Phycomyces Blakesleeanus

Phycomycesblakesleeanus P450s

D. Nelson

August 9, 2009

52 sequences

>CYP51F1 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

73% to CYP51F1 Rhizopus oryzae

estExt_fgeneshPB_pg.C_10567

MAILSLITQVVPSITSVFLYGTLSLVVVFSIHILSQLVVPRDPNQPKLVFSWVPFLGNGVEFGMNPIGFIQKCQKLYGDV

FTFKLVGKSVTVCLGADGNQFVFNNKQNLSSAAEAYNDMTKHVFGFDVVYDAPHSVFMEQKRFIKAGLTLESFRAHVPLI

VKETTEFFKDFKKPTGYMDAYSTFSKLIICTASRCLMGKEIRSALHEGVADLYYDLDQGFQPINFMFPNLPLPSYRRRDV

AREKMAELYSKIIRRRKEENDTSNNDLLQALIESTYKDGTPIPDHHIAGMMIAVLFGGQHTSATTSAWTTLELANRPDLV

QALREEQIAKLGSLKADLTFENLKELTLMEACIKETLRLHPPIFQMMRKVIADKVVFEKTGHEIPKNDFLCAVPGATQVD

EQYFNEPLTYNPYRWIEKSDPVHQMEVGEDANADYGFGIVGISSRSPFLPFGAGRHRCIGEQFGYLQLKAVMATVIRLYD

LSLEEGKGVPESDYTSMVVVPKHPANVVYTCRE*

>CYP61A1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

81% to CYP61A8 Rhizopusoryzae, 80% to CYP61A1 Rhizopus oryzae

e_gw1.3.127.1

MKTAFSQPNISTTAVICSAVVGLFAYEQYVYLNKKKGLPGPQFKIPIIGAFTDSLYPTFEGYMSKWKSGELSCVSVFDRF

VVIASTCDLSRKILNAPVYAEPAVVDSMKHILCADNWVFLSGKSHVDYRKGLNVLFTRKALGIYIPVQDKVYKKHFAEWL

SLNGEKGQYQLRFRELNMESSLRVFLGDHMSDEVASKISQEYFNITAALELVNFPIPLPGTKVYKAVQSRKYIVNQFVEC

IKDCRTRMANGGETKSMMDAWVRSMLDTEAELAAAGKPAPRKFDNREIALTILTFLFASQDATSSAMTWAFQLTADHPDV

LHKIRSEQMKLREENPDQELTLELMEKSVYLRQVIKEVLRIRPPVLMVPYQTVREWPITPNYTVPKGSMVIPTTYPALHD

PVAYPNPDNFDPDRWGTEGTAEKYPKNFMVFGNGPHHCLGKEYAVMHLMATLAEACMVLDWTHYRTDKSDDISIFATIYP

QDGCIMSFEPRKSPASIST*

>CYP509C14 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

40% to CYP509C4Rhizopus oryzae

fgeneshPB_pg.49__3

first amino acid is I =ATA instead of M = ATG

conserved location forM in CYP509C15 and CYP509C16

IDTITNIFLSFETFVKNVVDYLPKGSYVVAA

MCLFFCKKVYDFTAVPYELKKFPNIPFFYFVKSILSVESVENRTKRLVLPLLHKNNGFYVSRFPFYWTVFTTDPDAVQYL

LMKGEIFPKDTRFTSAVSKDSLIIRLFGSSNVAFISGEPLKHQCRTMNPAFRRTAPVNIFGRLIPDMFRLIDKSDGDILI

VNLLQRMTFDALGKALFGFDFKTMKEDNSAWMTAYSDAMSGVTAPVLNIIPSLEYILRYFYPNYTKAKNGVDKLNRLILE

LVNKKKQELEESMPQSCSNNNNGDTDGDAYDQEKDLLTLILEAEMKDNKSSGSDDLRANMATFIMAGHETTASSVSFCIY

HMVINKDVRDKARREALDILGYDDFISPPTFDECKRVNYINMVVKEALRLCTPGGLLFERIATEDVFLSGVFIPKGTRIS

VDIEALHKNPAIWKNPSVFDPERFSKGGEHEQHRGITWAPFSDGNRKCLGINFSMTEQQVILLMLLKHYEWDLSENSIHN

NGMVYDNVFSFAPKTLSIKFHKRH*

>CYP509C15 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

67% to CYP509C14 Phycomycesblakesleeanus

e_gw1.3.167.1

MDIVNSISLSFGPSAKRLVDYLPKGSYVAAAVV

LFLCKKVYDFTTVPDKLSHFPSVSYFSFLRSTLAVESIEDRTRRFILPLLHKNNGFYV(0)

SKFPFYWTVFVTEPLAVQYLLMKG(1)

