTVLENRVLTAQGAPVKRHIEFKLPEQVTYKAGDYLTVLPMNPPRDV
RRAMARFGLLPDQEVTIRTKTPSSLPTGRPISVYTLLSAYVELSQPATTRDLRF
LSEAAKSEAEKLVFKELAENYTECVLTGRLSVLDILEAHPNVDVPFGAFLQLL
PSMRARQYSISSSPLCDPTRASLTIRVFEAPTSPGRKDPLLGVASTYLGGLHPG
DRVQLAVRPCKTAFRLPADPAVPLVLVCAGAGLAPMRGFLQERALQKEGGR
DVGKSLLFFGCRHPEEDYLYRDEDLKKWVELGIVDVRVAFSRAQDQSLGCK
HVQDRLWHDRTDVMDACDKGAKLYLCGSAKMAAGVKDKLVLVVQDAMQ
LEHAAAVEQFNTMMAGRFATDVFE
 
>CYP505D2 pc.73.4.1
MTEPIPTPPSVPFLGHIPLLDREVPMLSLALLAEQYGDIYRLIFPGRSSIAIASQE
LVHEVSDDKRFRKTVQGPLGEVRAVAGDGLFTADVPGEENWDIAHRILMPA
FSFMKIRDMFDDMVDVVAQMVVKWERFGPRFRIDPAVDFTALTLEAISLTTM
SYRMNAFYTFVQNGIHPFAKAMNEFLQESGGRSRRGRVLSAFMRGATAKWE
QNRDLMMKYVDDNARSSARKDVLDLMMNEKDPVTGRKMTELSIKQNLLTF
LIAGHETTSGMLTFTIYYLLKYPAVMRKLREEIDTMIGDRPMTVDDVNKMPY
LTAVMRESLRLGPSVPGRMIESLKDQTLKNGKYAVAKGEILVVCNFIAQRDS
KVFGDDADEFKPERMMDGKFEALPPDAWQPFGAGVRGCIGRAFAWQEVQIV
LVYLLQHFNLAFADPNYDLRLKQTLTLKPNEFYIHAIPRAERRRAIPLLGPRAG
PTSAPVNGTNGIADEGGHPMYVYYGSNMGTCEAFAQRIAGDAGRYGFSAAV
ASLDSATENLPTDGPAVVITASYEGQPPDNAAHFVEWLGALGDADSPLAGVA
YAVFGCGNHDWVQTYQRVPTRVDEGLAAAGAERLLPRGEGDAGAGDFFEA
FTRWEAALWEALGKKYETAKGSGKEAGVQIKVTNATVSRADALRQADTMM
GTVIENRVLTAPGAPEKRHLDIRLPEGTTYNAGDYLAILPTNPSRDVRRALAR
FGLLPDQEITIESASPTSLPTGRPISAHTLLSGYVELAQPATTRDLRLLSEAATS
DAEKLVFQKLADNYAEEVLAARLSVLDILEAHPDVNIPLGAFLQLLPTMRVR
QYSISSSPLADPTQASLTIRVFEAPCTAGRKAPLLGVASTYLGGLHAGDRVAL
AVRPCKTAFRLPADPALPLVMVCAGAGLAPMRGFLQERAAQKRAGRDVAKS
LLFFGCRDPAEDYLYRDGDLAEWTALGIVDVRAAFSRARDQSLGCKYVQDR
LWHDRADVMAAWDKGAKLYLCGSAKMAAGVKDKLVLVVQDAMQLEHAA
AVEKFNMMMAGRFATDVFE

 

>CYP505D3 ug.73.15.1
 
MSQPIPMPPSVPFLGHVTTIDAELPVMSFRLLAKQYGEIYELNMLGRCILWML
VINTQELLHEVSDEKRFRKIVSGGLNEVRNAAGDGLFTAHADKEQNWAIAHR
ILMPSFSAMNMRNMFDDMVDVVSQLVLKWERFGPYHKINPADDFTALTLEA
ISFCAMSYRWVIFYSIYVRNDVHPFARAMSDFLLESGARARRPGIIAPFMRSA
NAKYQQDIDVLMNFVDEIIADRRAHPTDKKDILNVMLHAKDKETGLGMTED
NIRRNLLTFLIAGHETTSGMLTFIMYYLLKHPEAMRKLREEVDTVIGERPMTV
DDVNKLPYLIAVMREALRLGPPASARGASPYEDTTIGGGRFAVPKDTFIMCSL
YNIHRDTKVWGEDAEEFRPERMLDGKFEAMPPDSWQPFGYGMRGCIGRPFA
WQEAQIALVYLMQRFTFAMADPGYDLRLKQTLTIKPHEFFIHAIPRADRAHG
APLFSTPSPLRPRAASSAQPPADTAGRTPVYVLYGSNTGTSEGFAQRIASAAA
GKGMYSRSTIGTLDSAAAHLPTDGPVVIVTASYEGQPADNAAHFVEWLSSLQ
GTELEGVRHAVFGCGNRDWQATYQRVPTLVDDALTARGSIPLVLRGAGDAA
ASDFFEAFEKWETGLWGALREAYGVATGANAESGISIETLDTGKGRASILRQP
DAALGTVVENRVLTAPGAPEKRHIEFKLPEGMTYQTGDYLAILPVNPQRDVH
RALARFGLLPDQEITIRSAGPTTLPTDRPVNVSTLLSGYVELGQPATTRDLRLL
SEHAKSDSTKAALQALLDNYASDVLGARLSVLDILEAHADIALPFAAFLDTLP
SMRVRQYSISSSPLADAAHASLTISVLAAPARSGRPERFLGVASTFLGGLRAG
DRVPLAVRPSAAAFHPPADPSVPLLLVGAGAGLAPLRGFLQERALQKKAGRD
VAKSILFFGCRRPDEDLLYGDAELKEWQELGVVDVRPAFSRAPEHSFGCKYV
QDRVWHDRAEAVATFKAGAKLYICGSSRMAAGVKEQIVLIVQEDSKLEYPE
AVEKFEKIMVGRFATDVFE
 
>CYP505D4 pc.73.11.1 (ug.73.16.1)
MTHPIPTPPTVPLLGHATLIDHDFPMGTNALWAREYGEIFRMCFPGRTVYVVS
SYELVHEASNDKLFRKSVGGPLAELRSSVGDGLVTANVPGEENWGIAHRVL
MPCFSTISLRNMFDDMVDVVSQLVLKWERFGPHYRIDPAEDFTALTFEAISLC
SMSYRMNPFYNSAMHPFAAAVVDFQVECMARSRRGKLLNALIRSAKTKFEQ
DRDLLMQYADETVLEDRKAHPIEKKDVLWTMINRADPVTGKKMTDLSVKQ
NLLTLLMAGHETTSGMLTFAMYHLLKNPEAMRKLREEVDTIIGDRAMTADD
LSRLPYLVAVMRETLRLSPSAPARIVQAMEATTLGGGKYAIAKDDTLLIATYV
SQRDPAIWGPDAEEFRPERMLDGKFEALPPDAWQPFGAGIRSCIGRPFAWQE
VQIVLVSLMQRFTFAFADGHYDLRMKQTLTMKPHDFYIHAIPRTDRARVPPL
LGVRAAPAQSTDGEKGKVEAGEGAPPMYVYFGSNMGTAESFAQRIAGDAGR
HGFKATVAPLDAAVEKLASDGPVVVITASYEGKPPDNAGHFVEWLSNLGDES
ALAGVSFAVFGCGNRDWARTFQRIPTLVDDALGAHGGARIIPRGVGDASTGS
FFESFANWEEGLWAALAEKYETAKPTSVGGLELVVTDAGPGRADALRQPDT
TMGTVVENRVLTAPGAPVKRHIEIQLPEGTSYTAGDYLAVLPTNPPRDVRRV
LKRFALLADQEITIQSADPTSLPTGRPVNVYALLSGYVELAQPATTRDLRLLIE
ASSTDAEKQVFKELADNHAERVLKPRLSVLDIVEAHPSVHVPFAAFLQLLPA
MRVRQYSISSSPLVDPARATLTIRVFELPGAPARRPHLGVGSTFLARLAPGDR
VQLAVRPCKPAFRLPADPTVPLVLCCAGAGLAPMRGFLQERAMQKQAGRDV
GKSLLFFGCRDPQEDYLYKDDDLKAWVDLGIVDVRVAFSRAPDQSLGCKYV
QDRIWHDRADVLAAWNQGAKLYLCGSAKMATGVKDKLVHVVRDATGVDE
ASASDKFNEMMDRFRYRYFRVRYEHVVSAAFTYCIWNYLRDHSTRFNCPIA
MACTFRLGAIARGSICATWLRWREE
 
 
>CYP505D5 pc.73.14.1
MTTPIPSPPSIPFLGHVTIIDREVAIYSYNLLAKQYGEIYQLNMMGALRIIVICSQ
ELLHEVSDEKRFRKIPRSALEQVRNAVGDGLFTANGDDPNWHLAHRILMPAF
STMNTRNMFDDMVDVVNQLVQKWERFGPRHKIDPAQDFTALTFEAITFCAM
SYRELTLPQEGVHPFARAMADFLVESGNRALRPGIVQPFMRSTNSKYEEDIKI
MEHYVNDIYEQRKANPTDKKDILNLMMYGKDTQTGEGLSEKTIKDNLLTFLI
AGHETTSGMLTFIIYYLLKNPEAMRKLREEVDTIIGSRPMTVDDVHKLPYLIA
VMREALRLGPPAPMRGAASFEDTLLKGKYPVAKDVPIYCGVYMVHRDPKV
WGEDAEEFRPERMLDGRFEALPPEAWQPFGFGVRACIGRPFAWQEAQITVVY
LMQRFTFVMHDPSYDLQLKQTLTIKPHEFFIHAIPRTDRPSIVPIPTPSSTLLRD
QTAPAAQPPVTTPGEGGGHRMYVLYGSNTGTCEAFAQRVASDATVHGEVSV
FIGTLDSAAGHLPSDGPVVVVTASFEGQPADNAAHFVSWLTALNGSALADVS
FAVFGCGNRDWASTYQRIPTLCDDTMAARGGKRLVPRGEGDAGSSDLFESFE
HWEAGLWEALQKTYGTTKVEGRQEAIKVSTVDAGTARATALRQPDTMLGT
VVENRLLTSPGVAEKHHIEFQLPDGLTYRTGDYLAILPMNPSRDVQRVLAHFS
LLPDQEVTISAAGPSPLPTGRPVNVSSLLSGYVELSQAATTRDLRILMSAAKSE
DTKAALSELLDGYAEKMQAARLSVLDILEAHPGLDISFALFLQLLPSMRVRQ
YSISSSPLADPTRASLTVSVLSAAPTAGRREPFLGVASTYLASLRAGDCVQLA
VRPSAAAFHPPADPAVPLVLFCAGAGLAPMRGFLQERALQKQAGRDVAKSIL
FFGCRSPQHDFLYADSDLRTWTELGVVDVRPAFSRDTEHSAGCKYVQDRVW
ADREDVVKVWKAGAKMYVCGSGRMATAVKQKLVEIIAAQLNVDSEKATET
FNNIIKGRFATDVFE
 
>CYP505D6  pc.17.40.1
  
MTSTIPTPPSIPFLGHVASIEREVPLRSFRLLSEQYGEIYELNILGRKLLVVSSAK
LMSDVSDDKKFYKNMSGPLMQVRNAVGDGLFTAYGEEPNWGIAHRLLMPA
FGTASIRDMFPDMLDLASQLVLKWERFGPKHRIDPAEDFTRLTLDTIALCAMS
YRLNSFYRDSSHPFVQSMVDFLVECNLRANRPGLLTSVMVQTNAKYEEDIKT
MTELADEIIAERRRNPTDKKDLLNIMLYSKDPKTGQSLSDVNIRNNLLTFLIAG
HETTSGLLTFALYYLIKNPEAMRKAHEEVDEVLGDQQIQLTDIGKLKYIDAVL
RETMRLSPTAPMRTVRPFEDITIGDGKYFVPKDYTVVINTIVAQRDPTVWGED
SNEFHPERMLDGKFEALPPNAWQPFGFGMRACIGRPFAWQEAIIALAVLLQK
FDFVLDDPSYELELKQSLTIKPAHFYVHALPREGKPQLLATPSAAPFSSHARET
TNASLPASPGTEAKQPMYVLYGSNTGTSESFAQRIANGAAAHGFRATLGTLD
SVADHLPTDGPIVIVCASFEGEPADNAAHFVERLTSLQDKPLQNLRFAVFGCG
HHDWFRTYQRIPKLIDQTLEDRGAQRLVPRGEGDAGSSEFFEAFEAWETKLW
EVLPEEYNTVVKQDITSGLKVETVGEGATRAVDLRQHDAALGTVIENRVLTA
PGAPQKRHIEFELPEGVTSRAGDYLAILPSNPPQDVHRVLARFGMLPEQQIVIS
SSGPSSLPTGRQISAFDLLSGYVELSQPATARDVRTLLNIDSSDATKESLKALL
ESYSDAVLGRRLSVLDLLEQYPDIKLPFAAYLALLPSMRIRQYSISSSPLWNAQ
RVTLTVSVLEAPALSGRKEPFLGVASTYLANLRPGDKVQMAVRASNAAFHLP
QDPRTPLVLFAAGSGLAPMRGFLQERALQKKAGREVGRAVLFFGCRRPDED
YLYSDSDLKEWEELGVVELRPAFSRAPEKSEGCKYVQDRVWHDRRALDGLY
EAGAKWFVCGSGKVARGVKEVLTAMIKESRGYSDEEAAAAFERATVGRFAT
DIFE

 

>CYP505D7 gx.187.5.1
ATPIPSPPSVPFLGHVTIIDREVAIYSYNLLAKQYGEIYQLNMMGAKVVVICSQ
ELLHEVSDEKRFRKVPSSALDQVGNAAGEGLFTAHGDNPNWHLAHRILMPA
FSTMNTRNMFDDMVDVVNQLVQKWERFGPRYKIDPSQDFTALTLEAITFCA
MSYRYGRIXVHPFARAMADFLVESGNRALRPGIVQPLMRATNSKYEENIKIM
QKYVDDVYNQRKENPTDKKDILNLMMYGKDPKTGERLSEKTIKENLLTFLIA
GHETTSGMLTFILYYLLKNPEAMRKLREEVDTMIGSRTMTVDDVHKLPYLIA
VMRETLRLGPPAPARGTAPFEDTLLKGKYPVAKDGRIYCGIYMVHRDPKVW
GEDAEEFRPERMLDGRFEALPPEAWQPFGFGVRACIGRPFAWQEAQITVVYL
MQRFTFVMHDPSYDLQLKQTLTIKPHEFFIHAIPRTDRPSIVPIPTPSSTLLRDQ
TAPTAQPGPVTTPGEGGGHRMYVLYGSNTGTCEAFAQRVASDATVHGFKAV
IGTLDSAAGHLPSDGPVVVVTASFEGQPADNAAHFVSWLTALNGSALADVSF
AVFGCGNRDWASTYQRIPTLCDDTMAARGGKRLVHRGEGDAGSSDLFESFE
 

>CYP512B1 pc.30.92.1(genewise2nd.30.46.1)

 

MSLHQVYDAVVAHGDMGTLLVYMAYSVPLVMFLYSLFSPASLRHIPTEGGP

SFPLLSYKAARAYLRDATGILQRGYDKHKGKPFKVAMPDRWVVVLTGKKLV

DELQRLPDDAVSFIKGASDLSGTEHMFGRQVIDDPFHVPIIRTHLTKNLAPMFS

DVFDEVSIAFQELIPACDGEWVPVHAIKVARSVVARTSNRIFAGLPICRHPEYL

NLVINFTVDVAKGRYALLLFPPALKGIAAKILTNIDGRIKEGLKYLGPLIEQRM

ALAEKFGNDSSEKPDDMLQWIIDEVRARNQSVFEVVRTVLLVNFAAIHTSSNS

FTHALYHLAANPEFIAPLREEIETIVSEEGWSKAAIGKMWKLDSFMRESQRYN

GINSVSVKRKALKPLTLSDGTFIPKGTVLVTPTVATHFDDDNYKNPTVFDPFR

YYREKEQDMSAVKHQFVTTSPDYVSFGHGKHACPGRFFAANELKAMMAYV

VVNYDVKFEKEGVRPENIYAAMGISPDPNARVLFRKRESIVSV

 

>CYP512B2 pc.30.93.1

 

MTPSHSFPDLVASCISAWTLCFALGFSIAAASFYSLFGPFNLHHIPTVGGSSIPLI

SHRGARKYMRDAKGVLQDGYKHKGKAFKVALTDRWLVVITGKRLVDELQK

MPEDVASFVGAVADFQGLRYIFGQKVLDDPFHVNIIRSHLTKHLSSVFGDICD

EIYVAFSELIPQQDEEWVPVHAIQVVRTIVARASNRVFVGLPVCRNAGYLSLA

VNFIVDVAKARDFIALFPPVLKPLAAKMTSDIGTRVQEGMQYLEPLINERLRL

MEKFGKDWTDKPNDTLQWMMDGIMERDGTIEQLVRIVLLENFSSIHSSSNTF

THALYHLAANPEYITPLREEVETAISEEGWTKAAMSRLRKVDSFLRESLRLNG

INPVSMQRKALISFTFSDGTYIPKGTILVTPALATHHDEDNYEDATTFKPFRFV

GENPEDDVPLVTTSADFVPFGHGRQACPGRFFAAHQMKAMMAYLVLNYDV

KFENEGVRPQNVHGVLSVQPDPKARVLCRRRKSSYT

 

>CYP512B3 pc.30.113.1

 

MASNHLFSGVLPLDRAASTLGYLVCGALLALLLQNILTTISLRHIPTVGTSTLP

LLSYKGAYDFTRDIKGVFQQGYAKYKGRAFKIAFTDRWFVVLTGRKLLEELH

RLPDSTTSFNHASGSITGSTYIYGRGWLSDPWHIPIIRDRLTKHLAASFGDMYD

ELETAFRELMPSCEEEWVPVHFITMARTVVARTSNRVFVGLPACRNLGYHTL

LVNFALDVSKARNRLAWLPPALKRVAARALTRIDSRIEEGMQYLGPTIRARIV

EMERYKGDWPDKPNDILQWIMEELIARKMPMEEAVRIILRINSSAVQTTANSL

THAIYHLAANPDLIAPLREEVDAVITDEGWTKLAMSKLSRLDSFMRESLRLNI

VNPLSVRRMALKSFTFSDGTFIPKGTLMVTPAHATHLDEANYEHASVFDPWR

FVHQKEEDLSPTKHQFITTSPEFVAWGHGKHACPGRFFASNELKAMMAYIILN

YDVKFARAGVRPDNVYSGLTVAPNQEANVLFRRRQTQ

 

>CYP512B4 pc.30.114.1

MAFSDVVATVGAGPWVAYMMCAVLLALLLYSLFSPASLRHIPTEGGSSLPLV

SYLGAYNVLRNLQSVLQRGYDKHKGKAFKIALPDRWVVVLTGKTLVDELQR

MPEESASFIDATTELTGFGYIWGPRMRKDPCHVPIIRNQLTRQLSSAFGDIYEEI

ELSFQGLMPACEKDWTPVHVIEVARDVVARASNRVFVGLRVCRNPDYLDML

VDCAVSVASARNTLMLFPFVLKTFAAKNVVNMDRRIRRGMQHLGPIIEERMS

LLRSLGNDWPDKPDDMLQWIIDEVAARQMPKEDVVRNIMFLNFAAIHTSSNS

FTHAIYHLAANPDYLGPLREEVEAVTAKEGWSKTAMGRMWRIDSFLRESQR

VNSINPLTVIRRTRTSLTLSDGTFIPEGTVVAAPAYPTHFDDENYVGGDTFDPW

RYVREKEQDLSPSKHQYVTLSPEYVPFGLGKRACPGRFFAANELKAMLAYLV

VNYDVKFEKEGVRPENMHVGLTISPDPAAKVLFRKRRS

 

>CYP512B5 pc.30.118.1

MARSDILDALSLGRTELSTTYLVFGLFLALFLYSLFSPASLRHIPTVGSSSLPLL

SYKGAYDFLRDGRSLLQRGYNQYKGKVFKVAFTDRWLAVVTGRKLVEEVQ

RLSDDVISFPDASGEVTGFKYIFTKCALSRDPFHVNMIQRQLTKHMSVAFDDL

HDEFETAFKELLPHNETAWVPVHAIEVARKVVARASNRIFVGLPVCRDKAFL

DLMVNFTLDVARARDLLALFPPALKPFVAKLVVKLDSRIEEGMQVLRPIIQER

MEIIEKFGKDSPEKPDDMLQWIIDALVERNEPMEQVVLITLFVNIAAINTSSNS

FTHALYHLAARPEWIAPLREEAEAVIGNEGWTKNAMGKLVKIDSFMRESQRY

NSIVPLTCMRKALQPFTLSDGTHIPRGTILVTPAIATHFDDEHYADAASFDPSR

YVPVADAKQGGAPKQYVTTTAEYVPFGHGKYACPGRFFAGTELKAMMAYL

VLNYDVKFAQEGVRPPNAATTLSTRPHQEARVLFRKRNSSVQ

 

>CYP512C1 pc.30.76.1

 

MSSMNAPALPATHIVAGAILVWLLVRTFGTQNLRHIPTEGGPSLPIISFLGLHA

FLTRSREILEDGYQTHKGRAFKVALIDRWLVVLSGKKLVEELQKMPDDTVES

ATTEMFNMQHVFASNWHKDPVHSSLLRSLTRNLGVVFSDMFDELDTAFREC

VPANAERWLPVQAHTTMASIVTRAANRIFVGLPVCRDAGYIHMMIHVAEDV

SDAVRTLSMLPTFMKPFVARRATVIDQRIQQCLDYLRPAIADRMSMLERFGK

DWEEKPNDVLQWIIDEVTARNQGEDEVARIVLFINFGAIETTSFAVTHALYDI

VSRPGLADVLREEVEAAVATEGWTKAATNKMRKLDSVLRESQRLNGPTTAS

MFRRVLQPVTLSDGTYLPAGTTVVTPTLATHFDDTNYADAQTFDPLRFYKPD

GVQAQLVTTSADFVTFGHGKHACPGRFFAANELKAMMAYILMHYDIRPERE

GVRPENVYRGLNVLPDANARVFFRRRQTD

 

>CYP512C2 pc.30.77.1

 

MVLTTDFGGISTTHVVIGAFVTWLLLRYFSAKNLRHIPTVGGPSVPILSIVALY

NFLANGKKVVLDGYQKYKGKAFKVALLDRWLVVLCNPKLVEELQKLPEAL

VGYSLLEAXGTIFETKHIFGADLLTDPVHLVLLRTLTRNLGQVFGDMYQEVET

SFQELVPANEKEWLPVHASPIMRTIVTRAANRVFVGVPVCRDEGYLHLMVHF

AEDVNKAFGLYTVVPSFAQGFVARKAKAVMDDCIERCLGYTRPTIKDRTTM

MDSFGDNWADKPNDMIQWTIEETKARGQGEYDMARMLMFINSGAVETTSQ

AVIHALYDISVRPELADELREEVERAIAEDGWTKDATNKMRKLDSFLRESQRI

NGPMIVSMFRLVREPVTLSDGTFLPAGTTIASPTLGAHFDDSIYPNASTFDPLR

FYKAEAAGQPQFVTTSPEYLTFGHGKHACPGRFFAVNELKAILAYMLMHYDI

KPEQDGVRPENKSMGLGVLPNPDAKVMFRKRHAG

 

>CYP512C3P gx.30.36.1 60% TO 512C1 PSEUDOGENE

NDLLQWIMDEAVARDKS (FRAMESHIFT)

QEEIARMVLFLN (FRAMESHIFT)

FGAIQTTSCV (1)

LSMFPNILTPVTLSDGTFLPAGTTVVTPVLATHYNEDNYTNAALFDPFSCKDN

RSGGQQFVRTSADCVTLGHGRML (1)

CPGRFFAAAELKTLVAYVLVNYDLRPETEGVRPVNIYKGLT

V*PSETAKVLFKKRQTDE*

 

>CYP512D1 pc.27.9.1

MQSSVGEVFASAPTLAKLLAGAAFVLFLNSLWNIWKLRHIPTVGGPAIPILCYI

GTFRYLQDPQKILQEGYEKYKAKPGMFKIAAPDRWLVVVGHPNLIDELQKHS

DEQVSFMDAATEFVGTRYALPGTIADDPWHIPPLKQHLTHAIGSFFGDMLEEL

RVSIEERIPSNEKDDEWVAIPALDTFFWVFTRVIDRIIVGLPIRDTEFIKLMVEFT

MSIGIARFFIGLVPPMLKPAMAKLAARGVHKATAEAEKMLAPVIADRVRHLD

EFGEKWADKPNDLLQINIEEARAQGRPLDEIVIRTIVSIFVGVSTSAASFVHVL

YHLAADPELQAALRTEVEGAIARDGWTKAALVGMHRVDSVLRESQRVNGIN

SVSVMRTALQDITLTSAGAPVCLPAGTLCVAPERALHADKEHYPDPDAFVPF

RFAELRATADARGGAQHQFVSTSTRYVPFGHGKHACPGRFFAGNEMKAAVA

HLVSNYDVRLPDGASTRPPNELFGLAIVPNRSAKVMSRRRQPVV

 

