March 9, 2001

|

A new Human P450 has been found and it has orthologs in mouse and bovine and
fish. It may be vertebrate specific since it is not found in fly or worm. The
new sequences are all being named CYP20 (a long reserved and unused animal p450
name)

Human CYP20 (phase of introns shown)
AC011737.8|AC011737 Homo sapiens chromosome 2 clone RP11-33N4, WORKING
MLDFAIFAVTFLLALVGAVLYLYP (0)
ASRQAAGIPGITPTEEK (2)
DGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTS (1)
DPFETMLKSLLRYQSGGGSVSENHMRKKLYENGVTDSLKSNFALLLK (0)
LSEELLDKWLSYPETQHVPLSQHMLGFAMKSVTQMVMGSTFEDDQEVIRFQKNHGT (0)
VWSEIGKGFLDGSLDKNMTRKKQYED (1)
ALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQ (0)
ILEDSMIFSLASCIITAK (1)
LCTWAICFLTTSEEVQKKLYEEINQVFGNGPVTPEKIEQLR (2)
YCQHVLCETVRTAKLTPVSAQLQDIEGKIDRFIIPRE (0)
TLVLYALGVVLQDPNTWPSPHK (2) genomic seq stops here the rest is cDNA
FDPDRFDDELVMKTFSSLGFSGTQECPELR (2) intron site based on fish genomic DNA
FAYMVTTVLLSVLVKRLHLLSVEGQVIETKYELVTSSREEAWITVSKRY

AK020848 Mus musculus Cyp20 adult retina cDNA plus ESTs for C-term
MLDFAIFAVTFLLALVGAVLYLYPASRQASGIPGLTPTEEKDGN
LPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTTDVLKQHFNPNKTSDPFET
MLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYPETQ
HIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHG
TVWSEIGKGFLDGSLDKNTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHT
FIDSLTQGKLNEQQILEDCVVFSLASCIITAR
LCTWTIHFLTTTGEVQKK
LCKEIDQVLGEGPITSEKIEQLSYCQQVLFETVRTAKLTPVSARLQDIEGKVGPFVIPKE 360
TLVLYALGVVLQDPSTWPLPHRFDPDRFADEPVMKVFSSLGFSGTWECPELXFAYMVTAV 540
LVSVLLEKLRLLAVDRQVVEMKYELVTSAREEAWITVSKRH*

Bovine CYP20

MLDFAIFAVTFLLALVGAVLYLYPASRQAAGIPGITPTEEKDGNLPDIV
NSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSLLR
YQSDSGNVSENHMRKKLYENGVTNCLRINFALLIKLSEELLDKWLSYPESQHVPLCQHML
GFAMKSVTQMVMGSTFEDEQEVIRFQKNHGTVWSEIGKGFLDGSLDKSTTRKKQYEDALM
QLESILKKIKERKGRNFSQHIFIDSLVQGNLNDQQILEDTMIFSLAS
CMITAKLCTWAVCFLTTYEEIQKKLYEEIDQVLGKGPITSEKIEELRYCRQVLCETVRTA
KLTPVSARLQDIEGKIDKFIIPRETLVLYALGVVLQEXGTWSSPYKFDPERFDDESVMKT
FSLLGFSGTRECPELRFAYMVTAVLLSVLLRRLHLLSVE
GQVIETKYELVTSSKEEAWITVSKRY 498

Fish homologs CYP20

From oryzias latipes (fish)
MLDFAIFAVTFVVILVGAVLYLYPSSRRASGVPGLFPTDEKDGNLQDIVDRGSLHEFLV
GLHEQFGPVASFWFGRQPVVSLGSVDPLRQHINPNHTTDSFETMLKSLLGYQAGAGGGAN
ESVMRKKLYESAINNALKNSFPAVLKVAEELVDKWSSVPEDQHIPLCAHLLGLALKTV

Human to fill gap in fish based sequence
TQMVMGSTFEDDQEVIRFQKNHGT (phase 0)
VWSEIGKGFLDGSLDKNMTRKKQYED (phase 1)

227 this part from Takifugu rubipes pufferfish
ALSEMESTLLSVVKERKSQRNKSVFVDSLIQSTLTERQ 265
IMEDCMVFMLAGCAITAN 283 (1)

Tetraodon nigroviridis freshwater pufferfish
284
VCIWALHFLSSSEDVQDRLHQELEEVLGSGPVSLEKIPQL
RYCQQVLNETVRTAKLTPVAAGLQEVEGKVDQHLIPKE
TLVIYALGVILQDSHTWDAPCR
FHPDRFEEESVRKSFRLLGFSGSQTCPELR
VAYTVATVLLSAVVRQLRLHRLEDTLVEVRSELVSTPREETWITFSRRN