EIFPKDSRF

MDALSKDSLAVRLFGNSNVVFSTGDLWKHQRKAMNPVFHRTVPVDLFGRMIPDIFKLIEKTDGNVLVDSFLQKITFDALG

RALFGFDFKTMGDDDSEWIAAYNDAMSGITAPILQVATSYERILRHFYPHYDKASKGIDKLNKLILDMVDEKKKKIEESK

GQPDAGHEKDFLTLILEAEMKENAISDPDDLRVSKTKCLSGHLSTASSIAFCIYHMAINKASLKDIQNKARREALDILGD

DDSMVPPTVAECKRVNYINMLVKEVLRLCSPFGAILERMTAEDVTLSGAFIPKGTLVSVDIEALHKNPAIWKNPTVFDPE

RFRKGGEYDQHKGITWAPFSDGNRKCLGVNFSMAEQQVVLLMLL

KHYEWDLPENSIHKNGIVYDSIFSFTPKSLSIKFHKRH*

>CYP509C16 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

67% to CYP509C14   Phycomyces blakesleeanus

fgeneshPB_pg.3__395revised

MDTINHISPSFESYITVFAKIVPKGFYVVAAVALFLCKKVYDFTAAPYKLRHFPKVSFFAFSKSIFSAESVEHRTKRLIS

PLLHKYKGFYIAKFPLYWTVFVTEPHAVQYVLMKGEIFPKKTRFMNTLNKDSLMIRLFGSSNIAFASGEIWKHQRKIMNP

AFHRTAPIELFGRMIPDMFRLIDKSNGNIMLADLLHRITFDAMGKALF(1)

GFDFKTAREENSEWTSAYNDAMSGI

SAPILNITPSLEHITRYLYPDYAKAKKGIDKLTELTLEMVNERKEKIQEAIGQPDDGREKDFLTLIIEAEMKEDKASGSG

GLRENLKAFLVAGHASTASSISFCIYHLAMNKDVQNKARKEALDILGDDANISTPTVNECKHITYINMIIKETLRLNAPF

GTLFERIATEDVTLSGVFIPKGTIISVDIETIHKNPAIWKSPTVFDPERFSKGGEHDQHEGITWAPFSDGNRKCLGINFS

MAEQQVILLMLLKHYEWDLSENSIHKNGIVYDGISLFTPRSLYIKFNKRH*

>CYP509C17 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

76% to CYP509C14   Phycomyces blakesleeanus

e_gw1.3.168.1

MDIINNISLSFKPFVKSLVDYLPKGSYVAVVVALFLCKKVYDYTTVPYELKHFPSI

PFFSFIKSVLSVESQEDRTKRLVFPLLHKKNGFYV(0)

SRFPLYWTVYTANPEAVQYILMKGEIFPKDTNFMNVLSRDSLTIRFFGSSNVAFISGEPWKHQRKTMNPAFRRTAPVDLFGRIVPD

MFRLIDKTDGNIFIFDLLQRVTFDALGKALFGFDFRATVEEDSAWRAAYIDTMAGVTAPILNIIPSLEYILRYFYPDYNK

ASKGVDKLNALILDMVNKKKKKLEESKDQPDGGQEKDLLTLILEAEMKENKSSESDDLRANMATFIMAGHETTASSVSHC

IYYMAMNKNVQNKARREALDILGDDSSTAPPTFDDCKRINYINMIVKEALRLSVTSGALMDRVATEDVTLAGEFIPKGTY

ISVDIEALHKNPTIWKNPTVFDPERFSKGGEHEQHRGITWAPFSDGNRKCLGVNFSMAEQQVLLLMLLKHYEWDLSENSI

HKNGIVYNSIFSFAPKTLSIKFHKRH*

>CYP509D1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

49% to CYP509B1 Rhizopus oryzaeover the last 405 aa region

fgeneshPB_pg.25__98

MLAKKVNGYAGFTLDAIQTIYFKYIFPTTGHQNRSSIIAYLTALILLYMAYSRAIKLVRPPKALSHIPHVPYFSYMSSLI

KKENTISRNKRFANKLFEDPESNGLYLRPNVKGWEVVVTRPEDAKKLLFKSDIFPKADFTSGIDGTILSKFSRGPNLLFT

TGAHWKAQRMVANPAFHRSAPVKLFGELTQKLFRVMDNRANKTVDITRLMEAWALDAIGLAGFDFDFNAIENPNSSWVRI

YERVDKALVHPFYSFFPKADKYLLWVLPNRKQAHTDLDIFLKMIDNVIIAKKKALHENKSNKHLENSEKDLLTLMLESEA

KGSTLSAKELRSNMCVFFAAGHETTANSLAYAIYFMAVNPDVQCKAREEAFKVLGDAQEDIMPTIEQTKSMDYINAVIKE

TLRSHSPALGTFARKATKDTELGGVLIPKDTMISMDIFNLHHNPNVWNNPDEFDPSRFLPGGEAEKQINNGFSWIPFGTG

ARQCIGMNFSLIEQRVMLSMMLRKFAWSLPEDSIHKDYLHTTNLVISSAKDLNINFEKLY

>CYP509E1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

43% to CYP509D1 Phycomyces blakesleeanus

e_gw1.11.60.1

MANSSFENLQSLFVDFVQPQLVQRKKQAGVIFSAVVLVLCYNTINKIIYPPKSLRHIPHV

NYIAYTRSQLRKQPASEQARELLLPLLAENNGFYA(0)