>CYP512E1 pc.154.15.1

MSDYSSLLAYIFISLATLAYLKRLLWPDRQQLEHIPAIGPTAPILSYWGAFRWL

SHGTEITQKGYAKYKGRPFKVANFNRWLVVVSGPKLIDDIRKAAEHELSFEE

AAHENLEVRYTAGPCIAENSYHVPIVRGQLTRNLPFLFNDVRDEVAKAFGDHI

PPTDDWTPVAAHPVIMQIVARATNRVFVGAPKCRDPDWLDLSIQFTADLILG

AHIITQFPQFLKPLAARFFTRVPAAIRRGRRHLERTIEHRKACLEQYGADWPD

KPNDLISWLLDEAKGEERTIHNLVTRVLTLEFAAIHTTSNSFVHALYQLAAHP

EWAEPLRDEIEQVVKREGWSKSSLDKMHRLDSFLKESQRYYALGGVTMDRR

AMKDFTFSDGTVIPEGTFVGVAVLATQHDPQYYDDPDTFNPWRFSDLREESD

ESGRHLLVSTGIEYFPFGHGRHACPGRFFAAIELKLMLAHIVMNYDVKAELD

GVVPPILEFGQNLAPNMKAKVLFKNRQRS

 

>CYP512F1 pc.15.28.1

 

MISIDSISLISGLISFAFIAYYLRQDKLQHIPSPGPTGPISSWYAAYKYIRGDAPQI

IEEGYRKYKGRIFRIADLNRWTVVVTSPSLVEELRKAPEDVLSFHEGIRYSLQL

DYTFGREAVEHEYHIPVIRTQLTRHLTPLFADIHDEIVQSFTDLVPPSDTWTSV

RVVPTVMQVVSRTSNRVFVGLPYCRDPAFCALAVRFATDVVKTGVALHLTP

RALKPLGVRLVSPVSKRVEEGKGDHRQAGGRPAPRQPGGRPARAAQGACGN

WPDKPEDMIQWLIEEANEDERTVEGLVLRILIVNFAAIHTSSMSFTHAVNMLA

AHPECIAPLREEIEEVVREEGWTKAAVQRMRKLDSFMKECQRLHGLGAVTM

SRVALQDYTFSDGTRIPRGTLVMAASRPIHHDAALYVPDADAFDPWRFARLR

AADADASIKHQMVHTSAEYLAFGHGKHACPGRFFAVNELKLMMAHVLHTY

DIRPQTSVPPGRWIRHSLLANPIATVDLKKRQT

 

>CYP512G1 pc.16.37.1
SVPTMGPTAPLLSYWGVLRYMTRPRDVLREGHVKFGGRPFRVASPLRWQYI
VSSPELIDELRRAPDAELDPLAAADDILHFVKALGTKFASNTYHVPIVRTTLTK
NIGTLLPSVLDEMRVAFARYIPADKEWHPVVAHDTNVRIVTQTSSRIFVGLPL
CRDPELLKITMSYTPTVMKTGLLLKVLPRPLQSFVQRGSGSIDALIDRAHRLLL
PTIEERRRMMDKYGAEWLDKPNDMLQWLMDSAEGEERTPRGLAARMLAVY
FAATDTAALGFTVALYRLATHPEYVQPLREEVEAVIAQDGWTREAFRKMPK
VDSFLKECMRLQGPSTLLLQRKAMQDFTFSDGTFVPKGSHVATSIVATHCDS
AYYSDPLTFNPWRFVGAEDDAQDSKHRFATTSPEYLLFGYGRHACAGRFFAE
IQLEMMMAYVVTTYDVRMEKPGVLPEPIEFGSMSLPSMTAKVCFRKRATE

 

>CYP512G2 pc.15.22.1 (genewise2nd.15.10.1)
MFADSPTSLYALVLLGTVVYLLNWLKGSKYKSVPALGPTAPLLSYWGAIRFF
LDAQGMLQEGQLKYGGSPFRIATRRYWQYIVSSPKLIDELRRAPDDELSFLDA
VNEALELEYTMGAATANNLYHVPVIRNTLTRNLGNLSSEIYDEISNAFADCIP
ARDEWMAVPALQSIMQIVARTSSRIFVGLPLCRNREFLEISMTYTTDVVKTGL
LLNMVPGPLKPIVNRLFSKVEQHIDRTHALLRPIIEERQRMMEQYGDDWPDKP
NDMLQWLMDAAEGQEREPRALALRILIVGFAAIHTSSMSFTQALYYLAAHPE
YMQPMRDEVEAVLAAEGGWSKGALQKMRKVDSFLKECQRYEGLGMLFLTR
KAVKDFTFSDGTFIPKGSYVSTSRAATHGQSEYYRDPYVFDPWRFANLRDET
GEGVKHQMVNTSIEYLPFGLGKHACPGRFFAANELKSMMAHLVVTYDVALD
MPGEVPRSVHFGPINSPNRTAKVLFRKRRG

 

>CYP512H1 pc.21.108.1
LQDIPTVGGPNLPFFSYFGAIHFLVRANKIISDGYSKYKGGSFKIAQVNRWLVF
VTDPALNEELRKAPEDQMSSPAALHQYVQGLYTMGFGLDGMLYYIEVLRDQ
LLRHVNPSPAMLYDEMQASFQDFIPQNTEWTPIPALSTSLKLFLRMSNRAFVG
TPLCSNSEYLDLVTEFMNNVFKGAFFYNCLPAFVRPILARWLDLVNPCLDRA
VRLLTPIYATRVAELEAAGKAEWAGASDDLLSCLVASHYSAARDVRELARIL
LVVNLAAVHTVSQSFTSVLFLLASRPAWQAELRAEAAAALAHGYTRDALAR
LRKLDSFVQESLRFNGLGALASTKLALTDFALSNGTVIPKGTLVSAPLRALHL
DDEVYPDGASFQPWRFVRAGGEAAPRQSLASTSPTYLPFGHGKSACPGRFFA
ALELKMVTAYLVLNYDLKLEGDATEVPPVSWFITARVPNYKANVLVRRRQE
KA

 

>CYP512J1 pc.37.85.1
NIPTLGTEMPVLSLWGALRYVMNSHNVIQEGYLKYKGRPFKIAQFDRWLVVL
TTPHHIEELRKAPETGLSSRDAVDSLLKAKYTLGMDVDTVQRYLDLFREKLA
NKLGGLTSEVHEEMELTLNESLPKSEDWEEFCVLPSILKILFRTTNRAFVGAPL
CRSEEYVALGEEYTTNVFKGAVIYNALPKALLPLLSKVLDFIGPTSRRCEQLFR
PEMDKRAAYLEEHGADARGKYDDLLTWLIATHGAGDEINYSELTRIVLIANL
AAVHSTAMVFTFAIFHAAADPGVADALRAEVASVVAEHGWTPTALTKMQRL
DSFVREVQRMHTLGAALVMKIARTDYAFADGHVVPRGALVTAPATTVHRD
DEHYPDAHTFRPWRFVGTPDESEADSARRKATSTSPTFLAWGHGKHSCPGRF
FAVRELKMLLGSVLLRYDVRLKTPGVLPQDQWYLTFRVPDPTACVLLKRRTT
A

 

>CYP5035A1 PC-hn-2(pc.12.112.1)

MADTSLLSRRLKSFFDPQGSPTLLSLPDSFVHLIFKRWEPMKLPIVAFLLFLVP

ACLSLLFASHLSLTKGLATAFATFYTVLVSSIVIYRISPFHPLARYPGPLAAKIT

KWWHAYHVHTGKQHLYVRRLHDQYGDIVRIGPNDVSIRDASCISSGLGSQGL

PKGPMWDGRFMYSPIPAMVGARDHAYHMQRRRPWNRAFSATALKEYEPLIY

GRVHQLVSALADRQGQVVDIAKWIGYFTYDFMGDMVYGGWTEMLRDGKD

EDGLWDVVHRGLEDVSAVYGEVPWVSYYASMLPNVGKDLKRMRKMAFDR

AKQRYDSGSKARDLFYYLSNEDGAEKVTPPRPIVVSDGVLALIAGSDTTAIVT

ATILYSLLCNPTTYHRLQQEVDKFYPRGEDPLNPKHYKDMHYLEATINEGLR

LFPATPSGTQRAPAPGKGDRLIGKYYIPEGTATKFHFWSIQRDPRNFSHPDTF

WPERWLVAEGLEHADEPLTHNANAFVPFSFGPYNCVGKNVAMQEMRMLLC

HLMHTLDLRFPEGYVPRAFEDALEDQFGFKVGELPVIVQRRE

 

>CYP5035A2 ug.97.52.1

MGSDAQLPVLSPRDAFAIIVLSAVGAHLVFKRWEPKKLRVVTFLLFLVPACLS

TLLLPHFGTALGLTVGFLTYWTALTLSIVFYRVGPLHPLYQYPGPLPAKISKW

WHVWHVQQGKQHLYLQQLHDKYGDIVRIGPNEVSIRDPACITPVLGAQGMP

KSDMFLGRNMWPETAPLIGYRDPAEHMKRRKPWNRAFSSASVKEFEPIIQHR

VHQLVEALSDRQGQVVDLAEWISFFTYDFMGDMVFGGWTEMMRDGADKG

GLWDLLRRGLTVSALWGEVPWVSYYAKKLPWTAQDNKAMRVMAFSRTEQ

RYASGSASKDLFYYLSNEDGSEKVSPPRNIVIGDGLLALVAGSDTTATVVANT

MYELLRHPAAYRRLQEEVDKFYPRGEDSLDPKHIKDMHYLEAVINEGLRMY

PAVPSGSVRAPEVGKGGKIAGPYYIPEGTQTRIHFWSVQRDARNFSFPETFWP

ERWLIAEGIEPAPAGEKLVHNPNAFTPFSFGPYNCVGKNIALAEMKQLLCHLV

HKLDVRFADGVDPDAFDRASEDRFIYVVGELPVVVERRD

 
>CYP5035A3 ug.53.54.1 
MAGDLSTRDALGIIVVSALGTHAIFKRWEIKHILVVSTLLLFLPAALSTLLIPHL
GSFKGIAAGFSVYFITLLSSITLYRISPFHPLAHYPGPLLPKISKIYHIAKVSSGK
QHLYLQELHNQYGDIVRFGPNEVSIRDASCIMPVLGAQGMPKGPMWQGRHF
WTEVHTLIGFRDPKAHQRRRRPWNRAFNTAAMKEYTPLMQNRVRELGDAL
VARQGQVVDLAEWIGFFTYDFMGDMVFGGWTNMVREGGDRERLWEVVKS
GLKIEFIYDNIPWLSYYTRNIPGAGNAELRAMAIGQTEKRYSRTSTSKDLFYYL
ANGAEKEDPPKHTVVVDGGLALVAGSDTTSSVLSSIFYCLLRHPDTYDRLQA
EVDKFYPPGEDSLDPSHLSDMNYLEAVISEGLRLFPAVPSGSQRAPEIGTGGKL
VGPYYIPEGTQTRIHFWSVHRDPRYFSRPEAFWPDRWLIAEGLQAHAAGDEPF
VHNPNAWTPFSFGPSNCVGKNLALQEMRMVLVHLMHRLIVRLADGWDPAQ
YEREMEDRFVFSIGRLPVVVERRD

 

>CYP5035A4 pc.53.86.1

 

MAAREAILIIALFAVVSTISHVIFRQWEVMHCSVVLGLLVVIPAVLSTPLVSDF

GIPCGLALGFTTYFAVLLLSITLYRISPFHPIARYPGPLLAKISKIYHVSKIWSGK

QHLYLQRLHEKYGDIVRIGPNELSIRDVSCITPALGAQGMPKGPMFNGRHLW

PETHSLIGFRDPKEHQRRRRPWNRAFNTASVKEFNPIIQARVQELGDAFAARE

GQVVDLAEWIGFFTYDFMGDMVFGGWTHMVREGADHNGLWQLIKSGMKV

SFVYEHIPWLSYYVKKLPGAGSDLKMMRAMAFGQTEKRYATTTTTRDLFYY

LTNEDGSEKVDPPKAVVISDGALALIAGSDTTSTVLTSTFYCLLRNPETYKRL

QEEVDMFYPAGEGSLDPKHLPEMHYLEAGLRLFPAVPSGTQRAPEVGKGGK

AIGPYYIPEGTQTRLHFWSIHRDPRNFSHPEMFWPDRWLIAEGLQECVGEKLV

HNPNAWLPFSFGPSNCVGKNLAMQEMRMLVCHLVQRFNFRFADGYDPAQY

ERDWQDRFVVMIGQLPVTIERRA

 

>CYP5035A5 pc.1.6.1

MPSGILGQLQSLPAKLTAQDATLVAHVIFKIWEPMQARIVSLLVIIAPLLLSTLF

IPHYGTVSGVFRSFAIYLTTLVSSIVVYRLSPWHPLARYPGPLLAKVTKLYHAL

MVSKGKQHVYIKALHDQYGDIVRIGPNEVSIRDAACIQPLMGAQGLAKGPSW

SGRSMFPPISPLIGIRDPAEHARRRRPWNRAFNTNGIKEFMPTIQTRVQQLAEH

LGERHGQALDLAEWFSFFTYDFMGDMIFGGWTEMMRDGGDLQGLWTRVK

AGLQHAGMVPEHVPWVAYYAKKIPSVVRKVSEMRGMGISRAKMRYQQGST

SKDLFYYLSNEDGSEKVTPPPEVVTSDGALALVAGSDTTSSVLSNLFYCLLRD

PVSYKRLQEEVDKFYPPGENSLDPRHINNMPFLEAVINEAMRLYPVVPSGSQR

SPEIGKGGRAVGPYYIPEGNQARVHFWSVFRDSRNFSHPETFWPDRWLIAEGL

QESPEKITHNANAFVPFSFGPANCVGKNLAIQEMRLAVTHLMHKLNFRFADG

FNPDEWDSQIQDVTVMQLGKLMVVVERRD

 
>CYP5035A6 pc.42.19.1 (genewise.42.13.1)
HLIYKRWEPLRLSVTLTLLMGVPAALSVLLIPHLGLLRGALATFSLYLSTLISSI
VAYRLSPWHPLARYPGPLPARVTQLWHTWQAHKGQQHLYLKQMHDKYGD
VVRMGPNEISIRDADCIVPLYGPHGLPKGPSAGRQMHPQELSLIGYRDPARHS
VRRKPWARGLGTAAVREYMPALRSRVSQLVDALGARSGHPVDLAEWIAFFA
YVFVSDCSLSXLANCQSGMTLWATWRECHGAGAVFEQVPWLAYYAKMLPA
ISQRILKMRKLTVRHATRRYNSGSFSRDLFHYLSGEDLPEGSARPPQHIVAAD
GLLAVVAGSDTTASALSNLFYCIMRHRDVYKRLQQEVDQFSPLGDDSLDPQH
LNNMPYLNAVINETLRYLPSVLSGSQRAPLIGGGGVSVGPYYVPEGNQVRVH
FYSVHRDPRYFSDPDRFWPERWLIADDRQPSSEKIVHDDRAFIPFSYGPSNCV
GKGLALQQMKSTVCHVMAKLEMRFADGYDPDTWEEQVQDEGVMIV

 

>CYP5035A7 gw.54.121.1 (genewise.54.12.1)
  

KSVHLIFKRYEPMHILVVSTLLLLLPAILTVPLIDQLGIAKGFLVAFATYFATLL

SSITLYRISPFHPLARYPGPIIAKVSKIYHVAQVWSGKQHLYLQRLHDRYGDIV

RFGGFSTCSLRGPNEVSIRDVSCIAPMLGTQGMPKGPGKHCWPEIHTLIGCSDI

KEHQRRRRPWNRAFSTAAMKEYNPIIQKRLQELGDALAARQGEVVNLADWI

SFFTHVPWLSYYTRNIPGATNDEFRGMVFGQTVKRYACTGTTKDLFYYLNED

GAEKEDPPKPIVVVDGAVALIAGSDTTSTVLASTFYCLLRNADTYKRLQAEV

DRFYPPGADSLAPDHLPEMHYLEAEALRLFPAVPSGSQRTPERGSGGKTIGPS

YIPEGTQTRIHFWSVHRDPRNFSRPETFWPDRWLIADGLQKDEGVEFVHNPN

AWIPFSLGPANCVGKNLALQEMRMVLVHLLHRFSFRFAGDYNPEQYEWDIE

DRFVVAVGRLPVIVERR

 

>CYP5035B1 Phanerochaete chrysosporium

scaffold_247a

MGTEYVLPLLRTNILKLPTNMTRNDALLAVGGAAV

LCHLIFKKWEPTYIPAVVTLLLVVPLGLSALLVPHYGQLLAPLVALATYHTILL

TSIALY

RLSPWHPLAQYPGPLPAKLSKWWMVWQERDCKQHLYIKQLHDRYGDIVRIG

PNELSIRNV

DAVAPLMGTNGLPKGPS

LRGQGLEPPITGLIAIRDPAEHARRRRPWTRAFSTA

ALKEYEPILVKRISQLCEQLASQKGTLDLATWFSWFTYDFMGDMV

RFGGGSEMLAHGDQDGIWTMFKEGGE

GQMMYHHIPWLAHYAKRLPMSPALKKMRGFALGRTAERYKKGASTKDLFYYL

SNEDGVEKTPPPAAQVISDGVLATIAASDTTSTTLSNAFWNILRHPHYY

KRLQAEVDKFYPVGENAFDTKHHSKMTFLDAVL

NETLRMYPVLPSGSQRAPFPGNGDRVVGP

YYIPDGTQARIHFWSLQRDPRYFSHPDTFWPERWLIAEGLEPAPAGEKFVHNP

NAFIPFS

FGPSNCVGKNLAQMEMRMVFCYLLQNLDFELDKSWNPAERENATEDQFVLL

MRSPVQVTVRRRV*

 

>CYP5035B2 pc.54.66.1

MGSEVAMQLLRANISKPFPRLDQNDALAVVVGAALVVCHLIFKHLEPTYIPA

VLFLLVLVPLYLSALLLPHFGPLLAPVIAFTTYHTSLLTSIGLYRISPWHPLAKY

PGPLPAKLSKWWMVWKERDCKQHFYLEDLHKRYGDVVRIGPNELSICNVDA

VLPLMGPDGLTKGPCSTIGQGLEQPIPSLVSIRDPAEHARRRRPWTRAFSTAAL

KEYEPILAKRISELCEQLAQQKGSLNLATWISWFTYDVMGDLVFGGGNEMLA

TGDQDGIWAMFEKSGEGQMVYHHVPWLAHYAKRLPMSPALKKMREFALGR

ALERYKRGAVTKDLFYYLSNEDGSEKIPPPPAQVIGDGVLATVAASDTTSTTI

ANTFWHILRYPHYYKRVQAEVDKYYPPGESAFDTKHHNKMTFLEAVIHETLR

LYPVLPSGSQRSPVPGKGDRVVGPYYLPDGTQARVHTWSLHRDPRYFSRPDT

FWPERWLIAEGLEPAPAGEPFVHNANAFIPFSFGPANCVGKNLAYLEMRMVF

CHLLQNLDFELDKRWNPAERSRSAEDQFVLYMRCPLPVTVRRRV

 

>CYP5035B3 PFF_271(pc.92.54.1) 
MGAGYVPQLPRSYALTSFTGTSQTHALTPVIGAALITHLNFKRWEPLNLPIVIFL
PLVAPLGLSALFAPGPSYGSLVAPFITLFLYHAILLASIALYRISPWHDLYHYPGP
LPAKPSKWWMVWKERHGKQHLYVKALHDRYGDVVRTGPNEISIRDVAAVV
PLMGTKGLPKGTAPWGEPIVPSVVPLIGIRDSVEHARLRRSWARAFTAGALKG
YEPVLTARITQLIAKLGSQTGEXIDLALVLSYFSYDFMGDMLYYGGGSELLAEG
DNDGVWALGQMTCHHLPWLAKYKDLLPASPGLQKMRSVALQRTMARYKNG
GLGKDLFYHLSNEDSAEKTSPPTEQLVSDGVLAVFTASDTIATVLSNVFWSILR
FPRYYEQLQAEVDKFYPARADAFDTAHYGEMVWLDAITNEALRLYPIVPSGSQ
RAPAPGDGARVVGPYVIPAGTNARVHTWSLQRDPRCFSRPDAFWPERWLAAA
GLGDSEATCEGPEGAAGAAEDFVHDARAFEPYFVGPLDCIGRALAQLELRMVL
CALLQRLAFAPARGDPLERERTLQDQFVVMMRGPVMVSVSWRA

 

>CYP5035C1 ug.43.44.1

 

MSAVLNSLSPTESVLAVVTCALATHLVFNRFEPTELPVVAAALVGLPAVLSAL

LVGHFGLLAGAALAFATFHATLAASIVLYRLSPFHPLARYPGPLPARITRWYW

ARVACGGRQHLELKRLHDVYGDIVRIGPNELSFRDISVVQPMMGAQGMPKG

PMWDGRTFKPPILPLVGMRDVADHTRRRRPWIRAFTPAALKEYEPVVAKRG

AQLIEILAQKKHTDFVHWIHLFTFDIMSDALFGGNPGAEMMSHEDKDGIMHS

MKTGFEAGQLFEHIPWLGYWMRHFPQLATATKQYRAMCFQRGMQRYQDGS

SQKDLFYYLVNEDGAEKQTPDKATVIADSALAIIAGSDTTASVFSNMVYCLL

KNPHAYKRLRAEVDEFYPPEENSLDPKHHSKMPYLEAVINETLRLYPVVPSGS

QRAPELGTGGTLMGTHYIPENTSVRVHFWSVHRDPRNFSQPESFLPERWLAA

EGLEAPPAGLSGAPQDADSAAARGTFVHNANAYMPFSFGPWNCVGKALALL

ELRCVATHMMQRLDVRFADGWDPAEWDAAMEDKFVIKTGRLPVVVERRF

 

>CYP5035D1 ug.50.50.1

MITVNRPSTQDSVIATVACAIIVYFVCKRWEPWRLAVVVPLTMLPPLVLSLPL

AASVGFLNAVITTSSTFASALVAMLTFYRLSPLHPLSQFPGPLQCKISGFWMA

WIVSRGKRHVYIQSLHEKYGDYVRIGPNEVSINDPTAIPQILGSYGWPKASGM

SGRALHQDPLPLISLLDDAEHSRRRKSWNRAFSSAAVREYQPVVAQRATQLV

QALQEQRSVVDLSQWMRLPSDIAFVNLHDFLYSFGGGTEMLREGDKAGLWQ

LLKDGMSTAVPFEHVPWLSHYILHFPALIRSLTDLRALAFGRSKLRYERGSTT

KDLFYYLVNEDHADAEMPPMKVVISDAVLAIVAGSDTTAVTLSNIFYYLISHP

DTYRRLQEEVDKYYPPGEDALNPKHYVKMSYLDAVLNEAMRLYPALPSGSM

RTPAKGSGGQVVGQRFIPEGTQVRVHPYTIQRDPRNFSYPNRFWAERWMIAS

GNQSHHEKIAHNPDALIPFSTGPRNCVGKNLALLEMKMVTCHVTQRLSLCFA

DGWDPSRWWDDLEDVFVSRMGQLPVIVRSR

 

>CYP5035E1 pc.97.5.1  (genewise.97.3.1) 

MQAAHLVFNRWEPTNIAVVAALLLGVPCAAASLLFSGRGFVPRLALTAALY

YACLGTSVVLYRLSPWHPLARYPGPWLLKTSKLWMVRRVKRGGQWRYIRE

LHQRFGDVVRIGGPNELSFCDAAMVVPVLGTQGLPKGPGLIALRDPLEHQRR

RRTWNRAFKPAALQEYLPLIQKRTAQLLDALSKCEEQDVVDLGRWIRFCKYA

HMPWLAQFTKHIPRVAAKLKELRAAARSRAAARYKAGANRKDLFYYLVGD

SNEDGGEKEQPTEDVILSDALLAIIAGSDTTSTILTSAVYCLLTHPDVHKRLVE

EVDKFYPPGADWCNTEHHADMHYLNANETLRLFPVLRDGSLRAPWVGHGD

RALGPSSFIPEGTQVRVHTYSLQRDPRCFSQPDTFWPERWLVAGGLQHAEPGF

VHEPGAFLPFSRGPSDCVGKGLALQDMRIVLCALLQHLELAPPRNRPFDEWK

AEVDRRFADSSAVLPVSVRVRRRV

 

>CYP5036A1 PC-hn-1(pc.15.127.1)

MDALDPRIAIPIVYFIYKKYEPSSPRSAFFLLLALPGVLAVALRVCERFNSYAT

AVPTVYLAYWSLLSTFVVAYRISPFHPLARYPGPLLCKISKGWLAYVAGKGG

KAHLYVQDLHMRYGEVVRIGPNELSITHQDFTRVVLGAKGLPRGPYYDSRQ

HEAGMSLDGMRDQALHAIRRRPWARGMNTAAMKYYEELIRNTLSDLIAGLK

QRTNRPVDISEWTNYFGFDFMGQMAFTRDYGMLKNGYDKEGLLDLIEHAM

QDSAWISHITWSIPFLRYVPGASKYWDQMKAVGERAVADRVALGSNHRDLF

HYLMDEDGHEAVRPTKALVAVDGQLAIIAGGDTTATTLSHIVYFLLRYPIYLD

RLRKEIDETFPDGADSTLDFTKQTNMPFLNACINEALRLYPPVLAGLQRRVEP

GTGGKMIGPYFVPEETQVSLFAYSIHRDPQHFSPLTNTFWPDRWLSQEKYTLP

SGDVISADEVVTNRDVFIPFSQGPMVCAGKNVALTEMRSVMCALLQHFDLKI

ADQSFLDSWEDKIEETFTTKRGTLPVILSLRA

 

>CYP5036A2 ug.170.56.1

MFFPLDSWVAVPVTSAVTYFIYKTLEPSSPVSVLLLLGIAPGALSWTLYGGSG

SVIAHIFTVYVSYWALLVTYTIAYRLSPFHPLARYPGPLLCRISKAWLAYIVAT

SGKMHLYIQNLHMRYGDVVRIGPNEVSVTHRDFIGVIGPKGLPKGPYYETRA

HKAGTSLNAIRDQALHSVRRRPWARGMNSAAMKYYEELVEETVGDLVASL

KRRTTKAIDFSEWMTYFGFDFMGHMAFTHDYGLLKNGYDKEGLTPLIEHAM

QDVAWVSHVPWSIDYLRHIPGVYKHWLRIKALGVQTVRKRIALGSTRRDLFY

HLMDEDNRERVKPDINVVAIDGQLAIIAGGDTTATALSHLFYCLLRHPQYLER

LRKEIDDAVPIACGSFKLDFSKLPAMPFLNAFINETLRLYPPVLSGLQRRVEAG

TGGRFIGPHFIPEQTQVSFSAYTIHRDPRYFSPLTDTFWPDRWLVQEQYVLPSG

GVIPAAEVVTDRDVFFP

FSQGPTVCAGKTLALTEIRSVACALLQTFDISNADEASFDAWEDNLEEMFTTK

RSTLPVFLSLRT

 

