July, 14, 1999

|

The only possible mitochondrial P450 from C.elegans has been reexamined to
better
identify the intron exon boundaries based on similarity to CYP12A sequences of
insects.
One previously missed exon is added based on an EST sequence and another exon is
extended to fill a critical gap.  Only about 40% of the sequence is covered by
ESTs, so five
of the intron boundaries are theoretical.

CELZK177  cosmid ZK177 U21321 CYP44 Probable mitochondrial P450 489 aa
C70591 is an EST from the middle region that adds 49 amino acids not previously
identified as coding region in ZK177. Another exon extended 13 amino acids helps
fill in
the missing I-helix region with DGLSTT matching with AGXDTT of the I-helix.
* indicates predicted intron locations ** indicates verified introns based on
ESTs.

MRRSIRNLAENVEKCPYSPTSSPNTPPRTFSEIPGPREIPVIGNIGYFKYAVKS*
DAKTIENYNQHLEEMYKKYGKIVKENLGFGRKYVVHIFDP*ADVQTVLAADGKTPFIVPL
QETTQKYREMKGMNPGLGNL*NGPEWYRLRSSVQHAMMRPQSVQT*YLPFSQIVSN
DLVCHVADQQKRFGLVDMQKVAGRWSLESAGQILFEKSLGSLGNRSEWADGLIEL
NKKIFQLSAK**MRLGLPIFRLFSTPSWRKMVDLEDQFYSEVDRLMDDALDKLKVNDSDS**
KDMRFASYLINRKELNRRDVKVILLSMFSDGLST*TAPMLIYNLYNLATHPEALKEIQKE
IKEDPASSKLTFLRACIKETFRMFPIGTEVSRVTQKNLILSGYEVPAGTAVDINTNVL
MR**HEVLFSDSPREFKPQRWLEKSKEVHPFAYLPFGFGPRMCAGRRFAEQDLLTSL
AKLCGNYDIRHRGDPITQIYETLLLPRGDCTFEFKKL