>CYP5036A3 ug.128.46.1

MSAIFAASSTTYIIFKRFEYSKPVPALVLLIGVPMTLASVLRDHFAGLATAMCA

TAAVHWVLLTLFVAAYRISPFHPLARYPGPLPCKLSKCWMAYLAGSGGKTH

VYIDRLHRLYGDVVRIGPNELSVRHKDACTTVLGAKGLPRGPYYDTREHDNG

VSLDGIRDPALHAVRRRPWARAMNSASTQYFEELIQHTVSDLTGGLKERAGE

SIDLTEWMSFFFSYDYNMLKEGRDTQGLRRMIDQSLVDLRWISHIPWSIPYLK

MIPGASKNWDDMKAAGDKVARHRVSLGSSRPDLFHHLRDEEGHEAVRPQLE

VVSVDGALAIIAGADTAATTLAHFWMFMLRHPACFERLRKEVDATFARDDG

PDFVKQARMPYLNACLNETLRLFPPVLAGLQRRVGRGTGGRMIGTHFIPEDT

QVSLVAYTVHRNPDCFSPFPDTFWPDRWLTQETYTLPTGEVIPSSDVLTRRDA

FMAFSQGPMACAGKNVALAEMRAAVCAVVQRFDLVLAYERALDEWEEVLQ

ECFVSKLGKLPVQVVPRN

 

>CYP5036B1 genewise.22.99.1

MALLQLAQDVFRRSHPASACYALYHKYLNKPVHPLYHFCLLLVVPAALLAL

LQAIHRISVAQECGYALFYWLVMASATVVYRISPFHPLANYPGPLAAKISKLY

LAYLTAKGRAHEDVRALHSKYGDVVRIGPNELSFNRSDAIQTIYADKTMPKG

PYYVARTNLAGVVQLDGVRDFKEHARRRRPWNKAMNSAAIKSYEPIVSSTA

SQLLGQLSKRIHNDVNISDWMSFYGFDFMGRMVFGREWGMLEEGRDVNDY

WHTMDKCLTIVSWSSQIPWSVPIIRLMKPPPEVLKMQKISDDSAMARLTSEGS

GVKDLYYYLLNEDDSSKSELTRDECISEGVLAIVAGSDTAATALTHLCYYLLT

HPDSLQRLRQEIEEAYPTLGSELDDLSRQAEMPYLNACINETLRLLPPVLTGLQ

RSVTAGSGAIIAGYFVPEGVDVSVHHYSVHRNLQDFSPIPDTFWPDRWLEQD

AYVLPDGDVIGKGEVRTNRGAFMPFSVGPQQCAGKNLAMVELRAVACGLFR

RFDLSLSERMNICDYEKGLRDAYTTVRGPLYVKLKPRKE

 

>CYP5036C1 ug.36.48.1 = genewise2nd.119.1.1|whiterot1 = scaf154

47% t0 5036B1, 45% to 5036A1, 46% to 5036A2, 45% to 5036A3

not in tree

MVDRVDPRLILGSSSLVSVACYLIYKHSEPNNIPAHAALLLGVPALLVHQLGT

HWSILQQGGAFVAYWALILAFTGLYRLSPIHPLARYPGPTLGKLSKIYLSYLSA

RGDIYRVIKGWHDKYGDVVRIGPNELSFRHVDALQPIMGTKYTVKGPYYDTR

TTPEQITQMDGIRDYSVHGQRRKPWLRAMSSAGLKGFEPIVKMKALELVEEL

SKKVGEIIDMSEWMNLFGFDFMGHLAFGREFGLLKSGNDHDDMIRTVEDGV

YGAGVISHIPWIAFLVHFPPAMKGLRAMQQMAATFARERTQKGSTTKDIYYF

LTEDEGAAQSGATHDEVIADGMLALIAGSDTTSIALSHVCYFLLRHPACAARL

RAEVDRAFPPGEDVLDFARHADMPYLNACINEALRLLPPGLGGLQRMVRRG

TGGAMIGPHFVPEDTKLSVHLFSLMRDAREFAPLPDAFWPERWLAQDTYVLP

TGDAVSKEHVTTNRAAFIPFSVGPQNCAGKALALVELRAVTCALVSKFELHK

PKDYDLDQWEGDLLDLYISIRGKLPVILQARQGR

 

>CYP5037A1 PC-ln-1(gx.1.22.1)
PPGPPGLPFVGNAYQIPHDKQWLRFDEWIRRYGDLVHISVMGQPTVIIGSAQT
ASELLDARGSIYSDRPQAVMAGELVGWDQGLGYAPGPHSPRFREFRRLFQQF
MGPRAAQDSSMLAAQEKSATRLLSRLLSTPEEFITHVRQVTGALILYLTYGYE
VDEDGFKDPLVNIAEEAMLGFARASDPGAYLVDTMPWLKYIPEWFPGASFK
QDVKAMRQARERLYDVPYNFVQKAMAEGPVPRSFVSTYVEEKATPAFADEE
LIKAAAASLYSGGADTTPSSLASFILAMTLHPDVQRRAQVELDSVIGESWQRL
PTFADRPNLPYIDAIVLEVLRWHPAVPLGLAHRLSQDDVYRGYYFSQGTVFW
ANIWTMLHDEIIFPDPSRFMPERYLDEHGRLKSMSRFEDPAVIGFGFGRRICPG
MHFAHNSIFIAIARMLYVFNFTKAVDKNGNEITPEVEYSGFISHPSPFVCSISPR
SIAAAELVVQ

 

>CYP5037B2 ug.1.25.1
MIRPLTLLDIALATLAVVLLKTIIARSKQRARYPPGPKGLPVIGNVLQMPKDRE
WLTFAQWGEQFGNIVYLSLLGQPMIILNSAKDAVALLDKRSSIYSDRPILYMG
GELIGWKYILGLTPYGDRFREYRRLMAKFIGGKTQVERHFPVMEQEATSFLK
RILRRPDDLGANIRTHAGAIILKLAYGYTIREDEDPFVTLADRAMAQFTEATTP
GAFLVDVFPLLRHMPAWFPGASFKRTAQEWSDTLNSMADVPHAFVKEQMA
KDTEVPSFTSELLRDEKLQEGQEFNIKWSAASLYAGGADTTVSSIHTFFLTML
LFPHVQKRAQAEIDSVVGTDRLPTFEDRAKLPYVEGVLKEVLRWHPIGPLGA
FLVLFFSLGLPHRLAQDDSYEGHLFPKGAIVIANIWCVSISTSWQCLYSPCCRK
CLHDPDVYPNPSDFDPTRHLSENGRSPQPDPRDYCFGFGRRSYPGLHLADTSI
WITCATVLAAFNIENVVENGRVIDIVPEYTSGTISHPKPFRCSIKPRSTRAEALIF
SD

 

>CYP5037B3 pc.1.248.1
MPSALSLLDFAFAALGLIIVKAFLSRTRRQGPYPPGPKGLTIVGNALEMPTSRE
WLTFSEWGGRYGDIIYLSLLGQPMVILNSAKHAIALLDKRSNIYSDRPVLVMG
GEMIGWKYTLALTPYGQRFREYRRFIAKLIGGPTQMQTHLPLEEHETRRFLKR
LLNEPERVADHIRKTAGCIILKLSHGYDVREGHDPIVDLVDTATEQFSLATSPG
AFLVDVFPLLRYVPAWVPGARFQKTAREWRKVLERMADEPHDFVKQRMAE
NTNVPNYTSELLQNERLDGDKEFNIKWSAASLYSGGADTTVSAIYSFFLAMTL
FPHVAKRAQMEVDAVVGSDRLPTCEDRPNLPYVEALVKEVFRWNPVAPLGL
PHRLIEDDIYEGYFIPKGSFVIPNIWSYSTSHILHDPNHYPNPFEFDPTRFLSDEG
RTPQPDPRDYCFGFGRRICPGLHLADVSVFLSCAMVLATFDISKAVENGKVIE
PEVEYTSGTISHPKPFKCTIKPRSTKAEALILSADD

 

>CYP5037B4 ug.1.26.1
MSTPLTYLVLLSAILTVVLIRTAIARRKRWARLPPGPKGLPIVGNVLQMPKSQ
EWLTFSRWAEQYGDIVYLNILGQPLIILNSAEDAVALLDKGGSIYANRPILAM
GGELVGWNRTLALTQYGERFREYRRLIARFIGGKAQMARHLPLVERETRRLL
QRILNNPEDLAGNIRKTAGAIILTLSHGYRIREDDDPVVAHVGRALEQFTEAST
PGAFLVDVFPILRHVPAWLPGASFKATAKRWGETLEQMADVPHNYVKEQMA
SNKDIPNFTSELLRDEKLGDIDSKEFNIKWAAASMYSGLGPQTVSSIHSFVLA
MVLHPHVQRRAQAEIDAIIGPERLPTFEDRAALPYVEALFKEVLRWNPVGPLG
LPHRLSQDDVYKGYLLPKGSIIIANIWSFLRDHNLYPNPSDFDPTRHLPKNTEA
ASQPDPRNYCFGFGPDVLAGQHLADASVWLACATMLATFDIENLVASDGTVI
GVEPEYTSGTVSHPKPFKCSIKPRSALANALINAGMPE

 

>CYP5037C1 pc.2.111.1 (genewise2nd.2.36.1)
MTSTNILLISHGHRVKDSNDRFLKLSDAVTDEFSEAVAPGAFLVDQFPLLRHL
PSWVPGTAWRKTAEKYRRHVADAVAEPFAFVKQQMAAGTAIPSFVSRNLDD
GAAPSPDHEHTVKYAAMALGCADAADAAWQTASALTSLFLAMTLYPEVQR
RAQAELDGVVGTDRLPTFEDRDRLPYITAICAEVLRWMPVGPLGLPHRLTED
DVYEGYALPKGTIFFVNNWKLLHDPDTYRDPMAFMPERFLGAAPELDPSKIA
FGYGRRICPGILVAEATIFITVAATLAAFSIRPAQNGGAPSLPPVRQTSGIISHPA
PFQCDVVPRSKKAEALVVAAVENR
 
>CYP5037-un1 pseudogene genewise.25.75.1  
scaffold_11 (1449124 bp) : 785586:787348 (1763 bp) (-) strand 
32% TO 5037B3, C-term half = 40% to 5037B2 
gray X = frameshift

MLLRIWSRSQSFHPNVSALLFVTTRACHLMSC

RLPLPPGPRARWYGTIGMPTKSQWLNCHGRKCTVRYGSHYDAPGLLMYFHIVENPMVV

LDTAGTVNDLFEKRGTSYSSRPVTTMVNELYAYAQYSLGGYSLAH (?)

WRKHRHLFHQHFNTSAMHVSRPVVLREAHTFLHNVSRTPVDDWSIVFGGH (2)

ADAIVTMLSYGHQIAPEGEMYVDTRTRLSQ (0)

AYLLLLLAKTRTSL

IYDVVKHVPAWFPGAAFKKQALQWREANRMMLNVPLEKVQ

67 amino acid deletion here

QIDRIFASDKLPTF

ADREDLX

YVDCIVWEYLRWNP (1)

VTPLGLPCQVTEDDTYCGX

YIPKGATIVSNTWY (0)

MYPYLLLFDPDRFADASRNASLGIHELPNAAFER (2)

MCPGRVLAFETI

WITIATTLAGFHLSEPRDEHNEVIQLDTPNTPKLLS (2)

HPKPHQCAVSPRSERALFLVVESLDG*

 

>CYP5136A1 PFF_311a  
 

MSSLLVLVAISLALSQLIRFYRWLFHHSISYLRGPVADSFILGNVREFTYQESV

GDLDFRYMNEYGTAWRMKSILGSDVLMICDPKALQHVLHKSGYHYPKNTEA

RIGSFNVTGRSILWAPNGDIHSRHRKIMNPAFTAQQLRSFLPLFRRGSNKMCQ

LWKDEVLAQAPTGMTIAVNQWLARTTLDVIGEAAFDFSFGALDDADNEVSK

AYHNMLFADSLLYPSAWSTIFRGLWRFIPDQLLSYVRYLPTREYTRFRYTLNII

NKVSKSLIDQKSEDLLSGDKSSKDVMSVLVRANSSENPRSQLSEEEMVSQMA

TLTLAGHETTANTITWLLYELAKHPEYQQKMREEIAVKRAEINARGDADFTM

DDLESMQYLHAALKETLRYHPIVYHLAREASKDDVIPLAYPVTTIKGETVSEI

PIAAGQIIMPNIAAYNRLPQVWGDDAHEWNPLRFIDDSPEVQVRLGMFGNLM

SFFAGVRGCIGWRFSLIEMQAIVADLVENFQFSIPPEKPEIIRVPAGIMGPMVK

GKMHEGLQMPLHVTPL

 

>CYP5136A2 pc.142.11.1  
 

MAAAALLIICWLVVNLRRLLTHNSIRHLRGPPSASTLFGNVTDTLYQASVGDV

EFRWLKEYGGAWRLRGLLGANILALADPKALQHVLQKSGYNYPKTRQLSVT

LFNLTGRSILWAPTGEIHARHRKVMNPAFSVPQLRSFIPLFRQSAKKLTQIWKDQV

NAGHPDGVTLPVDRWLARATLDIIGEAAFDFDFGALDNTENEVSKAYHRMF

ADSQLYPSVWNLLFQATWSLLPEPLLYYIRYLPTREYKTYRSTLSVMDKIAAQ

LIEERTREFGAGDPDKSRKDVMSVLVRANMSENPSTRLSDEEMRSQMFAMTL

AGHE

TTANTVTWMLWELAKHPDIQEQLRQEIAEKRMEVTANGSYEFALDDLESMP

LLQAVIKETLRYHPISSFLWRVAAKDDVIPLEKPIVTTTGETITEIPVAAGQVIM

PSLCSYNRLAHVWGEDAHDWNPMRFLQGDTEKQTKVGMLSNLITFSAGVRS

CIGWRFSVLEMQAIVVELVENFRFSLPDNKPEIIRAPTMTMGPMVKGKLHEGF

QMPLRVVPV

 

>CYP5136A3 pc.16.161.1 

MAVIDYTLHASSPLVLLACTVCVAVLAFRWYSSSTHGSIAHIRGPPVKNPILG

NIRDFSYQENVGDLDFAYMKEYGTAWRLKSSLGKSVLMVADPKALQHIFHK

SGYLYPKTTPSTVRSFLVTGKSILWAPDGNTHSRHRKIMNPAFSAPQLRSFLTL

FRKSSSKLCQLWRDEISPEGSTVLVNKWLARTTLDVIGEAAFDFDFGAMQDN

QNELSVAYDNMFTDATLHTSPWNAIFEALWDYIPDGILKQVQHIPTREYARF

KQTLGVFAKYSKRLIAQKSADLVSDTHSKDVMSVLVRANAAEDAGRKLNDE

EMVSQMSALTLAGHETTANTISWLLYELAKHPDFQEKMHAEIVAKRAEIVAR

GDEDFTMEDLESLEYLQAAIKETLRYHPIAFHLNRMASQDDVLPLAYPVMTT

AGEKVTEIPVRKGQAIMPNLAAYNRIPEIWGADAHEWNPMRYIENRTDAQVR

VGMYANLMTFSAGVRGCIGWRFSLIEMQAIISDLVENFRFGLPKDRPEVLRVP

AAVMAPMIKGRMEEGAKLPLHVTVY

 

>CYP5136A4 pc.16.153.1

SGACVLCLAWLAYRWYRWTTRLNISYIRGPPVKSWILGGNVRDFAFQENVG

DLDFKYVQEYGLVWRMQQPLGAQVLMVADPKGDIHARHRKAMNPAFNNA

QLRSYYPCFRRTSSKVCQLWKDQILSQGPNGATIRVDRWMARAALDIIGEAA

FDFDFGALDDSANELSAAYHNMLSADSTLRPSAAQAVFQGLWTHAPLRVLE

RVRHLPLRDIARFQHAMRVFNTYAARLMARGAAGAAHGRDVMSVLGTAHA

NASADPRTRLSAEEVRAQMCALTFAGHETTANTTTWLLWELARHPPAHQDS

VRADTVRRRAHVAARGDADFGVEDLDALPCLEAAIRETLRCHCIVFHLNRVA

SQDDVIPLSRPLTTATGKTVTEIPVAAGQVVMPNIAVYNRTRTKWDPTRFLDG

RVDNPEVRLGVYGNLRTFAGGVRGCIGRHRMIEMQAIVADLIGHFRFSIPDDK

PEIVRAPSMLMAPMIKGKEHEGSQMPLHV

 

>CYP5136A5 pc.14.209.1 
 

MFHGYLSATFQAQRRPGNIKDFTYQQNVGDLDFQWVKQFGRVWRMQSPFG

TDILALADPKAMQHCFHKADDQYNKRVESTVGSRMMMGKGLVWASGTTHE

RQRKIMSPAFTTAQIRSFLPFFRAGAAKKWRDELFNHSTDGAAVPVNKWFSR

ATLDILGETAFDFNFGAVDDKDNEVTLAFHTMLFANSCLRPPKWDLLFKRIW

YFLPNPLLELVQYVPTKEQNRFRRCRLVVEKVSQQLIQEKREALLAEAKSSRD

IFSVLVRANVSENPNSRLSDEELIAQMGTLVLAGHVTTATTLSWMLYELARR

QDYQDKMREEIVAARARLQERGQQDFSMEDLENMHYVSSCLKETLRFHPPV

YHLFRQANTDDVIPLEQPVRTTSGKYVTEIPVAAGQQVLFSVCAYQRLPEVW

GEDAGIWNPMRFIDGNVDKQSKLGLYSNLMTFSAGSRGCLGWRFTIVETLAII

VELLEHFKFEPTEDTAKVIRVPTGIMSAFTAGKEREGPQMLLKVVPIL

 

>CYP5137A1 pc.5.122.1   (SEQ ON OPP STRAND FROM THIS MODEL #) 
 

MNNLTAALILVALALWFACRRFTRTTLRDIPGPKPVSFWLGNLEQYFLGQAG

EGDFHLQERYGRIARLHGSIGGEYLWISDPNALRYIFQTSGYRYAKQPERRAL

SRLHSGHGLVWADGEVHKRQRKVMLPAFGAPESKALLPHFARAAEAVSVK

WKDILTTAPSLSKELNVSTWLSRATMDAIGEAAFDYHFGALENTDTDIVRAY

NNLMPIVFGAPTADAIFKRDALRIFRSSRIVEWIYDRQRNPAVEKARECEELTL

KIARELVENKAEALEQGKGSKDIFSLLVKANMTEDAKSRLSEEEMYAEMRTI

LFAGHETTSTTISWVLLELARHLPVQERLREEILAHKRGGELSATDLDGMPFL

QAVVREALRLHPVLNQTFRQAEQNDVLPLAHPLTDRTGTVLTALPISKGTRVI

LSIAAYNRDTELWGSDAHAFDPDRWLDGRVKKVQTLGMYGNLLTFAAGVR

GCIGWRFAVYEIQTFLVELLANFEFRPTEDLKRLRREPCGVMVPTLEGDRGTV

QLPLRVSLLDHKI

 

>CYP5137A2  PFF_88 NOT IN TREE
MHDIFPLAVLLGALLWIVRRILSRSSIRDICGPEPESFWLGNLKQFFMRQAGEG
DFELQERYGRIARLHGSIGGEYLWVADPKALQHIYQASGYNYAKQPERRALS
RLHSGHGLVWAEGEVHRRQRKIMLPAFGAPESKALLPHFIHIAESLSMRWKDI
LLASRDFAKELDVTEWLSRATMDAIGEAAFDCQFGALDNGGSEVLRAYNDL
LPMVLGVPTTDGIWKRDAMRIFNSSAIVEWIHDRQTNDVLQRARECEQMVM
KVAKELVSSKAEALVQGKGSRAYFSLLVKANAAEDAASRLSDEEMYAEMRT
SSLAGHETTAMALSWALLELAQHPEVQSRLREEVRGCKRGEELSAAVLDSMP
YLQAVLREVLRVHPPAIHNFRQAVRDDVLPLAHPITTKSGSVLTELPIQKGTR
LILSIAAYNRDPDLWGSDPHMFDPDRWLDGRVKKGQVVGMYGNLLSFSAGV
RGCIGWRFAIYEMQAFLVELVSNFEFGPTEDLKRLRREPCGVVAPMLEGEQG
VQLPLRVSLANYDV

 

>CYP5033A1 Ustilago maydis

36% to CYP5034A1 GenEMBL XM_399595.1 37% to white rot Scaffold_7 C-term

MAISTSSRLVIHQDVLSWLQHRPFASAFTLLVVYITYKLAIKPILFPSPYRHLPRPERASYILGQRI

VEANGLTYIDASTNQRVKVSGPGEVCKHYARTLDTSVFVFPEPFGGETLFISDPFALNAILADVDKF

QSDLLRTTIIEFIVGKGIVARFGDAHRKQRKLMAPAFTPAHIKGLTPIFAKYAQLMCHKIALADDES

VDFAEYLDCTMLDIIGEAGFGYRCSALERGRGGSELSSAFNSVNQAAIDFGPARAIHLGLSAMLYPR

ASIWPLSEANRRIAKVNRVMDRITMQIVREAKSRVEKEGEDLGDKKDLLSLLIKSNLDARIGERMTD

KEISGQIQTFMFAGYETSSVTTSWTLYFLARHPEVQNKLRNILTATLSERKGIPLEELDVSTLEYDD

VWCQDLEYFDWILAETLRLCPPLSGNDRQAMQDSVLPLMTPVKMTNGENVSQLMVKKGSRLTIGIKT

VNCDRKLFGDDADEFRPERFAELPQRHAEAKLPPYATYSFFGGPKSCIGSKFALTEMKVIIIAVLSR

FQLSPEP GVTIKQHQALIVRPRVETSTGGPAAGMPLRIKRLPHQVSV

 
>CYP5138A1 pc.65.27.1 
  

MPLLSAVPAAALPLLGAALYVLWTFLALLVRQARSPLRHLRGPPSPSFLVGNL

REMHDQENTALFARWEHRYGSTFVYHGFLGGARLLTTDPVAVAHILAHGYD

FPKPEFIRDALASMAAGHEGLLVVEGEDHRRQVRASPAFATPHIKSLSPIIWSK

ATQLRDVWIDLASSPSLTPAATPPGTKVDVLAWLARATLDVIGEAGFGYAFN

SVRAAACPGDAAEDELARAFAVIFSTARKFRLITVLQVWFPFLRRFVSIPPRCF

LALPLKSSLSSDPSQQLSTNAMLCQIATFLAAGHETSASALSWALYALARAPA

CQHTLRRELRALTLPADPSAADLQAVLALPYLDAVVRETLRVHAPVTSTMRV

AAHDAAVPVGTPFRDAHGAQHAAIRLRAGDIVTLPLQAMNKWGADAACFRP

ERWLAHGDAPREPRGLWGGVMTFGTGVVANGNRSCIGYRFAVNDVVTRPC

VKSEPHLGNQMPLRLRRVAVEETVGDSSGDGAPRTVS

 

>CYP5139A1 gx.38.22.1 
  

MGYPLAVYAVGALVALIVYSVGPTVWHVLTSPLRHLPGPPNDSLLWGNMAA

IQNEEISVPQARWVKQYGHTISYRGVFGMWRLWTVDTRALNHILTHHLIYQR

PLPSRYQLSRLVGPGVLVTEEERHKHQRRVMNPAFGPAQVRELTEIFTEKANE

MRDVWYNEITKAGGASAQVDALSWLSRATLDIIGRAGFGYDFEALTGASNEL

NQAFSTLFARPIARHRFFARIGMQLIEQRKAAILAEKGKDVERKDLTGRDLLT

LLIRANMATDIPEDQRLSDEEVLAQVPTFIVAGHETTSTATTWALFSLAQMPEI

QRKLRNEMLTIDTDTPSMDQLNSLPYLDAVIRETLRFHSPVPVTTREAMADD

VIPLGTPTVDRYGRTIDHINIKKGDLVFVPILAINRSKEIWGEDVDDRPERFEN

VPEAASTVPGVWGNVLSFLGGPRACIGYRFSLVDIVTRPVMTGPDGKTRGAL

PLIIRPYRP

 

>CYP5140A1  pc.96.21.1 
 
MNASSIDFFPRNLATSPVFSAKPFLLALSLISTYLVSVAFYRLFFSPLASIPGPW
YAAVSDLWITTHVLRMQQCRVVQDLFDTYGPIVRIGPNKVAFCDAGTMRSV
YCVHKFDKSAYYKSLLTNNNDHAMTTLPHAEHAIRKKTYAPHYTPANLALF
QPELNDLALKLTDILSIRSSSVDVLDLFRHLMVDVIACTVFGSRSGSLDNWNK
GVRDPLSIAVYDFPKRGIMVRLCLSSPVTASDNHIRSGAQCLLGPGSFIAGVDT
SSTSLSYMFWELSRRRDVMQRLQAEIDEIMPDPRVIPDATVLNRSEYLNAFVK
ECEYACHPCPAEILRDPIALHFDMMGYALPPGTIVATQAWSMHRDEDVFPSA
ETFLPERWLVDPHADREVEEERLARMHLHLVPFGVGTRQCGGQNLAHLMIRI
VVAVVVRNCEVRADVRETNERSMSMRDAFVSPLLWLLLGSERS
 

>CYP5141A1 pc.181.9.1

 

MISDTFALAISSGLSLFLCLKAFIDYRAGLRSINHSYLPGFRALISSFGILGLFFK

EPKRGLWGGRRRFWLRKHLDFEEAGVDIISHIAFLPSVSTYLLLADAAAIKEV

TGHRARFPKPTYKTLRIFGGNVLASEGEEWKRHRKVVGPAFSEHNNRLVWN

ETVKIVNDLFANVWGSQSEVYVDNVVQSVTLPMALYVISIAGFGKRALWQA

DGNLPPGHKLSFQDALHILGTDLWIKAATPTLLMNWAPTTRIANVKLAFDEV

KQYMLELIQERRNSEKRDERYDLFSSLLDANDLNEDGNGNVTLTNDELLGNI

FIFMLAGHETTAHTLAFTFGLLALHPDYQETVYQQIKSIVPDNRPPMYEEMNS

LTECMAYETLRLFPPTATIPKIAAEDTYLVTIDRAGNRVVVPVPCGTALHLNVI

ALHHNPRYWDNPSAFKPERFRGDWPRDAFIPFSTGSRSCIGRRFFETESIAILT

MILSRYKIELRNDPRFADETYEERWQRVLRVKDGLTPA

 

>CYP5141A2 gx.37.18.1

MFSNTFALAITSGLLLSCLKAYMDYRAALRSINYHPGSCALIPSFGMLGLLFK

EPRRGLWGGWRRFWRRKYLDFQEAGVDIISHIAFVPSVTTYLVLADAAAIKE

VTGHRARFPKPSYEFFRIFGGNIIASEGDEWKRHRKIAAPAFSEHNNRLVWNE

TVKIVCGFFENVWGSQAEVYVDDVVQSLTLPMALHVISIAGFGKQTVWRAD

GTLPPKHKLSFQDALHVVSTDLWIKFVMPTMLLDLAPTKRIAKVKLAFEEVE

QYMLELIQERRDAEKRDERHDLFSNLLDANDSDENGDGSVKLTDEELLGNIFI

FMLAGHETTAHTLAFTFGLLALHSDYQEKVHQQIKSIMPDNRLPTYEEMHLF

TECTAVFYETLRLFPPVTTIPKISAEDTSLVTTDRAGNRVVVPVPCGTSLHLSV

VALHYNPRYWDDPYAFKPERFHGDWPREAFIPFSAGARSCLGRRFFETEGIAI

LTMILSRYKIELKDDPRYAHETYEERWQRVLDVKDGLTTT

 

>CYP5141A3 PFF_77b

 

MNSVLVILLSTILLLCLKTYVDLRTALRAVNYHPGFKSFISCFGVFGFAFKEPR

RGLIGGSLRFWHRKHLDFDEAGVDVIHHVSFFPRVSTCLILADPAVIKEVTSH

RALFPKPLYHELRLWGGNIIASEGDEWKRHRKVGAPAFSEPNNRLVWNETVK

IMVDLFDNVWGSQDTIIVDHVVDAFTLPVALFVISVAGFGKNASWQSDLLPPS

GHKLSFKDAIHVVSVDMFIQVVTPTFLWKLAPTKRIADVKLGFEELEKYMLE

MVEERRNAPKKEERYDLFSSLLDASDSDADGGARLTDRELLGNIFIFLLAGHE

TTAHSLAFTFGLLAMHQDYQEKLYQHVKSVIPDGRLPTYEEMNKLTECMAV

FYETLRLFPPVVGVPKVVAENTTLVATDFTGKRRAIPVAAGSDIHISILALHYN

PRCWDEPHAFKPERFHGNWPRDAFLPFMAGPRACLGRRFFETEGIAILTMLVS

RYKIELKDEPAFAHETYEERWDRLFTVKQGITLA

 

>CYP5141A4 pc.181.12.1

MGTLAWVVLSFCLFYCVQKYLEFRAVVRSIHDHPGFRTLLPPYGIFGFLFKRPI

PGITRGGMSQWRGKYRDFEAFGMDIISATSVIPTARNAFLVADPAAIKEITSSR

TRFPKPVAQYRVLTFFGANIVTAEGDEWKRFRKITAPAFSERNNRLVWDETV

KIMLDLFENEWAGKDTVVVDHAVEVTLPWIALFVIGVAGFGRKMTWQEDSK

LPPGHQLSFKEALHYVSTAVFVKLATPAWLLTWAPTERMRRTNLAFKELEQY

MLEMIQTRRNSEKKEERYDLFSNLLDASEDGSDGHARLADEELLGNIFIFLLA

GHETTAHTLAFTFGLLALYPEQQDKLYKHIKHVIPDGRIPAYEEMNLLHESIA

VFYETLRLFPPVTGIPKVAAEDTTLVTTDHSGNKVVVPVTKGTGISLHVPGLH

YNPRYWDDPYEFKPERFHGDWPRDAFLPFSSGARSCLGRRFFETEGIAILTML

VSRYKIEVKEEPEFAGETFEQRKERILAARGGLTLTYVCSPPHLRNLLNLPLR

 

>CYP5141B1 pc.37.84.1

MQQHLLFAAGLICLFLVKRCIEYRRAIRAIHNYPGVRAVLSNSSGLGYLCKRSI

PGLAVGGARLWVKRYSDFCRYGADIVSCVAVLPRTEILLFVADPAAIKEISSD

KTRFSKPTELYELVNIFGRNIVTTEGDEWKRHRKIVAPAFSERNCELVWEETL

HVMIGLFNDVWGSDSIITLDNAFDITMPISLFVVAASAFGRRIPWTEGGLAPPG

HHMSFKEALHIVSTGTVIKAVLPKWLLNLGPSQYIREVRDAFREMEAYMREM

VTENMLDDTKSRRDLFSSLVHAGQDSPGQEALLTDAELLGNVFMFLLAGHET

AASTLCFALGLLALHKDEQDKLYDHIRFTLGEKDVPAYSDLTSLSYCSAVLYE

TLRLFPPVIGIPKKATEDTVLSTVDRDGNHIAVPVPVGSSVAIHVPGVHYNPRY

WKDPAAFRPSRFFGNWPRDAFLPFGAGSRACIGRRFFETEAITALTMLVVRYE

ISVTDEPQFRDETAEQRRERVLSATQELTLT

 

>CYP5141C1 pc.81.19.1   

MASRLLVLLAALVLFALRAFARFRRAVHAVSYVSSALRSVNHPGYRTLLNTL

GPIENFFPRIPGVAPGAFHMWKRKHRDFEEHGWDVITY

VAAFIGSSTNFYVADADVIK ()

EITTHRSRFPKPIEQYKVLTFFGGNIVASEGEHWKRYRKIAAPAFSE ()

RNNKLVWDETRLIMQDLFTNVWGERAEIYVDHAVDITLP ()

IALFVIGVAGFGRRIPWQDEDVVPAGHTMTFK ()

TALHTVSENVFTRLLIPDWLLRAAPTARLARIRDAFAELEQYMREMIRARRER

PAREERHDLFSSLLDASKDADVRLQDSELIGNMFIFMLAGHETTAHTLCYML

AMLAMHPEVQDKMYESIRGVTQNGRLPEYEDMRSLSYCEAVLYETLRMFPP

VNSIPKSVAEDTAITITNADGERTTVPMPKGSSISIHTPGLHYNPRYWPDPHTF

RPERFLAADWPRDAFLPFSAGPRACLGRRRFSETESVAAAAMLVLRYRIAVA

DEPRFAGEGARARFERVTASRPGVTMTCVFCAPLWVVVGTDELCCRPTRVPL

VFRRR

 

>CYP5141C2P pseudogene FRAGMENT pc.167.26.1 91% TO 5141C1

genewise.20.89.1 [whiterot1:25284]

VAAFIGSNTNFYVADADIIK (0)

EITTHRSRLPKPIEQYKVLTFFGGNIVASVGEHWKRYRKIAAPTFSE (0)

RNNKLVWDETRLTMQDLFTNVWGRHAKIHVDHAVDITLP (0)

VAGFGRRIPWQDEDVVPAGHTMTFK ()

TALHTVSENVFTRLLILD

 

>CYP5141C3P pseudogene FRAGMENT pc.67.69.1 84% TO 5141C1 

VASFIGSNANFYVADADVIM (0)

GNTTHGSRFPKSIEQYKILTFFGGNIVASEGEHWKRSRKIAAPAFSE (0)

RNNKLVWDETRLILQDLFTHVWGKRAEIHVDYAVDITLL (0)

IALFVVGVTCFGRRIPWQNEDVVPAGHTMT*LK (0)

TVLHTVSENVFMRLLIPD

 

>CYP5141D1 pc.81.21.1 
  

MLLILWALLAAVVYHAAARLVRLRRLLVKIRFHPGQRAATSIYGAATFLFPW

RIPNLTPGANLLFDEKHALLARHGLDVVTSVSTHPMRAVFVVADPAVLRDM

AAARSRYPKPVELYGSLSLYGPNIVASENDAWKRYRRICSPSFSERNNKLVW

EETVRVVTELFDTWEGRQEIDMEDALTMTLSITLFVISSAGFGKPITWKGGDE

RPEGYAMSFKDVIYHMSTGVFIKIATPQWLLNLGLTEKMRNTNVAFKELGM

YMSDMIRERRESQQREDRGDLFNGLLDAGEEDEKLKLTDEELMGNIFIFLIAG

HETTGHTLCYALALLALYPDEQEKLYQHIRTLCPAGELPVYDDLRNYTYALA

VLYETLRMFPSVVGIPKVASEDTCVQTMNDAGQLVEVFIPEGSDIVFDTPGLH

YNPKYWTDPYTFSPSRFMAPDWPRDAFLPFSGGPRACLGRRFARFAEIESIAV

LVLFVSQYTIHLKEDPKYAGETEQQRRERVLKSVPGLTLT

 

>CYP5142A1 ug.79.41.1
MDDVNLFIRARTLLDSVLVLILTSIGYAVANAVYNVYFHPLSKFPGPRMAAAS
RWWKTYVEVYRDESIVDRLFHLHEKYGNVVRIAPDELHFSDPAVYNAIYSPK
SRWNKDPLMYAPFGFGSHRSMFSTVEYQPAKKRRDLAAPHFSRKSVLNLQG
VIQAGVSNLCDAMAQRAAEGKPTDIYSAFRCLNFDNVTSYCFGWSLHMVRS
PDFSAEPVQNMQDMHSSYQVWKHFLWLRTPMRLLLSVLGKRPMPYFRVIME
QVDGYLERPEELDNAPHSLIFHSLMDPAQSTKLDKQSVVEEANLLIIAGTDTIS
NASALGTLFLLSDGGYMRDKLQAELKAIWPRLDDKPSLEVLESSAPYLKAAC
KESLRLSHGVMSPLLRVVPSQGATLGGHFVSGGTKVGICNAFVHLNPALFPDP
HVFRPERWPEPGAESLDTWLVAFSKGPRSCIGINLGWCELYMNLANLFRRFD
LKLDHRVQVLFLGGS

 

>CYP5142A2 pc.79.57.1 
 

MNVWARVSEGWTALEVILVALLTSIGYVVTTALYNIYFHPLSKFPGPKLAASS

WLWKAYVEVIKGESILDRLSKLHEEYGPVVRIAPDELHFNDPAVYNEIYTARS

RWNKDDVMYAPFGKDTSIFTTREFREAKKRRDLSAPHFSRKTVLSLQGLIQE

GIDEFCEVITKRDADSKTTDIFRAFRCLDFDNVSSFCFGWSEHAIQAPDFNSAA

VEELQHSNKDFQFWKHFLRLPLPVLLLASRIKNQIATYIDKPEELDKTPHPTVF

HVLMDSSHGTRLSATAMAEEASLFLIAGTDTTSNASALGTIFALSDNGYMRN

KLKEELKSVWPRLEDKPSLEVLESLPYLKAVCKESLRLSHGAMSPLMRVVPQ

QGAVLGGHFVPGGTKVGMAHTFVHFNPTLFPEPHTFRPERWLEPGAEALDT

WNVAFSKGPRSCLGIKSLAWCELYMNIAHIFRRPVRPYDLWHRDCFLPYLDG

VDLLVYATPSTD

 

>CYP5142A3 pc.24.27.1

 

MDVVRQALEGRTTKEYAGLALLAFAAYVVANIIYNLYFHPLAKFPGPRAAA

ASRWWKAYVEVYKGESIVDRLFELHAEYGDVVRITPDELHFSDPKVYNEIYN

TRSRWDKDGEMYAPFGGNSTMFTALRYHDAKKRRDLTASLFSRKSVLSLQGSIQEGL

DELCDIISARSAAGKTTDLFRAFRCLNLDNVTSFCFGWSLHTVRAPDFRAPPL

EEVQNSHGGYQFWKHLMLFRAVLLPKLKEQVDALVARPDELEAAPHPIIFHS

LIDPAHGAKLSAQELMEEANMFIVAGIDTTSNATGAGVIGVLSNPSTYDKLKT

ELRTAWPRLDEKPTVEVFESLPYLKAVCKEALRLSHGITSPMLRIVPPQGATL

AERFVPGGTQVGVSHLFVHLNPTLFPDPHAFRPERWLEPGAESLDTWLVAFS

KGPRSCLGINLGWCELYLNIANLFRRFDLKLEGRAKAFLDGPRARASGDWKD

CFLPCFEGPDMLIHTTPVAD

 

>CYP5142B1 ug.20.42.1

MLNLSLDSSSVLSLVWTASPWLLLSWILYTVLMAVYNLHFHPLAKFPGPKMA

AASEWWLAYVEVIKQESLSKKLWELHEQYGANATQLHFSKPAAYNEIYNVK

NRWDRDMKLYHIFADEVSTLTIPDYARAKKRRDLTTFLFLARILLRQLDTVCE

NIDKHIKEGKPVSIFKAFRCAAADVICTMCFARSMNATSEPGFNAQVVTAIHA

AFPVIMVFKHFPLLQTLSRMVPPLLLSSLRPELNGLMKMRKMLTDQVKEVKA

HPEILKESQQVTIYHELLKDPKNIPSDTSLRDEAVLYVTAGMDTSSDTLTLATI

NVLSRPDVHARLMHELVEAWPHLEDAPPRYEQLEKLPYLTAVLKESLRLSHG

VVQPMTRVVPREGAYISGHFIPGGSIVGMSSIFVHWNEEIFADARAFKPERWL

DPEADLDPWLVAFSKGPRSCLGVNLGWCELYMSIAAIFRRYELKLNGIG

 

>CYP5142C1 pc.20.56.1

MLRLLVDNGLVSALARYGPAMLISIIVWTLGRVVYNLYFHPLAKYPGPRMAA

ATEWWQAWLEIFKAESLSLTLLELHAKHGGDIVRIGPNELHFSRPSAYHEIYT

SKNKWAKNPAFYRYIVSPTESTFSTCEYDKAKKRRDITLPIFSRKSILGMQHLV

QECIDSMCENIDKHISEKKSVNILRAFRCCALDAVTSLCFARNTRATSEPEFRA

PIEVAMDFSLPLTPVLKHFPMVQVVMSWLPPDVLLWADARLGGFVQLRKML

DAQVEEILRDPDVLASAEHPTIYHAFLAHAPTPSVAELRDEALVYVHAGTDTS

SDALAVGTLNVLGRPAVLARLRAELDTVWPRLDERPRYEALEALPYLTAVV

KESLRCSHGVVHPMTRIVPRGGARISGAHIPAGTIVAESNIFVHWNADVFPEP

HEFRPERWLEGKTPSGESLDNWLVPFSKGPRSCIGINLGYCEIYMTFANLFRR

YDLSLDGVKPSDWKWRDCYLPHYLGPEMKVVATPRLS

 

>CYP5142D1 ug.43.40.1

MAGQLMAHSLDVLSTMFTLLSLYAITRCIYNLYLHPLSRFPGPKLAAATTWW

RAIGEVFMWENLTDKLVELHNTYGPCEIVRIGPNELHFSRPSVYHEIHNPRNK

WNKDPAVYNVFADTESTVSICNYEAAKRRREMTLPLFSRRSIVDAHDLIRSCL

DKMCTNIDSIASSGEPVHFFRAFRCFALDAISLMCFGVSPEASLAPHFRSTLDG

AMHVALHDALLVKQFPLLKYLMAYSPQWLVTYTRPALRSYFEMRRVRLSLP

TLRQLVYLRSTIAAERSSAGSQEGTPLSEPVLRDEAFVFVNAGADTVSNAITV

GVLNVVDNRDVYTKLKHELRCAWPNLKVSPRWEELERLPYLRAVVKESLR

MVIGVVHPMTRIVPPQGAVLCDMFIPGGTSVGISHYFLHHNEDVFPQPRTFKP

ERWLARESDKEHMLVSFSRGPHSCLGVNMAYCELYLAFAYFFRRYDVELNG

VRYVHVSSRETELTN

 
>CYP5142E1 pc.167.13.1
MDSWLSWHGVAAAVVAAALLLVVYRVYFHPLAKFPGPKLAAATHWYSAY
YEVWRDGALVEHLQELHKQYGPVVRITPDEACISYTDIYVRGTRFTKDPGFY
GFMHGDRSSFWMLDPQKSKARRDVLLPLFSRRAVLSLEDVVQKKVRALVTA
VLTQGADDTSVNMHRAYRSATLDTILAYAFAQERGMLDVPGFAHPLVREFE
RAFPLALILKHLPWLHRVSTAVRAVKYMLVRTDPDDIVRDTAAQIDGLLADP
DRLAELPHETVFHRFLAPHAKGAGGEPPSRRDIVDEAINIFAAGSDSTGHTCA
MGTAFVLAYPEVHKRLVRELEEAWPDRDAEIRLAQLEKLPYLTAVIKESLRM
SHGVVMPLPRVVRPNEAIIDGISVPAGAVVGMGATFMHYNPEVFPQPYTFDP
DRWLQPDVSRLEQHLVPFSKGLRSCIGLTLAWCEMYLVFGYIFRLLDMQLDN
MTLEDIKVKYHFTPTVREKDMLRCMVRARES
 

>CYP5143A1 gx.20.61.1

IILIILATISYRLSPLHPLARYPGPILDKSTSLRLAYLAFIGQRAQYVTELHERYG

KIVRIGPNKLSINSLDVVHPIYGSSQAYDKSESYRPGLSAEGSIFFARKKELMR

DGDPEGVVESGHKAILMFETYCDSFGEVPALFDILSVLPTGEAYQLVEKRAAT

HLKDRIKVHPHDGWDMCSFFLAQREGHNYPPMNEVDLNANTVVAFEAGGD

TTAGFIIITMFHLLRYRQAYDKLKEELDGAFPTGSVSVEEYSHLAELPYLGAVI

NEGLRLGAAFPSFPRVVPKGGAMLAGEFIPEGTMVGVPIYTQHYSPDNFWPEP

REFRPERWFEDGLGPGTITRQAAFMPFQFGPFGCPGKALGLRLMSVVISNLLV

LSYDLSFPPDFDPEAFLNGWINTRTNIFRIPLRVEAKRRPW

 

>CYP5143A2 PFF_33b(pc.20.120.1)

MFNSFGPAHVLLPPLALSVIIAVAAYRLSPLHPLAHFPGSWVDKVTSLRVAYF

ALTGHRAEHVTSLHDKYGVVVRIGPNRVSINSSDVIYPIYASPQAFDRAASYR

PGLIHDGSLLFSRKRHWDGALKDRVDQLIDCIARRQDLRGVVDLGEFMRNGD

PHNICRSAKDSIVLFEVYSSSLGEIPALFDIASVLPVTAEYRKVERHFQKHINER

MQIKSHSDWDFCSFFMAQREDAQYPPLSKPDLNADAMVAFEAGGDTLAGFL

SIIIFYILKHQPVYQKLRAELEQAFPLGEIAQDQYASLTEIPYLVAVINEGLRLG

ANFAGFQRVVPQGGAVLAGQFIPAGTVVGVPAHLQHIHPDNFWPTPLEFRPE

RWFKDGLGPGTITRQSAFMAFQFGPFGCVGKTFAYRQLNVVLSRLLLAYDLT

FALDFDSKAFVEGWLNIRTTIFNYPLKVQASRRQW

 

>CYP5144A1 ug.24.32.1     revised 8/15/2007 at I-helix micro exon, also removed one 
small intron after AGVYL and added a micro exon VDVIPA
 
MELPAHTKYLLACLAFAIFVLLHSKRRRPRYPPGQRGLPLVGNLWDIPTEYA
WVKYREIGAQLGSDIIHFEVLGSHYVVLNSDKAVKEVLEKRSHNSSDRPQTV
MLQELTGWHRNWALLEYGDYWKDLRRIFSQYFRPSAVPQYHSKQTKAVRRF
LNLLLNSPDDFTKHIRYLAASAILDVVYGFDVRPGDPRIELVERGVHTLTDISA
GVYL (1)
VDVIPA (1)
LKYIPAWFPGASFKRKAAGWKVLVDAVYEVPYSQYKDAMREGTAKPC
2461961 FAGTLLSEANPDGDLDETFRCLTGTAYV (1)
GGADT (0)
2462165 VSSTLLTFMLAVTMFPETQDPAHEELDRVLGRKRLPDIRDRDDLPYITAM 2462314
LHEVLRWHPVAPLTLPHRLTADDEYEGYHIPAGAVVFGNAWAILHDPATYGD
PDVYAPARYLTADGRALRADVPYPLEGFGFGRRVCPGRPFAHDILWLALAHVL
AVFRVGRARDAHECEVPPRGVFTPGLISVPEPFGCRFVPRFPGAEELIRQSAMP
E

 

>CYP5144A2 ug.24.29.1 revised 8/15/2007 at I-helix micro exon and at VDVFPI,

AND  KQSIMVNEL, AILRDED

 

MEDTSRSLVGPSLWAVFALGLLFAFCLRRQPRYPPGPRGLPIVGNVFDIPMNV
GWKVFRDVSRCFESDVIHYEALGSHLVVVNGAKAAKELFERRANNYSDR (2)
KQSIMVNEL (2)
TGWHRNWGQLEYGDRWRQHRRLFHQHFRPMAVSQYHPRQVKGVRVLLRA
LSESPEDFQRHIRFMAGATIMEIVYAYDAQPGDPRIKLVEDAVDTLTFVVNAG
VYL (1)
VDVFPI (1)
LKYVPNWFPGASFKRQAAEWKKLVDALYEQPYQEFKATVKEGN
2465265 AKPCFAATLLSSVENDEDIENLEELFMGLTGTAFV (1) 2465369
AGSDT (0)
2465493 TIASLNVFILAVTIFPEAQRSAQEEIDRVLERKRLPTMEDKVLLP 2465627
HVTALVHETLRWHPPLPLAAPHRVIEDDEYEGYFIPAGTTIIGNAW (2)
AILRDEDLFPDGDSFKPERWLNEAGALRDDLPYPMETFGFGRRICPGRHFAND
VLWLAIANILTVFSIERALGEDGQPIVPEAKFSPRLISK
PEPFKCAFKHRFSGAEDMIRLAAIVEE
 

>CYP5144A3 genewise2nd.24.5.1 REVISED AT PRSVMLHEL 8/16/2007

 

MELPPVPHPLIAYLCAGLLLAGLVVTRLRRRRHYPPGPKGLPLIGNLFDIPTDYAWKI

YRAFGDQYGSDIIHFEIFGTHLVILNSAKAARDLFEKRSSIYSDRPRSVMLHEL

TRWGRSFGFMQHGDEWREHRRLFNMHFRPSAIAQYHAKQKSAVCTLLRSLLDA

PEQFREHVHFMAGDVIMGIVYGFDVQPGDSRLQLVEKAVMTLNQIVNAGVYL (1)

VDVIPA (1)

LKYIPAWFPGAGFKRHAAEWKKLVDDMFEIPYRESMKSLQEGKCESSFAASLLAQ

LEGQESPDNIERIAMDVLGTTYVAGSDTIITATSTFLLAMILHPEVQITVQAELDAL

LEGARLPNISDKAALPSVTAVLQEVLRWNPGLPLVPHRVVADDEYKGYHIPAGA

AVIGNTWAMLHDETTYPDPEPFKPQRFLNEDGTLNADVPYPTDVFGHGRRMCP

GRHFAHDMLWLTIASILTVYKVERDVDEDGQEITPTASFTSRVPTPFRCRFTPRSA

SAESLIRSSGVSTE

 

>CYP5144A4 pc.24.8.1(gx.24.6.1) revised at micro exon 8/15/2007

ADDED KQQSVMIHEL AND REVISED LAST INTRON BOUNDARY 8/16/2007

NOTE THIS GENE IS COMBINED WITH CYP5144A5 IN JGI BROWSER (e_gww2.1.398.1)

 

MEQSTLHILPYLCASIPVLVCLLVLRLRRPHYPPGPKGLPLVGNLFDVPLSHGW

VAYRELAKQYGSDVIHLEILGSHIVIINSAKAARDLFDKRSNIYSDKQQSVMIHELTGWHRN

WGFMAYGDYWRKHRRLFHRHFRPAAVPQYHSAQAKGVHNLLKLLMRSPERFREHIRF (2)

2473972 MAGSTILDVVYALDVQPGDSRIELVERAVHTSTEIVAAGVYL (1) 2474097

VDLFPI (1)

2474217 LKHIPSWVPGAAFHRKAAAWKALVDRMYEEPYNQFKASM 2474333

KDGNAKACLTASLLMEAESTHQLDAIEDILISVTGTAYGAGTDTAVASLNTFMLGITMFPH

TQLAAQDELDRITARQRLPTMEDRENLPHVTAILQEVLRWNPAAPLGLPHRTVRSDEYNG

YFIPQGATIIGNSWAMLHDEAIYPDPGSFKPERFLTEDSTLRSDVPYPIEAFGFGRRICPGRYF

AHDLLWLTIAGILAVFRIERARDEQGDEIVPAGDFSPRFIS (2)

SPEPFQCRIVPRFAGAEALIHGTGLLG*

>CYP5144A5 pc.24.9.1(genewise2nd.24.7.1)   

NOTE THIS GENE IS COMBINED WITH CYP5144A5 IN JGI BROWSER (e_gww2.1.398.1)

 

MEWSLSLGYALLGLGIMWVVKYAQRPRRRYPPGPKGIPILGNVFNIPLENSWISFDQ

WSRQYASDIVHVEALGKHVYVVNSARAAKELFDGRANVYSDKEQSVMMLELCGW

SRSWAMLPYGNYWREHHRLFHQHFRPQSMVRYHEKQRRGARRLLQLLLDTPEDYE

KHMRYAAGSTILDVVYSFDVQPNDPRIELVEAALGTANDLMHAGIYL (1)

VDIFPL (1)

LKHIPTWFPGAQFKRLAAKYKRLVDNMYTVPYSQLKASVKLGTAQPCLVASLLS

EADEHVTPERDEIFMNLAGTTYAGGTDTIVIALSIFILAMILHPEQQVAVQKEIDR

VVGRDRLPELADRESLPRVTAVIQEVLRWHSPLPLATPHRATSDDEYNGYYIKA

GSVVIGNAWAMLHNENVYPDPASFKSERFLTPDGKLRDDVPFPIEAFGFGRRICP

GRHFALDSLFLLVSHILAVFTIEHAVDADGHIIPVEPEFEPQAFSPPKPFKAQFKLR

FLAAEDLIDGSALE

 

>CYP5144A6 pc.24.10.1  revised at micro exons 8/16/2007
 

MLTALSCVFAEALAVWAVSSWTRPRHEYPPGPKGLPFLGNMFDIPMKYGWVTF

ANWSRLYGSDIVHVQALGKHIYVINSAKVAKDLFDGRPHIYSDK (2)

EQSVMTQEL (2)

SGWKRAWALSPYDDEWREYRKLFHQHFRPSAVQQYHHKQTKAVRRLLQLLLD

TPEDFLAHLRYAAGSSLLDVVYSVDALPGDLRITLVEKAVHTFAKLLETGVYL (1)

VDVAPI (1) LKHIPAWFPGADFKRQAAEYRQLVDDMFKVPYQQFKDAWRRGTAQPCFAASLLT

DADPLDGSEHEELFINLTGTTYAAGSDTTVAAMSTFMLAMALHPEVQRWVQEEL

DRVVGRGRLPEMADQPALLRVMATVHEVLRWHPPLPLATPHRAMADDVYAGF

TIPAGSIVLGNSWAILHDDKTYTNPHTFDPRRFVGPNAQPFPEVVFGHGRRECPG

RHFALDILFLAVAHVLSVFAIERVDNSDPGIGDIQGLFTPHVLSYPKPFKASFKPRF

PGVESLVRTAALSEI

 

>CYP5144A7 pc.24.11.1 This is hybrid with genewise2nd.24.9.1|whiterot1 in second half (GENE IS SPLIT IN GENOME VIEWER)

MSRFLYDYSTLLYLCAGITFVVLITLSSRPRRRYPPGPKGLPIVGNLFDVPTDHGW

KRYQEIGKEYGSDIVHFQVFGSHIVVVNTAKAARELLDKRSNIYSDKQRSVMIHE

LTGWHRNFSLMPYGEGWRTRRRLFHQHFRPMAVPQYHTRQLKAVHGLVQSLFE

APQNYKEHIRFMAGSAILDIIFAFDIQPGDPRIEIVEKGVQTATEFMCSGVYL (1)

VDVFPI (1)

LKYLPSWFPGAGFKRQAAKWKALVDDMHEIPYYQFKQTMREGKAKPCFASTLL

SSAAENDKDSLESLDEIFMSLTGTAYVAGSDTTISALNTFVLAMTMFPETQAAAQ

EELDRVLGRKRLPDFDDRDSMPYLTAMVYELLRWHSVLPLGLPHRTLADDEYN

GYFIPAGTVIVGNCWGMLHDDDLFPDPDIFRPERFLNADGTLNSDAHFPIETFGFG

RRICPGRYFAQDLLWLTIANVLAACSIERVVDEKGFEVRPTGDMTPRVLSMPEPF

ECNIRPRFSGAEALVRSACLND

 

>CYP5144A8 genewise2nd.24.9.1 = Scaffold_205i revised at micro exon 8/15/2007

AND AT QQTVMIHEL

fgenesh1_pg.C_scaffold_1000787 [Phchr1:787]

MEALASRITVYLCAGVVLVYVFSRVFKRRPHYPPGPRGLPIIGNLLDVPSLYGWI

AYKNLGDQCGSDIVHLEVLGSHYVVLNSAKAARDLLDKRSNNYSDR (2)

QQTVMIHEL (2)

TGLERGLGMLPYGDYWRLHRRLTQQHFRAAAVPQYHARQAKVVRKLLHSLLD

SPERFMDHIRFMAGAIILDIVYALDVHPGDHMIEVVETAMGRINEIINAGVFL (1)

VDVIPV (1)

LKYLPSWFPGAGFKRRAAAWKVDIAPMFEAPYERFKQSLGGTTRPSFAGNLLSR

VQNEEELSQLEDVFMNITGTAYGAGSDTTLATLTGFVLAMTIFPEKQLAAHAEL

DKVLERKRLPEVEDMQYLPSITALVYEVLRWNPAAPLGIPHQTIVDDEYNGYFIP

AGTVVIGNAWAMLRDPNTYPDPDTFKPERFLAKDGSLRDDVPYPTEAFGHGRRI

CVGRHFAQDVLWIAIAHILTVFRIERAVDEDGREIVPVPDYTPHFVTMPKPFKCRF

TPRFPGAEGLIRSAADASNE

 

>CYP5144A9 pc.83.7.1 revised at micro exon 8/15/2007,

revised at RQSTMMLDEL and EFTARIVS 8/16/2007, EST = DV758101.1

MAVLLAAGYYILSVAVFILLYNASRRRQRLPPGPKGLPLIGNLFDVPNDYAWLRY

KELGQQYGSDIVHMQALGNHILVLNSMKAAVEILDKRADISSDRQSTMMLDEL

SGLGRAWTQLGHNDSWRIHRRLFHQHFRPSAISQYHTKQTKAIHRMLSFLRESPA

QYMDHIRFMAGSMILDVVYTLDVQPGDYRIKLAEMVAHVSTEVFTAGVWM (1)

VDMIPM (1)

LRHLPTWFPGAGFKIQAAKWKTTVDRSYDIPYEQFKASMHEGGGEPCLASALLS

SAEDVEELERMDKVFSSLTGTAYIAGTDTTVSTLASFVLAMTIFPEAQLAAQAEI

DRVLGGTRLPDINDKANLPQVTAILYETLRWNPVLPLALPHRTTADTSYDGYYIP

AGTVVLGNSWAILQDETLFPEPQLFKPERYLNGDGSLNSSAHYPIETFGFGRRICP

GRYFAQDAVWLAIAHILAVFKIERARDGDGKEIVPTPEFTARIVS (2)

MPKPFECKFKVRSPQAESLIESAALGG

 

>CYP5144A10 pc.83.8.1 revised at micro exons 8/16/2007

MALLVYFCAGLVPVLLLVLGLRKRPRYPPGPRGVPIFGNIFDVPMKYAWLEYVK

YGQQYKSDIVHFQVLGQHIVVLNSLQAVGDLLDKQSSIYSDR (2)

VPSVMLNEL (2)

TGWSRSWVQMEYGDQWRMHRRLMHQHFRSTMIPQYHPKQTKAVRRLIQSLLE

QPEHFMEHVHFLSGSLILDVVFSFDVRPGDAILALAERAVDTTKAIIAAGVWL (1)

VDVVPI (1)

LKYIPSWFPGAGFKRIAAKWKTDVNKMFDVPYAKFKDSMREGSATPCFASALLS

GAEDDNGGVIDNQDEVFISLTGTAYVAGSDTLSDALSTFLLAMIAFPEKQRAAHE

ALDCVLERKRLPGVEDRDALPHITALAYEVLRWHPVVPLSIPHRTTADSYYKGY

YIPAGSTIFPNSWAILHDEALYPEPHLFRPERFLNEDGSLHAHARDPIEAFGYGRRI

CPGRHFAHDALWLAIAHILAVFKIERALDVDGNEIEPKLDFMPHFLSMPKPFKCR

FTPRFPDAANLALSASSDY

 

>CYP5144A11 ug.83.30.1 revised at micro exons and after EXXR motif 8/16/2007
GC boundary at HIRY, added C-term
MGWTLCLYALLGLTGLWVAARVRRPRQRYPPGPTGLPVLGNVFDVPLENGWL
VFDQWARQYDSDVVHAEALGRHIYVVNSAKAARELFDGRPHVYSDK (2)
DQSVMLLEL (2)
SGWWRSWVMLPYGDYWKEHRRLFHQHFRPQSLPQYHEKQAKAARRLVRLLLD
SPQDYAKHIRY (2)
ATGSSILNVVYSFDAQPGDPRLELVEAAMGTANELMHTGVYL (1)
VDIFPV (1)
LKHLPMWFPGAHFKRQAARYKRLVDDMFEIPYAQLKSSMQEGTIEPCFAAALLS
EAEDSASPERDDMFMNLAGTAYAAGTDTIMMTLLTFILAMVLHPEEQAAVQEEI
DRVVGRDRLPGLADRESLPRVTAVIQEVLRWHPPLPLA
TPHRAASDDEYNGYHIPAGALVLGNCWAMLHDARVYPDPDVFRPGRFLAAGGD
APRADVPLPAEAFGFGRRICPGRHFALDSLFLFVAHLLAAFRIEHAVDAEGNVVP
VVAAFEPQAFR (2)

SPPKPFKARFTLRYCGAENLVRGGVRAG*

 

>CYP5144A12 pc.16.82.1 revised at micro exon and added one exon before it. 8/15/2007

fgenesh1_pg.C_scaffold_8000230 [Phchr1:5055], added N-term 8/16/2007

added RTHSVMLNELSGWAE and WYTPFPLG and C-term exon 8/16/2007

MELWFDFPSVVTYVLAA

VSCASLLILHTRRRPRYPPGPKGLPIVGNLLDVPTHNAWIKYKQLGKKYGSDIIHF

EVFGSHIVVLNSTTVARDILEKRSQISSD

RTHSVMLNELSGWAE

ERNFGFMRYGDGWRRQRRLFQQHFRRKAVTQYHAIQSKSVHSLLNALLDRPERF

IANLRF (2)

MAGSMILRIVYGTDIQPGDSRLTLVEKAVGTLVEVMNAGVFL (1)

VDVFPI (1)

LKHIPSWMPGAGFKRKAAEWKVLVDDMYEVPYNVGTLSIFFLAMTIFPSVQVAA

QEEIDRVLGRKRLPSIEDRNALPRTTAIVYEVLRWYTPFPLGVPHRTIADDEYNGY

FIPAGTTIIANAWYAMLHDEERYPNLETFIPERFLNKDGSLRSDACIPLEPFGFGRRI

CPGRYFAEDIVWLAIASILSVFRVEPPVDEHGEPLKQTATFGTRFLS (2)

PAPFKCCFTLRYPEAEGLIRASATSTA*

 

>CYP5144A13 pc.16.83.1 = GX.16.34.1 (USE THIS MODEL)  = SCAFFOLD 4e
 fgenesh1_pg.C_scaffold_8000229 [Phchr1:5054] ver2, 
ESTs = DV761651.1, DV753979.1
revised at micro exon  8/15/2007, revised at AHSIMLNELS and C-term  8/16/2007
REVISED SEQ = 50% TO CYP5144A8, IT SITS NEXT TO 5144A12
MTTLALASSLTYLFAGVLLVCLFVSYARKRPRYPPGPKGLPLIRNLLDIPADYPWIT
YRDLAEKYNSDILHFEVFGSHLVVLNSAEATRQILEKQSSITSDRAHSIMLNELSG
WDTDRTVTFMEYGESWRRHRKLFQEHFRQQAIPRYHHAQTKGVNRLLKSLLDTP
EKFSAHIRFMSAYTITEVVFGKEVGPDDPSIEVVDDGMHTLNELLNAGVFL (1)
VDIFPL (1)
LRYVPSWFPGASFKRLAGKWKKAVDDMYTIPYNNYKATLGEGDANTCLLATAMADKVD
QDDARVVDHDLMCLAGTTFGAGYDTTATALGIFIMVMAVHPEAQISIHEELDRVLHRDRL
PTMEDRKELPRTTALMYETFRWHLPLPLG
VPHQTTAAIHYNGYFIPQGANIVANSWAILRDEGLYPDPETFKPERWLDADGSLR
DDMRFPVEMFGYGRRICVGRHFAEDIVWLAIASILSVYKIEPPVDENGTVRALEAD
FTPRLFSAPKPFKCRFTPRFPGAEGLIRASL*

 

>CYP5144A14P pc.24.16.1 = gx.24.13.1 PSEUDOGENE MISSING C-TERM

revised at micro exons  8/16/2007

MPDCTTIGYLLASVALAYALASRHPRSSRYPPGPRGLPLLGNLFDMPRKHSWTK

HQELSKTYESDVIHYQVLGLHIMALNSGEAVRDLLNKRSTIYSDR (2)

QETVMLHEL (2)

TGWHRNWALMRYGDAWKERRRHFHEHFRPQAVSQYNFKQVKAARILLNSLLE

SPRAFSEHIRFMASSLILDIVYALDVRPDDPEARRVERALETLAEISASVFM (1)

VDLIPV (1) LKYLPSWFPGAGSKRQASIWKNIVDEMFETAYQVCKNSAQHEYVRPCFTTALLS

EVSDPANMKEMDEIFMSLAGTTYI (1)

GGSDT (0)

 

>CYP5144A15P PSEUDOGENE pc.24.17.1 64% TO 5144A1 
IT APPEARS THAT 5144A14P AND 5144A15P WERE PARTS OF A SINGLE
GENE DISRUPTED BY A TRANSPOSON CONTAINING A RETROVIRUS-
RELATED POL POLYPROTEIN THAT NOW LIES BETWEEN THEM
AQSAARSSTASTEQINATLNTWMLAMTLFPDTQVAVQDELDMVLGRKHLPSIED
RDSLPRVTAMLHEVLRWHPVGPMGVPHRLTVDDEYRGYHIPAGTIVMINAWAIL
HDESVYPEPDIFRPERYLDSDGRLRTDMPYPVEGFGAGRRLCPGRHFAHDMLWL
AIAHVLTVFRIERAVDEDGREIVPEAKFEPWLIRCASLCVGVPCTAHLAVSPPEPF
QCQTKLRFPEAEGLVHLAAMDE

 

>CYP5144A16 NEW SEQ 2588519-2588442 REGION (-) STRAND SCAF_1

68% TO 5144A5 AA 311-336

e_gww2.1.906.1 [Phchr1:132380]

MEGIPILSYVTLGLVTVWTILSLRKPRRRYPPGPKGLPVLGNV

FDIPLENGWLIFDKWARQY (1)

GSDIVHVEALGKHIYVINSAKVAREIFDGRPHNYSDK (2)

EQSTMLLEL (2)

SGWGRSWVMFPYGDYWRQHRRLFHQHFRAQSIPQYHQKQAAAA

RRLLQLLLDTPADFAKHIRY (2)

ATGSSIVDVVYSFDTPPGDPRLEIVEAAMGTASELLHSGIYL (1)

VDVFPI (1)

LKYVPAGFPGAQFKRKAAHYNKLVKDMFTIPYTQVKTAM

KEGSVQPCFTTALLSESDDLDTPERDKIFQSLVGTAYAAGTDTLMISMLTFMLAMVLH

PEAQT

AAQNEIDSVVGRDRLPGMTDRDSLPRVTALIQEVLRWHCPMPLATPHRAIVNDEYNGY

HIAAGSVVIGNA

WAMLHDEDVYPDPHSFKPDRFLTTDGRLRDDIPFPIEAFGFGRRICPGRYFAMDALFL

FVSHVLAVFRIE

HSVDAHGNVVGVEAEFQPQGFRCA*

 

>CYP5144A17P gx.24.12.1 49% TO pc.24.17.1, 57% TO 5144A5

scaffold_1:2496394-2495844 (-) strand

2496394 IADREPLPPVTA 2496356

2496230 HTPRYERRHSGYYMSAGLLVIGDTWY (0) 2496153

2496068 RFLMAERALRTDVTFPIEVFGYSRRICLGRQFAKDVLFLAISNILAIFTI

EKAVDEHSGSIEVQNAFLPHAIRCA 2495844

 

>CYP5144A18 fgenesh1_pg.C_scaffold_1000782 [Phchr1:782]

same as Scaffold_205c gene model complete, revised at micro exons VDLIPI (1) and

PQTVMLHEL 8/16/2007, 62% to 5144A1

GC boundary at PGLIR

 

MESLTLRNCASAFLAG

LLVLACGLVLRPRRRPRYPPGPKGLPLVGNMLDIPTEYAWERYYELGKEY

GSDVLFFRVLGSHFLVLNSAAAANELLEKRANVYSDR (2)

PQTVMLHEL (2)

TGWDQNWAFWEYGEGWKQARKMFHQHFRPSAAPQYHLKQ

TKAARRFVKLLLESPASFAQHAR

FLAGSAILDAVYAFDVQADDPRIALVERGVHTLVEISRGVFL

VDLIPI (1)

LKYIPSWFPGAGFKRQAAQWKDAVDATYSDPYRQFKTLL

RNGQAEPCVAASLLSSSGDEPSGALDDLLKSVAGTAYV

GGSDT

VSATLTTFILAMTMFPDAQAAAHAQLDEVLKRTRLPEMADRAALPYITAILYEVLR

WQPAGPL

GLPRRLMADDEYRGWHIPAGTVVLPNIW

AMSHDPGTHAVPAQFVPARYLAADGTLREDVPCPADVFGFGRRVCPGRPFAQDV

LWLAI

AHVLSVFRMEGPMGERGEIRHSRLFTPGLIR (2)

LPEPFACSFRPRFPGAENLVDAGVVG*

 

>CYP5144B1 pc.23.12.1   revised at micro exon AND PHAPIVSTIL  8/16/2007
e_gww2.8.230.1 [Phchr1:138753] 

MLDTTPFTLALLTVGAVCLLGLIKGASRRRRLPPGPKGVPLLGNIFDAPKEHEWR

TFKEWGRTYESDVVHFGILGTHYVVLNSAWAALDLMDKRSHNYSDN (2)

PHAPIVSTIL (2)

TGWDRNWGFMKYGDYWRAHRRMFHQHFRPNAVSAYHSTSQQAVRELLRLLY

AKPEHFKEHIQHMTGYNIIKLMFGVAVSPEDDPILARMENALRILGKIANPGVYL

(1)

VDSFPL (1)

LRFIPSWVPGAKFKRDAEAWKPVIDKTYTQVYEEIKTSYANGSPVPCLVTEMLED

VLKVDNEAYRDMLEDVIINGGGTAYVAAYDTSSSVLSTFVLAMLLYPDVQRTA

QEELDQIVGPDRLPTMEDQPSLPYVTALATEVLRWRPALPIGVAHKSVVDDEYR

GYHIPGGSVIIPNVQAILHDEGSFPDPDTFNPRRFLDSEGQQLEELTGIVSAAFGFG

RRICPGRYFAKDVVWLTIASVLSTFNIEKHFNEAGNAVEPSGEYTPGIISYPAPFK

AAFKPRSESAVELVR

 

>CYP5144C1 ug.83.31.1 revised at micro exons 8/16/2007

fgenesh1_pg.C_scaffold_1000766 [Phchr1:766]

MFSALVLSLLLAAALFLRFRRKRYPLPPGPKGLPIIGNARDIPKSFPWYTYDRWSR

EYNSEIIYLRLVGTDVIVINSEKAANELLNKRSTIYSDR (2)

EHMTMLLDL (2)

VGWGGRNFAFAHYGDLWRAHRRLFHQYFHPGAVPAYHAKSTLEVRRLLPRLLS

HPDDFMQSIRTMTGAIILGITFGMELQPENDPFVALAEEALHAMAQVGNVGSYI

(1)

VDYLPW (1) LQYLPSWAPGAAFKRQAAKWNKIVLEMYEKPFQTIKQALARGEAPPSILTSMLE

TLDPEEDNAARESDMRHVTGTAYTAGADTTVSSLGTFILAMLLHPEVQRRAQEE

IDRVVGSDRFPEYDDRDSLPYITAIMKETLRWRQVTPLAVPHRLRVDDEYNGYH

LPAGSVVVGNSWAMLHDEERYPNSDLFDPTRFLTPDGELDPDAPGPELAAFGFG

RRICPGRYFAMDSMWIAMAHILATVNIEKAVDDAGNILEPSGEYTYPVPFKVAFK

PRSAAADALIQGGTPLA

 

>CYP5144C2 pc.83.19.1 revised at micro exon 8/15/2007
fgenesh1_pg.C_scaffold_1000761 [Phchr1:761]
REVISED EXXR REGION AND PSHTLLVTV, and E*LTYAKWSREC (1)
Added C-term
 8/16/2007 Note: there is a stop codon in a conserved region, possible pseudogene
 
MDIPVPYAFIVVGALVLFFRLRKKPRFPPGPKGLPIVGNALDLPKAR
E*LTYAKWSREC (1)
GSDIIHLRFFGTHVFVLNSVKVVNELMVKRSAIYSDR (2)
PSHTLLVTV (2)
TGWQRNFTFVDLGDHWKARARMFQQNLGTSTISKHRPKLIEGNRKLLLNLLLSP
DDFMKHIRYLSGSSILGIIYGIEVQQDHDPFVETAEKALQCLAAVINAGSYA (1)
VNYVPI  (1)
LRFLPTWAPGAQFKRDAAEWYKYVTALIDGPYTYVKESLANGENNTSIVGTLLQ
ELSDDEKRSEQEDTIREAFGTAYTGGVDTTYSSVNSFILAMLKYPDVQRKAQEEL
DRVIGRDRLPSFDDRDALPYITAIVKETLRWGLVAPLAAPHQLRVDDEYEGYFLPA
GSVIIGNAWAILNDEKRYPHPESFIPERYLTTDGTLDSSAPDPMEACFGFGRRMCL
GRYFAFDSLWIAVASLAAAFHMEKAVDESGLVIEPSGEYTSGTAC (2)

YPLPFKAVFRPRHEGVVALIKADVSESDSL*

 

>CYP5144C3 pc.20.52.1 revised at micro exons 8/16/2007

 

MDDIVLVLLVACAVALYARTKRTRYRLPPGPKGLPILGNTYDIPAKYEWLAYEK

WSRDFGSDIICLKFVGTPVIVLNSIQAINDLLEKRSSIYSDR (2)

PVTVMAYEM (2)

VGLDRNFGFVPYGDVWREHRHLFHQYFRLDMVPKYHDRMLKHSKDLLQRLLV

SPDRLMEHLRFSVAGASILNISYGIDVQPENDHYIAVADEAIHALAVTGNAGSYL

(1)

VDYLPL (1)

LRYIPAWVPGAKFKRDAANWWEKTRLMIDEPFNYAKQRMAQGKGMDCVTAV

MLSAIGEDQDREHQELLIKQVLSVSYIGGADTTVSALATFVLAMMQNPKMQRIA

QADIDRVVGGERLPSVEDRDSLPYVTAIVKEALRWRPVIPLAVPHRVTVDDEYK

GYHIPAGSIIVGNVWAVLHDETRYPNPDVFDPTRFLTSDGQLDNNAPDPAEACFG

FGRRICAGRYFALDAVWLSVACILATFDIAKPLDENGNPIEPSGEYTTGLLSHPVP

FKVSFKPRSAAAEALVREPISRDL

 

 

>CYP5144C4 gx.20.26.1 revised at micro exons 8/16/2007

MDYLGISILLVAALALHYFLRKKRYRLPPGPKGLPILGNALDIPAKHEWLAYAK

WGQECGSDIIYLNLAGTPVVVLNSAKAAKDLLEKRSSIYSDR (2)

PVTVMAHEL (2)

IGLGRNFGLKPYGDTWREHRRLVHQHFRTENVPRYHEFTSKQIGRLLLHLLEDPS

NFVRHLRIMAGASILRICYGIDVQPDNDHYLSVADEAIESIAATGNAGSYL (1)

VDSLPI (1)

LRYLPSWAPGAQFKRDAAKWKEKVDRMIAEPFDYAKRYMASTEGAATDYIAGL

LLSAMDPGRDKTQQEIAIRDSLWAAYVGGADTSVSALATFTLAMVLYPDVQQT

AQAELDRVLGKDTLPTIEDRDSLPYVTAVVKETLRWHPVTPLAVPHKVTTDDEY

RGYHIPARSIVVGNVWAILHDPDRYPNPESFEPSRYLTSDGLLDPAAPDPTEACFG

FGRRICPGRHLAYDTIWTGIASILSSFDISPPLDEQGKPVNPSEEYTTGMLSHPVPF

RANFKARSENVEALIRRITLCE

 

>CYP5144C5 pc.20.54.1 revised at micro exon 8/15/2007 and EIMVMCHEM

MQTVVLAILFVFAIALPIYSRRKRYRLPPGPRGLPIIGNILDIPAGREWLTYAKWSR

EYGSDIIYLNMAGTPVYVLNSIQATTDLLEKRSSTYSDR (2)

EIMVMCHEI (2)

VGWGKNFAFQPYGDFWREHRRMFHQHFHPEAVTKHHVHILKQAKDLLQRLLVDPDD

FMQHLRFMAGAAILRVSYGINVQPENDHYIGIAERAIHSLALTGNAGSYL (1)

VDNLPI (1)

LKYLPSWAPGARFKRDGEIWRREVDQMFSEPFELVKRQMVGADGEPPDCVTAS

LLTTLDERKDRPREELEIAVKQAVGTSYVGGADTTVSSVATFILAMLQFPDVQRT

AQAEIDRVVGSTRLPTIEERGSLPYVTAVMKETLRWNQVTPLAVPHKVTVDDEY

KGYFIQAGSIVIGNSWAVLHDETRYPNPEAFDPTRFLTPDGKLNPSAPDPVEAAF

GFGRRICPGRHFAMDAIWMNLAFILATFNIEKPLDEAGRPIEPSGLYTPGLLSHPEP

FRVKFIPRSKAAEALIRETMFYD

 

>CYP5144C6 pc.20.55.1 revised at micro exon 8/16/2007 and VVTTMAHEM

MENITFAVLFVLLLAVPLFFKRQRYRFPPGPKSLPLIGSVLEFPVQSSWLTYQRWG

RELASDIIYLNVLGKHIYVLNSAQAVSDLLEKRSGTYSDR (2)

VVTTMAHEM (2)

VGWDKNFALQPYGEFWREHRKAFHQQFQPDMVPRYHVHMYKQAKDLVRRLIA

EPNALKQHLRYMAGALILRVSYGIDAEPNDDHYFEIIEQAVYSLTEVANTGAYL

(1)

VDFLPF (1)

VKYVPSWMPGAQFKRDATEWAPQVNQMFDEPFDVVKRALAEGNAPDSVCAAL

LSELDPRKDRAHQETVIKQAVGTAYIGGADTTVSTLSTFVLAMMTHPDVQRTAQ

EHIDRVTGGDRLPTIEDRDALSYVTAIIKEALRWRPVLPMAVPHITTADDEYRGY

HIPKGSIVMGNAWAVLHDEARYANPDAFDPTRFLTPAGTLDKDAPDALEAAFGY

GRRVCAGLHFALDSMWVNVACVLATLDIRKPVDEHGVPVEPSMAYTTGLLEQP

EPFAVVFKPRSQAAEALIYEGHDD

 

>CYP5144C7 pc.142.5.1 , e_gww2.9.179.1 revised at micro exon 8/15/2007

revised at RLHSTMLHDY 8/16/2007, ESTs = DV760024.1, DV759090.1

revised region after EVLR WRPVAPL

MDTLLLAGLVAVAVVAAGCLAHSRRQRFPPGPKGLPLLQNLLDVPRHRPQWEA

YRDWGLKYNSDIVHLRLFGVSFVIVNTADAVTELFSRRSSVYSDR (2)

LHSTMLHDY (2)

IGWEKAIVMKNYGEDWREHSRLFHQSFQPKVIQEYYPRLYEEARKLLPRLLKGD

DFVASLRVMTASAILGVTFGMEINDSNDPYVTIADRAIQSLVEAGMPGSYM (1)

VEYIPL (1)

MRYIPSWAPGGKFKRDAAEWRTLVSDMFTKPFEHIKSAIRHGVARPSIATSLLMG

LDDKQDNARREHVIRNVTGTAYVGAADTTVAALRTFILAMVMHPAIQKAAQAE

LDRVVGRDCLPTFADREHLPYLTAIQYEVLR (2)

WRPVAPL (1) GFPRRANADDEYHGYHIPKDAIVLGNIWAILHDPARYRDPAAFDPARWLTPDGA

LRADAGDAMLAFGFGRRICPGRHYAVANMWINMAYMLAAFDIAPPRDAAGRA

VPPAGEHTTGLLTYPKPFGAVFTPRSAAALRLIVADADD

 

>CYP5144C8 genewise.35.22.1 = GX.35.9.1 revised at micro exons 8/16/2007

e_gww2.4.188.1

MGVLILCAIAILAALLCYHHFRARRFRLPPGPKGLPIVGNVLDVPKDGPGWLTYE

RWSHEYGSDVIYLNLLGSSIVILNSSKATTDLLDKRSPIYSDR (2)

QRLTVLHDF (2)

VKGDRAFAFLGYGDEWRQHRGIFHKYFHGQAVHNFRPKMLEEARKVLVRLQST

DDYDRCFRVMSAASILGVTFGMDIEDINDPYVVLAEEAINYVLSAAIPGSFV (1)

VDSLPL (1)

LKYLPAWAPGAGFKCKGAEWHDLVSRMILTPFETLKQKMAEGTAKPCIATAIVQ

KLEESKGGDAQRETQIAQYVTGTAYTAAADTTVSSLCTFILAMVLNPEVQALAQ

EEIDRVIGTTSLPDYTYRDSLPYVSAIMYEVLRWRPVAPLGVPHRLMEDDEYEGY

HIPGGSLVVGNIWAITHDPVRYLNPDAFDPTRWLTTDGQLGDVTDALVAFGFGR

RVCPGRHYALEALWITLVHVLAAYRIEPPVDAHGRARPPSGEYLPGFIAFPAPFK

AVFKPRSPVALGLIQTALG

 

>CYP5144D1 pc.24.13.1 (genewise2nd.24.10.1) revised at micro exons 8/16/2007

 

MLDRSVLLPCLVGIVAAIIIVSRRGRERYRFPPGPKPLPLIGNLLDAPTDLGWYTY

AKWARQYHSDIIHFEVFGQHFYILNSVRVAKDLLERRSQVYADR (2)

QQSVMVQEL (2)

TGWHRVFSMKAYGESWRQQRRLFHQHFRQQAIPEYHAELTNGARMLLRSFLES

PNHFLEHIRHISGGTILAVLYGIDVDNYSAERMESIEKAIEIVTEIADGGVYL (1)

VDFIPL (1)

LKYLPTWFPGAGFKRRAAEWRVHVETMFEAPYGDVKRDMKLGKAKPCVATKL

MSAFGDKAEDPEIEELLICVTGTAYAASDTIVFAMIAFVRAMMVFPEVQCKAQQ

ELDRVVGRDRLPVISDQASLPYLAAVTKELLRWHPITPIAVPHKSTTDDWYDGY

YVAAGSIVIANVWAMFRDEERYPDPEAFRPERFLTAEGTLDPAVPDPVEVFGFGR

RMCAGRHYVDAALFLAIAHVLHALTIEKPRDARIPVVDPPPGYALSRLFWAPEPF

EADIKPRFEGVERLMQMSSLHSF

 

>CYP5144D2 pc.24.14.1 revised at micro exon 8/15/2007 and at QLSVMACEL

MLSSTILVFSSVCTLAAIVAIVRRFGGKRRHHFPPGPKGLPIVGNLFDVPTNFGWY

TFAKWAQQYNSDIIHFEVLGKHFYVLHSAALAKELFERRSQTYSDR (2)

QLSVMACEL (2)

TGWHRVLTLTPYGEYWRQYRRLFHEHFRAQVIPQYEDKMLTSARNLLRLLLETP

DRFLRHIRHASGRTMLDIVYALDTEAHNNAVILESVEKAIEIFAEVAEGGAYL (1)

VDHIPI (1)

LKYLPAWFPGASFKRQAAAWRVHVDTMYEAPYQDVNRRLLAGKAKPCITTSLI

SAFSDKCEDPDVEESLISFAGTTYAGSDTSVFKMTIFMRAMLLFPEVQVKAQEEL

DRVVGRDRLPELADKDSLPYISALYKELLRWHPLFPLAFPHKSTVDDWLDGYFIP

AGSLIIGNAWATLHDEERYPDPEAFRPERFLSDDGKLDPSVPDPVEAFGYGRRICP

GRHYADASLFLYIAHILFAFTIRKPLDERGNVIEPPPGVPEPFKASIKPRFEGVEELI

QLSTQLATSD

 

>CYP5144D3 pc.24.18.1 revised at micro exons 8/16/2007

e_gww2.1.419.1 [Phchr1:133291] ver2

MFDNGVTIALLLIGVTLLVAEALKKRHRFPPGPKGLPIIGNLLDVPKDYHWLTYT

AWSRQFDSDIIHLEALGQHYFVISSVDVAKDIFEGRSQLYSDR (2)

PQTVMLHEL (2)

TGWERNFAMMAYGDSWRRHRRLFHQHFRLQNVPAYHDQIAKGARNLAQLLLQ

TPDKFGRHIRHVVGAVILDIMYGIEVAPDDDERMEHLERAVHIFMELGQAGGFL

(1)

VDFIPA (1)

LKYLPTWFPGAAFKRQAMEWKPQVDAMYEISYNEVKDSMQRDQAKPCITSALL

TACWDDLDQSNMEETLIGVTGTGYAGSDTSVFALNAFVLAMMLFPDVQRKAQE

ELDRVVGRERLPSADDRDSLPYISAVIKELLRWHPITPTAAPHKSIADDYYNGYFI

PAGSIVIGNTWAMLHNEERYPDPEAFKPERFLTPEGTLDPHVPDPAEGFGFGRRIC

PGRHFAQASLFLNISNVLATCMIEKPVDEFGNVVEPTRECTSRFFWALKPFEAKIT

PRFEGVENLVQTMSTYTN

 

>CYP5144D4 Scaffold_252d seq next to CYP5144D5

e_gww2.1.429.1 [Phchr1:132914] CYP55% to CYP5144D5

revised at HETVMARDL 8/16.2007, added C-term

MQSNALVIACLVAGLLAVARASRKSRQRRYPPGPNGLPILKNLFDIPRTYSWLTYE

AWGREYNSDVV

HFEALGLHFVVLNSTEAAKELLEGRSHIYSDR (2)

HETVMARDL (2)

TGWHRHWGIMAYGDAWRQRRRLFHQHFRP

QAVPQYHEPMVRSARTLLQLLLESPDDWMRHVHHVSGGTVLKVLYAVDVDPHD

DEGMDVVDKALQIFMKLPEPFV (1)

VNFIPP (1)

LKHLPAWFPGAGFKRRAMEWKVHVDRMFEEPYHKIKVAAVTRPCIATSLLSAAW

EDLEN

PDVEEQLISVLGTAY

GEYNLALEQTIFSVYSFVIAMMLYPDVQRKAQEELDQVVGRDRLPEIADRESLPY

FSAVLKEVFRWHPVTPIAAPHKSLEDDWYKGYFIPAGTIVFGNTWAILHEESRYAE

PDVLRPERFLTPAG

TLDPAVPDPDEVFGYGRRICPGRYFVQDALFLYASHLLAAFTLSKFVDDEGHVEEP (2)

RLTCIFVTLRIPRAFKANIKPRYEGAERLVQMAFTSAS*

 

>CYP5144D5 PFF_252c = GX.24.18.1 revised at micro exon 8/15/2007

revised at HKTVMLHEL 8/16.2007, EST = DV762757.1

MSDSTLLAVGLIFGLLVLARVSRKRPRFPPGPKGLPIVGNLFGIPRDHSWLTYAE

WGRLYISNIVHFEALGQHFFVLNDEKITKEIFEGRSQIYSDR

HKTVMLHEL

TGWHRNWAFTPYGESWRQNRRLFHQFFRAQAIPDYHDHMAKGARGLVQLLLQ

TPENWMRHIRHASGSTVLDAVYAMDVDPNDNERLEGVERAVETLVEIAEAGGY

L (1)

VDFIPA (1) LKHIPTWFPGAGFKRQAMAWKRDIDALFERPYHEVKSAMGCRIFSEQRGKARSC

VTSSLMSMFSEKLGDPDVEETIMGIAGTSY (1)

AGSDTTVFTMFAFVQAMLLYPNVQRKAQEELDRVVGRDRLPEVADRQSLPYVS

AIVKEILRWNPILPAAVYHKSLADDWYEGYFIPAGSIVIGNTWAVLNDAERYPDP

EPFKPERFLTADGQLDSQVPDPVEVFGYGRRVCAGRHFAQTALFLYIAHVLALFT

IDNPLDESGHVIKPRRDCLTRLVPKPFKAKFKPRFTGVEELVHMSSIPTQ

>CYP5144E1 pc.8.2.1 (genewise.8.1.1) REVISED AT PRMPMLLDL 8/16/2007
fgenesh1_pg.C_scaffold_17000192
ADDED N-TERM AND COMPLETED C-TERM revised seq at EXXR
MGDTLALNGGIVLAVIVACSIALLLFQRRPHLP
LPPGPKRWPVVGNAFRFPKEREWLTFMRWSREFGALXDLLYYEMWGRPFVVIN
SHRAAVELFERKSALYADR (2)
PRMPMLLDL (2)
CGWAWDLAFMPYDETWKLARKLFTQHFRAGAAGRYRDEETRCARELLADILR
DDTQLFEHARVTFGKLIMSVTYGIDVRSADDKYITNAQKALYAITATGNVGTYL
VDSIPLLKYIPEWFPGAKFQREAREWREAAEAMSQRPVEDVKIAMAEGTARPSV
LRSLLEDYGETMSAQEAYAILSATGTAYEAAASETTWSATLTVVLAMLLFPEIQE
RAHAELDRVVGMDRFPVFEDQPSLPYITAICKE (0)
ALRWRTPLPL (1)
AVMHRVTQDDVYNGCHIPGGATVVLNSWAILFDPDQYPNPEPFAPERFLAPSGE
LAPDVPEPTAAFGYGRRACAGTAMALDTLWIVVASLLWAFDIRRAVDEMGNEI
DVAGEYTFGVVCYPAPFRCALRPRSEGIRSLISLPE*

 

>CYP5144F1 pc.240.2.1, e_gww2.5.175.1 [Phchr1:131322]
REVISED AT PEMPMLNDL AND MICRO EXON 8/16/2007
MVSAVLQGLAGLVIILLVRWAARQRQDRKQGPHPPGPPGLPLLGNLLDMPDNPS
WMTYIRWSEKYNSDILRLNVLGSNIIIVNSLDAANDLLDKRSAIYSDR (2)
PEMPMLNDL (2)
CGFGWNVAFRRYDDTWRNGRRVFQHELGPQVVKRFRALEEHATHQLLRNLLRE
PAEFMGHLRHMSAFEILRIAYGIEVTGREDPYVDTAEHAVGAVVATCSPGSYLV
NIMPFLKHIPEWVPGAKFKQDAKVWRRYVTELRDKPFSVVKERILRGDAPDCAA
KSLLESLESGEDTAGYTEDDIKYALGSMYA (1)
GGSDT (0)
TVSALGSFILGTVLDPAIQARAHADLDRVCPGRLPTFDDQPELPYIDAIVKEALRW
NPVLPIDVAHCSIADDVYRGYFIPKGSLVLANSWAILHDEAAYADPLRFHPDRFM
AGDALDGRVREPDAAFGFGRRICPGRYMAYDAIWIAVACMLAVFRIDKAKDAQ
GREITPSGEYNVGFAYPKPFPCDIRPRSSAHEALIRATAEDA

 

>CYP5144G1 pc.119.17.1 , gww2.5.320.1 [Phchr1:40563] ver2
revised TVCSISYEL and I-helix region 8/16/2007
MSSLLRVADAVLLCAALTIIYKLCLRQAKPSRLPYPPGPPGYPLIGHLSGPEGPGG
RSWVTFRDWSLQYGSDVIHLNMAGTHLIVLNTLGACSDLLEKRSTIYSDR (2)
TVCSISYEL (2)
CGLGWSFGLQRYGPEWRDGRKCFESQFNAHAVRKYRPALSREVSRFLHNLCTD
PVAWEYHVHHMAGALIMSVGYAIDVQAKDDPYLNAAEHAGECVQKTLVPGAF
LVDILPFLKYLPDWFPGVGFKQKARSWRKSIMYIRDAPYDVTKKRVVSAVVPDC
VAKDLMEKMVNNAKDPVYMERVARSAVGSMYL (1)
AGADT (0)
THSVLSACVLTLVLNPNFLPRAQASIDEVCQGRLPDFSDYEALPHVHAIVREAMR
WNPVVALNLPHRCTTDDIYEGHLIPAGSIVIANIWAILHDPAVYPDPESCNPMRYL
RCSPDGTVTLDPAVPNPADVAFGFGRRICPGRFMGYQTVWLALARMLAAFDIQC
ATDADGVPIVPRGEYDRPKPFECSIKPRSAAHAALVMQDVDAGEL
 
>CYP5144H1 ug.119.22.1, gww2.5.193.1
REVISED AT FGFTMLREL, FGF END DOES NOT HAVE AN AG BOUNDARY
POSSIBLE FRAMESHIFT IN THIS REGION MIGHT CREATE  PRLTMLREL
COMPARE TO LENTINULA EST EB011290.1 WITH PRMTMLNEL
REVISED MICRO EXON REGION AT I-HELIX
 
MASTSQTAFNAALGAACLVYLFAKIYWFVAAGRNLHGLKKLPGPRGWPFVGYLKAAE
RPAWLTYWRWSDEYDSDVVTFDVLGTTVVILNSLKAATELLEARSAIYSDR (2)
FGFTMLREL (2)
VGFDWNITVSEYGPYWRDSRRAFAHAFHPHAVARYRPAELKATHQFLRDLLNE
PEDFHGRIRYLAGRQILHIAYGLEIRDRADPWITAAEHGVEIAVKCIIPGSYLVDLI
PILKYVPEWFPGAGFKRQARIWKKEVTSIADAPLAAMEACDSLPDDSAAKPLLER
MLDSPDDPAYARHVLRGTLASMYI (1)
AGADT (0)
TTSTLATFFHALSRHPAVLYEAQRAVDRVCAGRLPTFADYDALPYIHALLRECLR
WRPVVPLNFAHRASKEDVYEGYRIPAGALVLANNWAIMHDPAAYTDPEDFNPR
RFLRARAGAGANGSGADDSLELDPGVRDPGVAAFGFGRRACPGRYMAYESLWI
VMASVLTVFDVLPAEGDEGEVEYTDGFLSTPKPFRCTIRPRSAAHAKLVYLALEL
DA
 

>CYP5144J1 genewise.24.21.1 = scaf252b = pc.24.20.1 = genewise2nd.24.19.1

46% to CYP205b (CYP5144A2), revised at micro exons 8/16/2007 added N-term

MWVVTCTCAAILYMVLVGLRKRHRFPPGPKGLPLIGNVLNAPAGSSAP

MVYQQWSKLFGSNIIHLKIFGTHFFVLNDAKTASDLLEKRSANYSGR (2)

SQTVMLFDL(2)

TGWDRDWGLLDYGDSWKKHRHVHHRYFHPKVLEAYHPRMEKGVQMLLQLLH

RSPADFNAHLRF

2537737 MTGHIIISIVYGIETKSADHPYIGLAEEGVKAFSATAVPGRFL (1) 2537865

VDSLPF (1)

2538014 LKHIPAWFPGADFKRQAALWKKDVDAMYETPFNDIKAAI 2538130

RRGETNTSIVGAALAELEGQADTEEAENIIMNVAGTAYPTASDTTIITLEFFILAML

QHPEVQRRAQADLERVVGNARLPSIHDQALLPYITAIMHETLRWRPPFRTVSLPR

KSLHDDEYEGYHIPAGSIMIANEWAILHDEARYPNPEEFDPSRFLNTDGSIDHTVP

EPVEPFGHGRRLCPGRHFAMDVIWLTIANILHVYSIEKAVDQSGNVVEPSGKCID

GLLSAPEPFQAVFRPRSDAAIALLRSID

 

>CYP5144-un1 PFF_45b pseudogene
 

PGPQGLPILRSLFHAPAQFQQLAFQDWGHRYIVLNCAQPASDLSDNRSTVYSDKG

GWDRNMGPLAHSAYWREHRRLAPHHFKDHVR

 

FTTAATPGMYL (1)

VDSFPM (1)

LRHIPAWLPGAQFKRAAARWRSIVEEVFDSGNPEPCLAACLPTSHRDREDTLMLE

NVVINTSGTAYAAASGTTTTTLLAFILTTMLYPDVQKAVRQELDSVVGQGRLPE

MADRNALSSIPALMKECLRWRPPLPLGVPHRSTAEDERGRRIQVPAGSTAIGNA

WXXXXXXXXYSDPEAVKPWRFFDAAGFGYGRRVCPGRHCLLDFVWLATANVL

VVCSIEEPFDGQWDTVEPSEQHTTGTIIFLAPFEAVFKXXXXAHVECVR

 

>CYP5145A1 ug.82.21.1 ESTs = DV765434.1, DV765432.1, DV759462.1, DV757969.1
MFYPPLVAVDVVFALLALYLIVRFLQKDRTLPFPPGPKPLPLIGNLLDMPSTYQW
VTFADWHDRYGDISSVTVLGQRIVILNSLDAAVELLEKRSAIYSSRPYMRMAGEI
LLWARTLVLSTYPGELFRDIRRFLHRYIGSRGQLERVAPFYELIETSTQDFLQRTL
ADPVRFVEHIRKNAGAIILNMTYGYKVQEGYDPLVDLVDRAVDGFVAASTPGSY
YVDIFPALQWIPSWFPGAGWKRRAEAWRADTQAMCDVPFEFAKQERLHGDNNS
KNFVSDNLASMETAQQEHHLKMAAGSLYSGGADTTVSAITTFFLAMTLYPEVQ
KRAQEELDAVIGTDRLPTLDDRERLPYTRALVSEVLRWNPIGPLGVPHVSTEDDV
YRGYFLPKGSMFIANIWCVPPSTYTYSEPLRFKPERYLGEQPEMDPRCAVFGFGR
RICPGACLNLAEASIFAVSAMALAVFDISKAVEDGVEITPKVEYTTGTISHPQPFK
CSIKPRSKKAEELIRG

 

>CYP5145A2 pc.82.61.1 (genewise2nd.82.23.1) revised near RYG 8/16/2007
MPSTHITALDIAVAIFALYIIRRLLQRGRTLPLPPGPRPLPLIGNLLDAPSAYHWETF
AEWNTRYGDVSSITILGQRMVILNSLDAAIDLLEKKSSIYSDRPVMPMAGEILLW
SQTLVLSPYPSDRFRDIRRYLHRYVGSRGQLERVAQTHQLIEDETRGFLQQTLRN
PLQFIAHIRKTAGAIILNMGYGYQVKEGHDPLVDLVDRAVNGFVAASTPGSFLVD
IIPALRWVPAWFPGAGWKRKALTWRADTRATCDVPFEFAKQEALRGSTSNNFVS
ANIQDIENAEQEYHLKMAAASLYSGGADTTVSAITTFFLAMTLYPEVQKRAQQE
LDAVLGAGRLPTLDDREQLPYTRALVSEVFRWNPIGPLGVPHVSTEDDEYRGYF
LPKGSIFIANIWYILRDPHTYTEPLRFKPERFLGEQPEQDPRAAVFGFGRRICPGAC
NARVA

 

>CYP5145A3 pc.11.258.1 scaf5 partial seq NOT ON TREE

54% to gx.82.23.1 (5145A2)

MQACLLEVFAHFPPVMAVLLVVLLLILTLFVLVTRKSSRHYPPGPRPLPLLGNIHN

APAQRQWKTFAAWKSTYGDVISLTIFGQRIVVLNSLESAIDLLEKRSAVYSDRPR

MVMVGELLGWAQQLVFAPYGEHFRNMRKILHKYLGARGQLDKIEPYHEIIEAAT

AKFLVRALRDDSDFHLEHNVHMTSGTINLRIGYGHNIAEGDDELVQMMDDALV

GFNRAAVPGAFLVDIIPALKWVPTWCPGTSWKRQAQEWKDLFVRMTEGPYAM

AQQQAERGGHDNIVSMSLSEDMSPEDHYDLKMAVGSLYGGGTDTTVAIILSFIL

AMTLHPEAQKKAQKEIDALTNGERLPVIRDREELPYVRALISEVLRWNPLVPLGV

PHRAIADDVYRGYFIPEGSTIVVNMWQLAQDPEVYADPEVFKPERFLGPDSERDI

RTFVFGFGRRICPGLNLAEASTFAICARILAVFEIGKVVEDGKRITPDFAFRDGAV

RFV

 

>CYP5146A1 pc.59.8.1 , fgenesh1_pg.C_scaffold_1000663 [Phchr1:663]

Phchr1/scaffold_1:2066931-2069520

MDPATVAVAVVCALAVMHVLTRRARTRLPYPPGPPEDPIIGHLRQMPNNDEAAE

VWYRWAKQYGDVMSLNVLGKRLVILSSEEAATELLEKRSSKYADRPRFPIFERIG

WKDMVLLMPYGPYHKTLRKMIQVPFEKDKAFQFRDIQERATSIMLHNFLADPK

GIEHHTHCRYVVSIIVEIVFGHRILSEDDEHLKIADVFVKIQHEASQPSLLDVSPLF

AKLPSWFPGAWFVKYIEDTKAILSHAIHHPVSIVQEQLASGIAKPSFVADELERLI

KAGQLTPQNKYDVSIAAHMIFGGGTETTWNTLTTFIACMLLNPEAQRKAQEEID

KVVGHGRLPDFTDRDSLPYVECVVKETMRWHPVAPVAVPHKATEDDVYRGMY

IPKGAIVIANARSITWDERRFHDPHAFKPERFLPRPLGAGEDFVQGAVYGWGRRI

CPGRHLAGDMVWIAIARVLAVFDIQKARDADGNAIEPNIEFTTAVHPKPFPCELR

PRSEKAASLIKESYELHSID

 

>CYP5146A2 pc.59.23.1(gw.59.18.1) gww2.1.504.1 [Phchr1:38849]

Phchr1/scaffold_1:2095089-2097090 adjacent to 5146A4

note by a typo this was called 5148A2, but it is really 5146A2

MGFLTALLLVFVLLCVALVRAVRRRRARPPYPPGPPADPLIGHIRIMPSTDNAHE

VFHDWAQQYGDVMSLDVLGTRYVILNSAEAATDLLEKRNSKYADRPTFPMYER

VGWKDTLVFLPYGPYFRKQRKMLQLPLEKERVTDFRHIEEQETCVMLYNILSDP

DNTDAFVHRRYTTAVTMELAYGHRVVSNDDEYLKAADMVIDVLRSVTRPSLLD

VSPIFEYLPAWFPGAWFVKCIKEIKPVVLREIQHPVSVVQQELMAGTAKPSFVSQ

QLEDLSRENGLSQEDLYTVSMVAHQIFGGSETGWHTIMTFIACMLTNPDVQRKG

QEELDSVVGRGRLPDFTDRDSLPYIDCIVKETMRWQPVVPLSVPHKAMEDDEYR

GMHIPKGATIIPNARGITWDERHFHEPRTYKPERFLPRPQGAGEVFPQGAVFGWG

RRLCPGRYLADDVVWLAIARILAVFDIQKAVDADGNVVEPHIEFTTVLTSHPKPF

PCSLRPRSEKAAELVRQAYDMHMANVAV

 

>CYP5146A3 pc.59.24.1(ug.59.33.1) gww2.1.413.1 [Phchr1:38101]

Phchr1/scaffold_1:2097942-2100000

MGFLTALLLALVLLCAIWVRAVRRRRGRLPYPPGPPADPLIGHIRIMPSTDVAHE

VFHGWAQQYGDVMSFSVLGTRYVILNSAEAATDLLEKRNSKYADRPTFPMYER

VGWKDALVFLPYGSYFRKQRKMVQLPFEKEKVTDFRHIEEQESCVMLYNIFSDP

DNRDAFVHRRYTTGVTMELTYGHRVVSDEDEYLKAADMIIDVLRSVTRPSLLDV

SPLFEKLPAWFPGAWFVKCIKKTKPVVLREIQRPVSVVQQKLMAGTAKSSFVSQ

HLEELSREKGLSEEDLYTVSMAAHQVFGGTETAWHTIMTFIACMLTNPDVQRKG

QEELDRVVGSGRLPDFTDRDSLPYVDCIVKETMRWQPVVPLSVPHRAMEDDEY

RGMYIPKGATIIPNARGITWDERHFHEPRTFKPERFLPMPQGAGEVFPQSAVYGW

GRRICPGRYFADDMVWLAVARILAVFDIRKAVDADGNVVEPRIEFATVLSHPKPF

PCSLQPRSEKAAELIRQAYEMHMANVEA

 

>CYP5146A4 genewise.59.20.1 e_gww2.1.326.1 [Phchr1:133267]

Phchr1/scaffold_1:2102681-2104782

MGPTAFVAILLCAVLLVQAVRRRRTPLPYPPGPPADPLIGHLRIMPDTSTAPEVW

HSWSRKYGDVMSLSILGKRVVILNSEEAVTELFEKRGAKYADRPSYPLYERVGW

KDALILLPYGTYYRKLRKMLQLPFEKDKAPNYRHIQEQEACVLLHNFLRDPSSVE

SPIHRRYTAAIIIEIAFGHRVLSDDDEHLKAADMFVEVQHGAGRPSLLDVSPIFEKL

PSWFPGAWHVRYIKEKRPMILHAIQHPVSVIRQQLVDGTANPSFVSQQLNDLIRE

GGLTPENQYDLSIVAHMIFGGGSETTWNTLTTFIACMLMNPEVQRKGQEELDRV

VGRGRLPDFTDRDSLPYIECVMKETMRWHPVAPLAMPRRAIEDDEYHGMYIPKG

AMVIANISLTWDERRFHDARSFKPERFLPKPEGAGEVLPPSFAFGWGRRICPGRY

LADDVVWIAVARILATLDIRKPKAADGSIIEPRIEFEAALTSHPKPFPCEIRPRSDK

AAELIKQAYDMHMASVET

 

>CYP5146B1 pc.59.19.1 , e_gww2.1.427.1 [Phchr1:132579]

Phchr1/scaffold_1:2085390-2087317

MLVLLGFVSLVLFLVYRRSVRASRGRLPPGPPADPIIGHMRVFPRANHGEVFHQ

WSKQYGDVLHLDVLGKSIIVLNSQEAANDLLDKRSANYSDRPEFPAFNLLGWDS

MLVFLRYGPAFLRQRRLMQQPLTRTGVVVFRPVQLQQCHVLLKNLLASPKDFD

AHLRRRFASAITLEMTYGHKVSSDDDAYLDIADKVNVVLTKMSKAAILDLFPRA

KHLPSWFPGAWFIRYANDHRHLIWEMASKPFEQVEQQLAAGTAQPSFVSMHLEE

MHRQNTHDADNVSALKTAAAHMWTGGEETSTLLIFVLAAVRNRDAVRRAQAE

LDRVLGPGRLPTFEDMDALPYVEAFIKETIRFHSALPLGIPHRAMADDVYRDMLI

PKDATVLVNSTALARDPAAYSTPERFWPERFLPPHSEPPPVGLGFGWGRRVCPGR

HLAEASLWIVVASMLAAFDIAPVQDAHGRDAPPELRFTQAITFSEDSHPEPFECSI

TPRSEKVAQLIMQL

 

>CYP5146C1 pc.175.6.1 (genewise2nd.175.5.1)

scaffold_6:685560-687500 region

MMPYILGVTLLLLTVIVLRVLRARASRAAPYPPGPPAYPVIGSVGPFPAHEPHLGL

AELAKKYGDVMYFEIFGKPLVVLSSLEAASDLLEKRSAIYSSRPRFAVHEMIGWT

DMVSFLPYGEQFNKQRKFFLHTFSKQGCLVFRSSQVAQTHLLLKNILQCPTRYIE

YLRRFSTAVIMEIAYGHKVSSEDDPYVKIAEDTNNVLMAAGHSLALVDFLPWLR

HLPAWFPGNWFARVAQESRPVIQRMRNFPFDQVVQQMASGTASPSFVSMQIEEL

ERDGGASPENLHILKIAASQMYGAGAETTWSTIMNVIAFLLLHPTAQRKAQDEL

DSVLRGERMPDFDDRKSLPYLDALLLEVMRLQPTAPLGVPHSSTTDDIYRGMFIP

KDSIVLTNTTYALAMDDRVYRNPTEFRPERFLPPHAEPNPNGIVFGWGRRICPGR

YLADTSVWIVMASFLTVFEIVPERDRNGQDIIPEIQWCSAPFPCVIRPRSEKEVKLV

SRL

 

>CYP5147A1 ug.50.27.1
MPLLLVDIAALVAGLVLLFMLDSWRRKGQHLPPGPPGLPFLGNILQIPRKKEFIVF
RDLGNIYGDIVTLRVPGQIFVILNSRKAVADLLDARSQIYSDRPRTIMCKDLIGWD
GSVVLSNNTPRFRDCRKLLRKGLGPSAVQSFIPFLNRQSAFYLENLQKRPEAFVDI
FKRNAAAISMKIAYGYDGIQDDEELYGIGAMANHYFAETAVVGVWPVDMLPIL
RHVPQWFPFAYFKKYAAQAKPIVLESVNRPFEETKRHMKRGTAGGSFTSMLLED
AKGDPETEDCIKWSGTGIFLGQMDTTTSALSWFFLSMVLHPEVQAKAQAEIDKV
VGNERLPRFEDKESLPYVSAVMQEVFRWHPVVPMIPHALSKDDEYRGYFIPAKT
SLIGNIWAIMHDESLYPDAEDFRPERFTEDGAPDCLNVAFGFGRRVCPGILIAQAH
VFVSIATTLATFNITKARDAQGNIIEPVVEDTPGAINFPQPFKVSLEPRSAAAADLI
RRSAEHSKTLPERLEIFSLDA

 

>CYP5147A2 ug.50.57.1 this seq matches an unannotated region scaf 50 178-179kb
ug.50-57 is from the first 5 kb of this scaffold, about 170 kb away from this seq.
this matches my scaffold_15f.  The ug # is wrong.
  

MLDVGATAAAGLLLVFLLGLGLMKTQHLPPGPRGLPLLGNVLQIPRRLPHVAFR

DMGHKYGGDIVTLRVPGYNLLVLNSRQAIYDLLDSRSAVYSDRPQGTIYRKLLR

KGLGASAVQSFIPFLNRQSALYLENLQSRPEAFVEITK

RNAAAISMKIAYGYDGIADDEELYRLAHQTTIYFAETAVLGAWPVDMFPILRFIP

SWFPLAYFRRYAARARPVVVECINKPFEETKRHMRLGSAGASFTSMLLGDANGD

PDTEDYIKWSSAAIFLGQMDTTTAVLSWFYLAMALHPEVQAKAQAEIDQVVGN

ERLPHIEDRDSLPYVCAVMREVFRWHPVANLVPHATDKDDHYRDYFVPAQTVA

IANVWAVLHDEDVYHDADKFIPERFSEEGAPDSLEIAFGFGRRACPGKVVGQAH

VFASIATVLATFNITKARDAQGN

VIEPEVMDTPGAVNTPQPFKVNIEPRSEAAVDLIRRSAEHSRTLPERLEIFSLDA

 

>CYP5147A3 pc.16.140.1
MLLFAAVSTVLALLLASVLTKARRKARNLPPGPKPLPFIGNAHQIPPENEWIKFKE
WGDEYGDLVKIKIPGSMLYIVNKRKVVDELFEARSAVYCSRPNFIMASLSGWDH
SIPTLPYGQRLRESRKLLKKGTSPAAVKTYHPYINRDLPFFLENMLSTPDKFVEHY
NRNAARIALKIAYGYEGITEDERIIQGGVKAMEVFSATAVPGVWAVDTFPFLRHL
PSWAPFSSFKGFAERCKRITDEALNTPFYEVKQRLEKGTADGSFTSVMLSTEKLD
PETEEIIKWCATGIFTGQFDTTTATLSWFTMAMAKYPDVQEKAQAEIDRVVGRD
RLPEVGDRDSLPYTWAILQETMRWHPTVALVPHTAIQDDTYGGYFVPAGTTVIA
NVWAMMHDENVYHDADKFMPERFYEEGAPDSLSVVFGFGRRICPGLVVAQTH
MFVTIASILATLNISKARDNAGNVIEPREDAKSGVINFPKPFQVSITPRSDAAVQLI
RRSVEHSKTLPDKLELFSP

 

>CYP5147A4 pc.16.141.1

 

IFTAVLAVTVVSLLTRRKNGRHVPPGPKPLPFIGNALQIPPQHEWIKFKEWYGPRL

RESRKMLKKGMGPAAVKTYYPYINREVPFFLENMLRKPDSFVEHLKIAYGYEGV

TEDEKIIRGGVDAMEVFSAVAAPGVWVVKYVPSWFPFAKFKKFAERGKKITDEA

LDTPFYEVKRRVTTATLSWFTLAMAKYPEVQKKAQAEIDRVIGKDRLPEVGDRD

SLPYVWAIMQETFRWHPTITMSGYVPHTAIQDDEYRGYFIPSGTTLMANIWRERR

SWPISGACPLRLMFEVIYHVHRGILHDEKLYHDADKFIPERFCDEGAPDSLSVAFG

FGRRRRVCPGLVIAQTHVFVTMASMLATFNITKARDSTGAVIEPREDAKSGVIPK

PFVVSITPRSDEAVTLIRRSV

 

>CYP5147B1 pc.50.95.1 

MLLQVLAAIAALFVLSGLLNSRRRNMHVPPGPKALPLLGNVLDIPKKDVHVTFR

DWANIYGKDLMKVEMPGETLYVISNKKVMVDLFEARSAIYSSKPTMTMADSSG

FKNSIPLLPYNARLKTSRRLLKQGLSPAAVRSYFPYINNRTALFLEALLKDPDDFV

RHFTRTAAHTALKIAYGYEGVTEDHHLLHTAIETMEIFATVVNPGRWLVDTLPIL

DRIPVSFPFANFKRVQEESRPVVFETVSKPFEEVKKHLAEGTADGSFSSYLLQSEK

PDPETEDCIRWAATSIFLGQFDTTTATLSWFTHAMVKFPEVQKKAQEEIDRVIGN

DRLPEIQDRDSLPYVNAIMKEIFRWQPIISMLPRSVVQDDEYNGYFVPAGTYLLA

NIWAVLHDPEVYPEPEKFMPERHLKEGVPNPLDVTFGFGRRVCPGMQVAQSQTF

GTMAAMLATLHLKPQKDEHGRDIIPETRTVDGLIRFPVPFKCAFVPRSEAALKLIE

RGAEHARSVPDRLERWSD

 

>CYP5147C1 pc.50.96.1 
  

MVQASDTLLSVVVCAALITLTSFLLSGYRKRNAHLPPGPKPLPIIGNLHQLPDLKA

DRAVAFRDMSLAYGSDILCVKVPGMLMYILNSKESMFDILVTRSAKSSSKPPQV

MADEXLSGWKYTVPSLPYGQRIKTSRRLLHKGLGPSAVQSYIPYLERESAFFLEK

LLDQQDAYKKHVTHTAARIALKIAYGYEGVTDDAHLIDTAVKAMNIFCVTATPG

IWLVDSLPFLQHMPSWFPGTGFKKQASQWSQTVLYAINHPFEELKRQMAAGTA

GASFAGRLLEVEDLSDPEVEDCIKHCSTGIFAGQFDTTTAVMSWFAVVMAFYPEI

QKKAQDEINKVVGHERMPVVADRDSLPYVNAILKELLRWRPVLPLIAHSVNEED

EYKGYYVPKDTVILANVWAVLHDESNYDEPEKYKPERFLRDGILDPSVLDPATL

AFGFGRRICPGMHIGQTLLFILMSRTLQNFDIAPAKDAHGREIAIDTSAVPGLIGFP

KPFKVSLVPRSNAHATHIRHAAEHARSLPDKLAIFEL

 

>CYP5148A1 pc.79.37.1
RWAKTFGPLYSMWIGNQLFVVISDPQIVKDLVITNGAIFSSRKDMYVKSQIIFRGR
GITTTPYGDTWRKHRRLASQFLGNRVVSGYLSGLEYEVQDMLCGLLTDGQAGF
VPVSPQAYLGRLALNNIMTIVFGTRTGSIDDPFIHHWLTLSREFMNCTGPVSNWV
DFVPFXCMAKFLLDVKDKERLDDLDIILLCCGFLVGGVESTAAIKQWFAAHISVL
PEVQAQAQMELDRVVGRDRLPQAEDAKDLPYVRAIVKEIERVHNPFWLGTPHM
STEDFSYRGYKIPKDTAVILNTYTMHHDSQRYPNPEKFDPDRYIDDERSSAESAK
LADPYQRDHWTFGAGRRICPAIALAEHEIFLSVAGLLWAFDMRQLSDAPIDLKEY
DGLSGRSPVPFCIRLVPRHERVAAVVGASCHTATCRNG

 

>CYP5148A2 ug.50.57.1|whiterot1 not same as Yadav’s = pc.50.1.1 + pc.50.2.1 (This is the correct ug number)

this whole seq not in Yadavs collection

Note: a typo named another seq 5148A2, but that seq was really 5146A2.

This is the correct 5148A2 seq

TFVLLVAGILYIVLPFFFRKNLVDKNGNSIPPGPLLRLPYLPDYPERTLHAWAQKFGP

LYSFFIGNQLYVVVSDANVARE

LLVNNGAIFSSRKQYFTKNQTILRGRAITASPYGETWRQHRKIAAQLLTPKAIQSYNN

VLDYEARIMIRSMYKESMQGAV

PINPAHYTGRYTLNNMLTISFAMRTESTQDPLIQRILAMAMEFNDLTGPFSNLVDFIE

PLQWLPTKTHARAAKLHDDFIE

VYGSMVMAVKERMDAGENVPHCLAKVLIEGQQQEKLDWEDVCMLSAAFALGGVHSVSG

LRWFLALIGKHPDIQARAHHEL

DAVVGRDRWPMAEDEKDLPFIRAIIKEVLRVHAPFWNATPHSSTEDFVYNGMYIPKGA

AVILNCFTLHHNEARYPDPYVF

PHCASYCLCANAMERDHWSFGAGRRICPGINVAERILFLAISRLLWAFTVH

 

>CYP5149A1  gx.62.25.1 MORE COMPLETE VERSION OF pc.62.64.1
SEAYLPPGPPALPFVGNLFQLPRKSVPRTFATMSQQYGPLYY
MRVINRHFVIVNDLDLARILFDKRGAIYSHRPRLPMAQEVVKRDTMLFMNYGPE
FRKSRKLVSTFLNQRNASKYWPAQEIESLKFVLAVQRNPSDWLKLTRWTATSLV
IRLLYGIEVQDKDDALVGLAEDFARLTTETTEPGRWLVDAFPILRHVPAWLPGAG
FKRWAKRAKARMDEFATLPYVMAKDKIEKGDITPCWTAEKLLETTEPLTEQDE
KEIRHTATSMYSGTNAMVATFILLMLHYPEVQKKAQEEIDSVTGGTWVPGMRD
RERFPYINCLVKELFRFSPAVPLVPHSLHEDDVVEGYLIPKGSWVMANMWAFMH
DEARYPDPETFTPERFEARPGVEPQDDPLDIVFGFGRRACPGYLLGVASVYLNIV
HLLFAFDIAPVKDAAGASVLPPIEFSDGHVA
HAKPFECDMRERSAERIALIEHTA

 

>CYP5150A1 pc.24.95.1 red is new POSSIBLE GC BOUNDARY AT ETMRL

scaffold_1 (3273479 bp) : 2653416:2656338 (2923 bp)

MAFSLPLISATVLLWVLWKVFRNYVVSSPLDNIPGPPRSSFWS (1)

GDSAIMYQRHGWSFHDNISEKYGPVSTTHTLLG (0)

ARGLYVYDQPKALNSIMITDQDSYEEPAWLLQ (2)

SSHAIFGPAVFIAQ (1)

GEQHRRQRRVLNPVFSGAHMRHMAPVFYDVAHR (0)

LRx (frameshift)

AVSAQIHDPASSEIDVLEWTSRAALELIGQGGLGCSLDPL

VADSNNDFGTALKTLI (2)

PLISGLHFYRMLMPYITPFVPLSVRRLFMRWVPHKNAQ

QLRAATEDLWALSRQIYEEKLAAVAKGDNDEVFEGQDLISIL (1)

IRSNTAAAAEDRLPEEEIIAQVA (2)

GLILAATDTTSSALARILHILAERQDIQDKVRAELVEAAGEGEDI

PYDQLVNLPWLDAICRETMRL (2)

HPPANIVNRE (2)

ARTDVIMPLSEPVQGRDGTLIHEIAVPKGTLVTISVRGCN

RNKAIWGEDALEWKPERWLKSLPETVSGAHIPGVYAH (2)

MTFIGGARACL (2)

GFRFAQLEM (1)

KVVLAVMLRSFRFQLSDKEVYWNFAGVVFPSIGRDGKTASMPMKIETL*

 

>CYP5150A2 fgenesh1_pg.C_scaffold_2000178 [Phchr1:1200]

= gx.121.14.1  LOCATED ON VER 2 SCAFF 2, 527-529KB
58% TO GW.95.20.1, 53% TO PC.24.95.1, 51% TO PC.10.108.1
55% to 153.5, 49% to 66.11

MTSAPLLAFGAALIAIIWTLFQGYLVKSPLDNIPGPERSSFWLGNHGDIFNRHAWNFH

DRARQLFGPVFR

FWGPFASRGLFVYDPKALNSIIVKDQLIYEESRWFISWNKYAFGLGLLSTLGEHHRKQ

RKLLNPVFSINH

MRHMAPIFYQTTHRLRTAITAELEASSADVDVLNWMGRLALELIGQGGLGYSFDTLVA

HTHNEFGDAIKG

YVPAILNVIILRNIIYPYMDEYIPAKVRRFILDILPFRSVRRIQKIIDDMHSHSRRIF

NEKKAALEKGDG

AVLHQVGEGKDIMSILLKANMEASDEDRLPEDELIGQMT (2)

TLVFAATDTTSNALSRILELLAKNQ

DVQDKMRTELIAASPDGEDIPYDTLVALPYMDAVCRETLRLHPPVNMMSRETREDVMM

PLSEPIQGVNGE

TISEIFVPKDTSVIVSIRACNRNKAIWGEDADEWKPERWLSPLPEAVGNAHVPGVYSH

LMTFLGGGRACM (2)

GFKFSQLEM (1)

KVVLAVMLRTFKFFPGKNEIYWNMGGVNYPTAGKDSNKACMYLRLERIAS*

 

>CYP5150A3 pc.153.5.1 LOCATED ON VER 2 SCAFF 2
scaffold_2 (3043971 bp) : 1623404:1625693  (-) strand
(whole gene range)
57% to 95.20, 56% to 121.14, 51% to 10.108, 51% to 24.95,
47% to 66.11 

MVPPSTFVLCALGGWVFWKLFRGYFTRSPLDNIPGPRRASLLK (1)

GNAHQLFNRHAWGFHERISQEYGQVVKFHAPFG (0)
GRGLYVFDPKALYHMIVKDIATFDEPRWFLQ (2)
MADFTFGPGLFSTS (1)
GQQHRKHRRVLNPVFSINHMRNLAPLFYTVAHRLRDGLSTQLTTSTGGE
VEILGWMGRAALELVGQGGFCHSFDQLDKNVPNAYRDVLKEVM (2)
PSQIALHFWRILLPYAVEYVPARIRRFLAPW
LPHPVMQKYRNICITMDEQARAI
YHAKKVALEQGDKLVEHQACEGRDILSVL (1)
VTANKQESVEDRLSEEEVIALIS (2)
TLAFFAATDTTSNAMARILHLLAEHQHVQDKMRLELFEAGM
DGEDIPYDRLVELPYLDAVCRETLRL (2)
YPPVLFMNRE (2)
TRQDAVLPLSKPIQGLDGDVLTEIMVPKGTLLMVSIVACNRNKALWGEDVLEWKPERW
LSPLPESIREAHVPGVYSHL (2)
LTFLGGGRACM (2)
GSKFAQLEM (1)
KVLLCTLLRSYRFMPGTKGVYWNVGAISYPTPNEIDEKAAMYLTMDHIQAPQ*

 

>CYP5150A4 genewise.95.20.1 57% TO pc.153.5.1, 55% TO 
pc.10.108.1, 54% TO pc.24.95.1, 51% TO gx.66.11.1, 58% TO 
gx.121.14.1, 

fgenesh1_pg.C_scaffold_2000729 [Phchr1:1751] = gw.95.20.1

scaffold_2(3043971 bp):2185130:2187482 (2353 bp)

whole gene range

MATTTHGLALYALCGLCVWALWRVLRAYVVKSPLDNVPGPERTSFLK (1)

GNTHQIFSRHGLDYLQELGERYGQVVRYYAPLG (0)

ARGLYVFDPKALNHIVVKDQAIYEEPRWFIR (2)

LNRLLFGPGLLSTL (1)

GDHHRKQRKLLNPVFSINHMRHMTPIFYNVVHD (0)

LRDAVAEQVKDTPT

EVNVLDWMLRTALELVGQGGLGYSFDALSAQKRNVYGEALKELL (2)

PTVFALHFWRVLLPYVGAVVPAWVCRAAAPFLPHAAMQKLRRVV

GAMDAHSRRIYEMKKGLLEKGDAAVVHQVSEGRDILSIL (1)

MKANREVDEEDRLPEDEIIAQMS (2)

TLVFAATDTTSNALARIFQLLAEHPDVQDRLRAELT

DAAPDGADIPYDALVVLPYLDAVCRETLRL (2)

HPPASFMNRE (2)

ARADAVLPLAEPLRGADGAPITEIAVPRGTPLIIAIRASNRN

SALWGADALAWRPERWLAPLPDALAKAHVPGIYANL (2)

MTFLGGGRACM (2)

GFKFSQLEM (1)

KVVLAVMLRSFRFLPGDKEIYWNLAPVAYPTVG

KTSTKSELYLKLEPLKT*

 

>CYP5150A5 AADS01000067.1 = pc.10.108.1 54% TO pc.24.95.1

scaffold_8 (1906386 bp) : 331157:333480 (2324 bp)

whole gene range

MGPLQLVLVATAA

5407 WALWRLFRHYILRSPLDNIPGPASSSFIY (1) 5499

5550 GNLKEMFNRHGWGFHDTIIRQYGPIATVHSMLG (0) 5648

5713 ARALYVYDPKALNHIILKDQYTYDEPGWFLE (2) 5787

WHRMIFGPTLIATT (1)

5936 GAHHRKQRKLLNAIFSIARMRDTAPIFYNVAHR (0)

LRDAISADLN

6116 QGSGEINMIEWFSRAALELAGRGGVAYSFDALEANSENSEF

GMTVKQYR (2)

6345 PTTIALHFWRILSPYASLYIPRVVRLALGRLVPHKDLQ 6443

RIQMIAHAISAQSKKIYDFRMAAFQRGDEDAVREISEGRDVLSYI (1)

IRAGLNSEEERLPEEEILAHMS

6752 SGLILGATDTTSNALARTFQLLAEHQDVQDKMRAELA

DAAPDGEDIPYDQLVHLPLLDAVCRETLRL (2)

NPPIGLLARE (2)

7091 ARDDIVLPFLQPVHGRDGSLINEVPVPKGSTVFISVRACN

RNPLIWGEDAAEWKPERWLQPTPKSLSEARVPGVYANQ (2) 7312

7377 MTFLGGDRACL (2)

GFKFSQLEM (1)

KVVLAVLL 7556

7557 RSFRFLPCNKDVYWNLAGITYPTLGKDSDKLELPIKLEIIGGQY* 7676

 

>CYP5150B1 fgenesh1_pg.C_scaffold_2000954 [Phchr1:1976] =

gx.66.11.1

LOCATED ON VER 2 SCAFF 2, 2927193

51% TO 95.20, 45% TO 24.95, 44% TO PC.10.108

49% to 121.14, 47% to 153.5

MSLFALAIPWVACGLVLMLVYRLVRDYVVSSSLEDVQGPTPRSLIY (1)

GNLPELQNRGAWPFLDHLTNDYDRVVRMRGMFG (0)

KRILWVADPKALHHIVVKDQDIYEEAPSAITF (2)

GRKLGMGPGLLSTL (1)

GDHHRRQRKLLNPVFSIAHLRRVTPVFYEVMNR (0)

LSKGIEKQLDTTSNNEVDLLAWMGRAALELIGQGGFG

HSFDPLVEQTPNPYADAVKSLV (2)

PAITGLIFYRMVIHLVDPLVEACAAHPALGAFIKRWFW

LVPNARMQHVKTIFDVLHDTSTAIYTEKKIALDSDDPELKMRVLEGRDLM (1)

SVMLRENMNADAADRLPEREIIAQIT (2)

TFIFAGTDTTSNALARILHLLCLHPDVQEKLRAEIIEARAQNGGGDLDYDALVALPYL

EAVCRETLRL (2)

YAPVPFVSRQ (2)

ARSDALLPLSAPLTLRDGSRVSALHVPQGTSVLVAIHSVNRSAALWGADAHVWRPERW

LEKLPDAVAEARVPGVYSNL (2)
MTFIGGGRACM (2)
GFKFSQLEM (1)

EVVLATLLSSFRFSLCDGKNADIVWNRAGIAYPTVGNDGGHPSLPLRVERLKC*

 

>CYP5150C1 EB077269.1 Trametes versicolor cDNA clone

52% TO CYP5150A2, 50% TO CYP5150B1

SHVMAQVLQLLSEHPDAQAKVRREILEAGDGYIPYEKLHSLPYLDAICKETLRMYPPTPI

VLREAFRDTTLPLSQPMRGSDGSMLSHIPIPKGTNVLVGVRACNRNKALWGEDAEEWKPE

RWLAPLPKAVEDASIPGVYSNLMTFVGGGRSCVGFTFSQLEMKVVLSSLLANFTFQLSEK

PIFWHISAITFPSAAKDSLKPEMWLKVGRYTGEAA*

 

 

>CYP5151A1 pc.8.82.1 (name is not right pc.8.80.1 is correct (-) strand)

C-term is 37% to CYP5033A1 Ustilago maydis 30% overall

name error, CYP5144E1name assigned twice see pc.8.2.1

Phanerochaete chrysosporium cDNA clone DV765344

MESFTLAALSLTTACAAALVAYLLYLCV

VYPLRNPIRQLPGPPSKWFLELRHMYMTMD (2)

PRRSPHTAAEFVEKYGRNVYIRGPVPWDQRLFTLDPVTMNHVLQHT

AIYEKPWPSRRLISGLIGAGMLSAEGQMHKRQRR

VATPAFSLNEMRALIPLVFSKGT

ELQKKWMEIMRDAGVKPGQ

GHVVNVCSWA

SRATFDVMGSAGFDYEFNAIQNEDNELLRAYVDMF

ETAVSKQKAGLRSVLVMYLPIIDKIF (0)

159857 PNETTRFVSKCQTVIERVAGTLIQEKKRKMADAAVKGQVY 159738

159737 QGKDLLSLMRKY (1) 159702

159661 VKSNSAVDLPPDQRLS159572

DQDLLNNINTFMFAGTDTTSLALTWTLYVLALYPHVQDRLRAELLS

VAPIAPIDTLTPEE

VQSLYAEIAALPFLENVIRETLRLIPPVHSSIREATRDDVV

PVSAPLKRTTPNGRVVEEQVHQIVVPKGTFIHVPIEGFNLDKGL

WGETAWKFD (2)

PDRWDNLPETIKELPGLYQHTLTFSAGPR (0)

ACIGMRMSVIELKSFLFTLVTNFKFAPDPTQKIGKANV (2)

ILTRPYVAGKQNEGSALPLIVTPYVREDAS*

 

COMPARE TO

>CYP5151A2 AACS01000049.1 Coprinopsis cinerea strain okayama7#130

3476 SCIGMRFSMIEIKTFLYILVTRFVFKPTKDKIIKSNV 3586

3642 VLTRPYISGKYREGSQLPLIVTPYI 3716

 

 

WHOLE PREDICTED SEQ 55% TO PHANEROCHAETE

MNPILLSGLAAASTVLTWVVYRVVIEPRFNPLLKLAGPPSPGLF

GTNLAPVLSPTVSPRLHEVYAENYGRSMRIRGVGPWDERLLTLDPVSVAYVLKNSTIY

EKPWQSRALITSLIGCGMLAAEGQVHKRQRRVGTPAFSIQNLRGIVPLVFKKGTELKD

KWMEMIETTGEVRGSDEKEKSMVVDVCHWVSRATFDVIGVAGFDYQFNAIQNESNELF

NAYKEMFEIAISQGDGIITLISIYAPWIHKIFPNQVSRTVERCQEVIRRVAGQIIQEK

KRKIAEGEASGKPYQGRDLLSLLLKSNVAVDLPEDQRISDEDILNNVNTFMFAGSDTS

SLTLTWTLWLLANNPEIQDRLRAELLAAIPDTELTADISSLNEDEIQTLYGIIAELPL

LNNVTRESIRLIPPVHSSIRVATQDDEIPTRYPVKLADGTIDTKQSVKIAKGSFVHVA

VEGFNLDKEFWGADAWDFNPDRWDDQPETARQLPGLYNNTLTFSAGPR(0)

SCIGMRFSMIEIKTFLYILVTRFVFKPTKDKIIKSNVVLTRPYISGKYRE

GSQLPLIVTPYIPSAEH

 

 

EB072414.1| TverSEQ10129 Trametes versicolor pBluescript (EcoRI-XhoI) Trametes

versicolor cDNA clone TverSEQ10129, mRNA sequence.

Length=897

 

PNELNAAFQEVFNPGANFTIFTILKNVFPALDIFPDERAKRLDHAQDVMRRIGLQLIEEK

KAQIAREMSEGKSGGVERKDVQGRDLLTLLMKANMATDIPDNQRLSDEDVLAQVPTFLVA

GHETTSTATMWCLYALTQAPDVQKKLRDELFTLQTEAPTMDELSSLPYLDAVVRETLRIH

APVPTTMRVATKDDVIPVSEPFVDRRGKVQDSIHISKGSPIIIPVLSLNRSTELWGADAL

EFRPERWINPPETISSIPGVWGHILSFLAGPRACIGYRFSLVEMKALLFELVRAFEFE

 

Score = 169 bits (428), Expect = 9e-42

Identities = 89/197 (45%), Positives = 129/197 (65%), Gaps = 9/197 (4%)

Frame = +3

 

Query 1 DQDLLNNINTFMFAGTDTTSLALTWTLYVLALYPHVQDRLRAELLSVQS---LYAEIAAL 57

D+D+L + TF+ AG +TTS A W LY L P VQ +LR EL ++Q+ E+++L

Sbjct 321 DEDVLAQVPTFLVAGHETTSTATMWCLYALTQAPDVQKKLRDELFTLQTEAPTMDELSSL 500

 

Query 58 PFLENVIRETLRLIPPVHSSIREATRDDVVPVSAPLKRTTPNGRVVEEQVHQIVVPKGTF 117

P+L+ V+RETLR+ PV +++R AT+DDV+PVS P G+V ++ +H + KG+

Sbjct 501 PYLDAVVRETLRIHAPVPTTMRVATKDDVIPVSEPF--VDRRGKV-QDSIH---ISKGSP 662

 

Query 118 IHVPIEGFNLDKGLWGETAWKFDPDRWDNLPETIKELPGLYQHTLTFSAGPRACIGMRMS 177

I +P+ N LWG A +F P+RW N PETI +PG++ H L+F AGPRACIG R S

Sbjct 663 IIIPVLSLNRSTELWGADALEFRPERWINPPETISSIPGVWGHILSFLAGPRACIGYRFS 842

 

Query 178 VIELKSFLFTLVTNFKF 194

++E+K+ LF LV F+F

Sbjct 843 LVEMKALLFELVRAFEF 893

 

>pc.8.80.1 [whiterot1:77774]

MFAGTDTTSLALTWTLYVLALYPHVQDRLRAELLSVAPIAPIDTLTPEEVQSLYAEIA

ALPFLENVIRET

LRLIPPVHSSIREATRDDVV

PVSAPLKRTTPNGRVVEEQVHQIVVPKGTFIHVPIEGFNLDKGL

WGETAW

KFDPDRWDNLPETIKELPGLYQHT

LTFSAGPRVRSPSVCRLSQG*

 

>CYP5152A1 pc.24.121.1 65% TO pc.24.126.1, 42% TO CYP530A1
N. crassa NOTE: 5144C1 IS AT 2402616-2402515 REGION SCAF_1
5144A6 IS 2479233-2479132 REGION (-) STRAND SCAF_1
THIS SEQ IS AT 2699101-2698997 (-) STRAND SCAF_1
pc.24.126.1 IS AT 2713991-2713887 REGION (-) STRAND SCAF_1

same as model fgenesh1_pg.C_scaffold_1000845 [Phchr1:845]

N-term is in a seq gap possible frameshift after FSFK

FKFAQLTEMYGPVFSFKQGTRVVCVVGRHQ (0)

AAVEIMQKH GADLADRPRSIAAGELLSGGKRTLLVGAGDRLRKLRK (2)
ALHSHLQPSVAVQYRPMQLKHALNVILDILRDPEHHIDHARR (2)

YAASVVMT

MTYGKTEPTYYTDPEVQEILLHGTRLGSVIPLDYHKVDRFPILKHVPFVTSTLRQWHKEELALFS

DLVDGARARL (0)

RDGAPPSFATYLIDQQQQFGLSDDEIAYLAGSMFGAGSDTSATAIAFVIMAAATHPKAQAEVQAQ

LDSVVGRDR (1)

VPSFDDESLLPLVTAFYLEAYRWRPVSYG (1)

GFAHKATADIRW (0)

GEYVIPADAIVIGNHWSIARDPDVFPEPEEFRPSRWLDESGKLREDLSSF

NFGFGRR (2)
VCVGQHVANN  (2)
SLFINTALILWAFSVGEDPAQPIDTMAFTDTANVRVHPFKAVYEPRIPRLREVVETYLD*
 
>CYP5152A2 pc.24.126.1 35% to CYP5065A2
yellow IS AT 2713991-2713887 REGION (-) STRAND SCAF_1
possible GC boundary at PISWG

Same as model fgenesh1_pg.C_scaffold_1000848 [Phchr1:848]

MATGLLADVLARVQVPALALLFALLLLRAALRIVQRQRVPLPPGPPG

RWFEPGPKAPLRYAELAKTYGPVFAFRRGGQLVCIINSYK (0)

DAVEIMQKRGADLADRPDFIAAGDFLSGGMRTLLVGAGERVRRLRRC
RALHSQLQPTAAVQHKPVQFRAALDLVLDVLHDPADHLNHTKR (2)
FAASLILTMTYGKTTPTRYSDAEVREINVHTTRLGTVVPAGLHAVDRHPVLR
HVPPATATLRRWHREELALFTRMVDGVRKDV (0)
HVARPSFTTYLLEHQEEYGLSDDELAYLAGSMFGAGSDS (0)
TATAISFVMMAAATHPQAQAQVQAQLDSVVGRDR (1)
VPTFDDEKLLPLVVAFYLETFRWRPISWG (1)  
GFAHRATSDIVWNDYVIPAGATVFGNHWAIGHDETVFSDPDVFRPSRW
LDEAGKLRDDISPFTYGFGRR (2)
VCVGQHVANN  (2)
SLFINTALLLWAFNIREDPKVSIDTMGFTDSGTVRVLPFHV

QFHPRIEHLREIVESSMPEDVYSAA*

 

>CYP5153A1 gx.27.66.1 = pc.27.122  
         fgenesh1_pg.C_scaffold_1000958
         Phchr1/scaffold_1:3068242-3069378
32% TO CYP5116B1  Aspergillus nidulans
The unbroken reading frame starting with FNMYQ is preceded 
by a conserved non-p450 seq upstream that probably ends 
460 bp before FNMYQ.  The true P450 N-terminal must reside 
in between or this is a pseudogene missing the true N-
terminal.  The two short exons shown below are my best 
guess for the N-terminal, but they do not resemble other 
P450s, and the total length is only 443 aa, a little 
short, so the pseudogene alternative may be correct.
MVHDSGGAIFDTAGPALVR (1)
RTITVYPSDSLVQRGIQTNLELILKHIYTCEVSPIHPHLAPLHQ (0)
FNMYQTIVWYFTAVLFLLGAVVARARKRPVTSSLERIQLTDLRDIRELLAPISTSLPIL
LEQRSVPNARLVRAFGITNTFVSSSVDVHATFSREARALIAGNDWDRFAQCAQLAVDK
CIEERTDAGTVMRYDTLMQNAALLSILMGLFEVALDDVPIADLGVVARGINDLWKLSK
TADTLPPHMLPEINTRLRAWLPAHQNPVDLIIPAFETMWRVVATTVAYTHADPLAHAV
LETFLADPTSTAFASARSGTPSVDALVTEAIRLHPPTSRISRHVVSNSTKGAVLVADV
GALHRDPTIWGADAEVFNPLRHQQRTPTQEKALLGFGAGRVMCVASRWAPHAAGIIVA

SISERIGREIQVREGKAKGGRDWDGWFVECI*

 

 

>AACS01000290.1 Coprinopsis cinerea strain okayama7#130, whole genome shotgun

 

Score = 57.8 bits (138), Expect = 5e-06

Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Frame = +1

 

Query 103 TDLRDIRELLAPISTSLPILLEQRSVPNARLVRAFGITNTFVSSSVDVHATFSREARALI 162

          + L IR+L +P + LL R+ PN RLVRAFGITNTFVS VH +F AR+L+

Sbjct 167305 SSLGGIRQLFSPDGADVGTLLADRARPNQRLVRAFGITNTFVSPHPSVHRSFVTAARSLL 167484

 

Query 163 A---GNDWDRFAQCAQLAV 178

+ W F + A+

Sbjct 167485 SRANKRGWGTFRDISTQAI 167541

 

>CYP5159A1 Coprinopsis cinerea strain okayama7#130,

ACCESSION AACS01000290 REGION: 167200..168432

Yellow region not in pc model. look for it

39% TO CYP5153A1

MLDWQSTSIVIAAFLLASLLCLIAISLNQESAVGHSSLGGIRQL

FSPDGADVGTLLADRARPNQRLVRAFGITNTFVSPHPSVHRSFVTAARSLLSRANKRG

WGTFRDISTQAIHVELSLARSGSVNYGIFIQAVTLRVILVGLLGANVPMEDFSPDDIY

TAASHINKLWSLSKDPSPIPSHLLPELNDALRRLLPDITTFPNPVDIVIPAWETFWRV

VATTVAYSHNSKAITQLFLDFYAYPTDNAFREANADANISPKNVVEESMRLQPPSKHI

ARKTIRPSLSKLPKPIANLLVRFLPRISWVKHYADVQAVLRSPAIWGSNSLEFNPWRH

NQDPSSTLPSRAEALGYIFGGGNLRCIGSSWAPVAAAVVASAVFDAVDRGVCSIVPGR

AVGGRNGWEDWSVTDTKN

 

 
>CYP5154A1 PFF_258a (gx. 18.4.1) 63% TO PFF_258b 
(gx. 18.4.1), C-term 38% to 5141A4
Scaf_6 ver2 (-) strand 503798-505808
505808 MQDLGYLPGLRSLVTPMSPLGFALPPSQYNPGRDWQW 505728
505655 VYRDAGTETISAIPYVFGPP (1) 505596
       LAKQVVSTKGQ (2) 
505458 ILRLLCSLWGPNIFAANGEEWRKHRRIINPAFSNAT (2) 505363
       FASVWEQTSRVFDEMEVGEGWAGKHTVNLPVVNGLTNK (0)
505139 LALILISTCGFGNPLKWQFTNSASGGMSFEKALSIVSSNHI
       ALLLIPDWMYRLPNK (2) 504972 
       IRELKTAVDRMNLFMRELIEKRRAEMAQKAPERTDILSAMIK (2)
504735 LSWLSRFDNDCDKVGNTFLLLSAGH (1) 504661
504611 DTVAHTLDAAFALLALHQDFQEEVYQELLEVMPTEADFV 504494
504443 TYENSARLVKTRACFLEASRMFRI (2) 504372
       SGFMLIRDTAEDVVLQNVGPNNDDVLPLKRGTRVVVDMIGL (1)
504143 HHNPRIFPDPEAFKPERWYNAHENDMSMFSFGARA (1) 504042
503989 CIGRKFAVAEGICFLAKLLRRWRVEPLAKEGETKEQWKQRVV
       RGVVVLNLGIGEVPVRLVRRNC* 503798
 
>CYP5154A2P PFF_258b (gx. 18.4.1) 
This one is looking like a pseudogene, no EXXR motif,
No N-term Met
Scaf_6 ver2 (+) strand 509278-511252
62% to PFF_258a in overlapping regions
509278 YLPGIRSLVSPMSALGASIPTSRWNPGRHWQW 509373
509448 VYRDAGTETIAAVPYLFGPPII 509513
509662 GPNIFAANGGEWKKHRRVINPAFSQET 509742
509963 LALILISTCGFSNPLSWQ 510016
510040 MPFADALWIVSTRIIARLLLPRWVYWLP 510123
510371 DYNMHQLGDTFLLLTAGHGT 510430
510478 MLALHPDFQEECYREILKVMHTNDDFV 510558
510606 TFGNSTHLIKTRSCFLEASSLYRM  510686
510727 AAGEILVQDVAEDTILRGAAPDGGDPPVPRETPIVVDMLGLR 510852

510906 DHNPKLYSDPEKFLPERWYNTHENDRTMFSIGAQA (1) 511010

511067 CLGRHFALVEGTCFLARLLRIWRVVPLLRPG

ETVEQWRAKIGVEALFNFGIGNVPLKFVRR* 511252

 

 

>CYP5155A1 fgenesh1_pg.C_scaffold_7000377 [Phchr1:4564]

Same gene as pc.81.7.1

whole seq is 40% to CYP5150A4

REMOVED POSSIBLE SHORT INTRON SEQ VKAAKNKYLEDGRSTASTWE

 

MAVGLPEVVLAAIFAYLLYRETWGKKTALSDVAGPPRESWMK (1)

GNTQRLFRDALDYNLWLSRTYGTAVKMYSLY (1)

ALYLSDPLALHHVFVKDQNSFDVSDAFIH (2)

NLLMFGEGLTGTL (1)

GEQHKKQRKMLNPVFSVSNLRELLPVIQPIANKMASVFVEQIPAD (1)

AREIDVMPWLSRGAQEYMSQACFGWTFNALDLNKRNTYSEAARKYT (2)

PAALRVSWLRPYLPFIVRTIPLTLRTKMLDWYPGSDMKDFLYILDVM
HQTSKRIFEQKKKALDSTVLEKADAETSERSEGDLGP (0)

GKDIMSILLK

ANASSNEADRMTDSEMIGQMSTLLFAGFETTTYAISRILWVLASHPDAQARIRSE(0)

DVSLSYDDLMALPYLDAVIKETLRVYPPSSVHFRVALQNTTLPLQYPVKSVNDTPITTIPVEKGT

QILVSIIASNHNTNVWGPDASEWKPERWLNSDDKAVPKATTDSAKYPGVYSGMMTFLG

GPRGCIGFKFSE

MEAKQVLATLLPRLHFALPSAVDEQGRRKEVYWMMSGPQIPVVRPPFGDGMTAQVPLD

VRLVREEDFAYGFEDEDLIKL*

 
>CYP5156A1 gx.17.28.1 34% TO CYP602B1   Fusarium graminearum
scaffold_7 (2051558 bp) : 939436:940306 region

SAME AS

fgenesh1_pg.C_scaffold_7000309 [Phchr1:4496]

N-TERM in model SEEMS TOO LONG. Remove it.

29% o 609A1

MYPLGLLTIVQHFETRDAALKLAIALPSIVLLALLFSWVSARKDQD

EGPPFLPLSIWETVWPFFTSRHDFLRRGFELTRHPAFRFKLLQ (0)

HTVVVVSQEHARADFFACRGLDIHEGFKVLSGA (0)

IPMLPGVTSDLQTRRINLIHRRLAAAQGGDHLQR (1)

LVPFIVQDIRQGFCSWGSTESLIDPFTRIPA (0)

LLFQTTVRCLGSHELADDGATVARLLSLYDTLDRSTTPLSVLLPWLP

SPSMLAKLRASKQVYDIVDGAIRARVASGVSRDDTLQILLDHGDEKMVIVG (0)

FIMGLLVAGARSTGTT (1)

ASWIVTFLAGHPEWRRKVREEIHALLSLYAATTAHCANDPAELLATVPLEAFEQCMP

ATDAVIRETLRIAQPHTAMRRNVGPDTYIAGTRIPSGAYVVYPFSDIHLDPRLYPD

PWRFDPSRPESKSNIGYVGWGG (1)

GRTVCLGQRIAKLQIKLVLSMFLLHYDFDLVDQDEHPLGNVPR

PNWNDHLTCKPPSGSCLVRLAKQ*

 

>CYP5156A2 EB008493.1, EB007318.1 Gloeophyllum trabeum ESTs 61% TO CYP5156A1

LADIPLSAWEGSTPVLDAVIRETLRLAQPHTAMRRNVGPDLVIDGKTVPSGAYVVY

PFSDVHLDADIYPDPWRFDPGRPADAKRAHAWVGWGGGKTVCLGQRLAKLEMKIIA

AMFLVGFDYAVVDKAGKPADPLPKPNWNDALMCRPEAGSCYVK

YERAASSTSSSSSSSPSSPSSPL*

 

 

>CYP5156B1 EB016637.1 Lentinula edodes

50% to CYP5156A1 N-TERM ONLY

MPYSVGLQAAGAALLSAGLPVLFTTAIIVLLLIISINSSLQKDVADAPARLPI

YSFFTIIPFFRRRFDFLNWGFQATGQSTFQFDLLRNKVIVVSGESARQAFFTAKGLDLTE

GFKILSGAIPMVRGVTSDLQTKRISLIHKRLAAVQKNEQLSMLIRPMLEDSRRLMESWGN

SGCFDPFDNIYELVFQLTVRSLSCTEISDDPCLVSRLKKLYDTLDVGTTPATVLLPWLPT

PAMVKKLWATKEIYDIVVAAITAR

 

>CYP5157A1 genewise.21.71.1

scaffold_9 (1898532 bp) : 1276291:1276784 (494 bp)

fgenesh1_pg.C_scaffold_9000353 [Phchr1:5749]

Phchr1/scaffold_9:1276084-1278363

30% to 608A1 Magnaporthe grisea over 412 aa

MSLLPPLTNLASGHISFFLGIPRGELFLLFLPFVVLIAFVLFKRIIQATKRKHASTRPL

CVLVSTDRPIDQLPPYHYRPTSKRFATMDLLSALRGREREYTKYVFADDKSLSFEEGAA

TILNLRFLLKIRGGRFYKDVDKLITSGIIPRIEAITNKIYPIFMRHARRLVEDGQKNNG

CVDFFAHTNHSIAESMLTVVMGEVGIYENLSWFSRTFPRLSKFSRLRDGLSDNGCPRLR

LLFGTLIYRYFFVLGPYVWRELRNNKFEPLARSEKEHDANESVLRYLGRMFAREDGTVS

AVDTCWCMCLMLSLIFASVHQTAVVAVWVMYELASRPTYIPAIREELLAVAELQADGSH

YLSYDSLRNARLLDSFIREVMRLKGDTLGVCRQTVQDTPMGQYVIPKGHLVIPMASLSH

RSREYHGQDAEVFDGFRWVERNLPAVMVGPTYFPFGMNRWACPGRVLAVSEMKMIALTI

LALADPTLEGGKYTVVDPLNTTSVQPAGKLYLTPLARPLI*

 

>CYP5158A1 39% to 5037B2, 36% to 5037B3, 36% to 5144A5

scaffold_2 2356566-2358785

2356566 MLTSQVSIAKLTTLPTSYYA

2356626 LLATIALLALLFARRTQQPTPPGPRGLPIIGNVAELSGGFEWIRFGTTLRKQF (1) 2356784

GDVLGFKVLNNRILVLNTAKAAKEFMDKRASKYSSRPVLTVIGELMGLDQ (0)

AMPLIPYGAEWRACRKLEHVALNQSAVKQYRPVIEHHAAQLALDILQEPDKFLTHTRL (2)

IILAVTYGLSARVTATE (0)

YISLAEEVMRIVTIYLRPFAHLCDVMPV (1)

LKHLPSWIPFRREAEYGRRLFESFVSTPYERTKQAF (0)

AKGDAEPSLIRDILASMPQDSLTPEVEHRVKWTAGFALLA (1)

SGGES (0)

2357970 TFGTIGVFMMAMALHPDKQARAQEEVDSAVGTDRLPTMDDKARLPYVYAVVQEA 2358131

2358132 MRWHPMLPL (1) 2358158

2358208 SLPRRAEVDDEYDGYYIAKDTTVCANLW (2) 2358291

2358346 AMGMEPNVKYPPEQFIPERFLDAEHPTPNPNTWAFGFGRR (2) 2358465

ICPGKALAEESLFVLMSTLLAMFEICAPPEGIKPEFESRVVR (2)

2358702 LPKPFKCIFRLRSPEKADMLRAVVATQ* 2358785

 

>CYP5158A2P gx.89.1.1 pseudogene

92% to CYP5158A1

scaffold_2 2396927-2398113

2396927 MLTSQVLIAKLTALPTSCYA

2396987 LLATAALLALLSARRTQQPTPPGPCELPIIGNVAELSGGFEWTRFGTTLRKQF (1) 2397145

GDVLGF

large deletion here, missing 6 exons

SGGES (0)

2397300 TFGTIGVFMMAMALHPDKQARAQEEIDSAVGTDRLPTMDDKARLPYVYAVVQEA 2397461

2397462 MRWHPMLPL 2397488

2397541 LPRRAEVDDEYDGYHIAKDTTVCANLWY 2397624

2397685 MEPNVKYPPEQFIPERFLDAEHPTPNPNTWAFGFGRR 2397795

2397854 ICPGKALAEESLLVLMSTLLAMFEICAPPEGIKPEFESRVVR 2397979

2398033 LPKSFKCIFRLRSPEKADPPRAIAAAQ 2398113