IPFLGKWSVQVANPIAIKTILLKF(1)

DMFPKANSLSKSQGTLAHRFIGGPNVFLLEGKKWRKQRMISNPAFSRSMPVDMFGRITINLFKYLDNIDPTIDVLDTMKK

WTLDTLGSAVFDFDFESLTKPNNEWTSIYYEINASLFVPIFNILPVLEKSFLWMFPKRKRVHDKMTKLKDMMRQVIIQKQ

ARLKENKPNPNLKDTEKDLLTLLLESENEGHEPMSEDELMSNLCAFFFAGHDTTANALSSALYHLAVQQDVQKKAREEVI

NVLGDEPEDVIPSIEDTRQLDYLNLIIKENMRINPPVGGPLDRLVTEDIVLDGVLLPKGTSVKVAVYSLHRNPLLWDSPE

EFRPERFLPGGEADKIEGMGYIPFSDGGRQCIGMNFSLVEQRVLLAMMLRKYTWKLSENTINKDELQVYAFNIMAPFDLK

ITLEKRY*

>CYP509F1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

51% to CYP509D1 Phycomycesblakesleeanus

e_gw1.20.54.1

MSSYQLSGYTGLTLNQLQVLYSKYLVPTLKDKAKSTTIASAVALLLGYLAFKKIQEPPHEIRHLPHISYFTMLRSILQGEPTSSLSKRLVIPIISCPENNGLYA (0)

RINGLGWTVHVASPEANKKMLMRTDIFPKSDPLPGTDGTLASRFLRGPNVLLLNGASWKTQRKLMNPAFHQSIPVNMFGG

LVQRLFSVMENETGPINVTNLMMRWTLDVIGQAGFDFDFHATDEPENEWVQVYNSISKGMGKPLWFFFPVLDRKFLWLFP

ERRKSHKSLDRFLEMLDGVIVKKRKALKENKRNPSMKDNEKDLLTLMLEGSQTGGAALTDRELQSNLCIFFFAGHDTTAN

ALSFIIYFFAKYPKIQQRAREEAHKILGDAPQDVIPTVEETKDMTYINMVIKETLRIKGPVTAIPARRAAEDTELEGVFI

PKGTLLTSDIYNMHHNPKIWNDPETFDPERFKAGGEADMLASSGMPWMPFGGGSRLCIGMNFSLAEQRVMISMLLRKYTW

RLPEDSIHKDELRTNNIGIMSAKILDIIFEKIY*

>CYP509F2 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

53% to CYP509F1, 53% toCYP509F3

e_gw1.20.55.1

MSISSLTAHTNYALDIIQNFCTNQDVQNLVKGNLPYISLAIVTTLAYITYEKVCRPPPS

LRHIPSIPYFKFMRSMLKGDTAAIHSKQVAIPLLSGKNHNGFFV(0)

RPNIRGWEVFVANPEAVKQIFNNIDIFPKSEPLSDSDGTLFGGFIAGPNLAFLSGAAWKTQRKLINPAFRQSMPVNFFALSTQRL

IQVVDKSNDQVNVTELMGRLTLDVIGKTGFGFDFHAIDNPGNEWVRIYNNITRGLYRPLWFLVPILERKFLWMFPERQKV

HQDLNKFLSMLDIIIDKKHKDMKEMKDLQLENNEKDILTLMIEGAAEGNGILSYKELQSNICVFFLAGHETTSNVLSFVL

YYLAVNPELQHKARDEALRILGDDPKEIFPTVEQTKHMEYITMVIKETLRLRPPAPSVLTRTCAADTVVAGVFIPKGAFI

APDIYDLHHNPDIWENPETFNPERFRSGGEADILTNNGMPWAPFGGGTRLCIGMNFSLTQQRVVLSMLLRKYTWTLPEDS

IYKDDLHTNAIGTLTAKKLEISFRKRY*

>CYP509F3 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

54% to CYP509F1 Phycomycesblakesleeanus

fgeneshPB_pg.20__100

MISNQVSECAKFTLGYIKDIYIKYFLPTFLTNKRGPAIASAAAIVLLYMAYDKLFSPPRAIRHIPYIPYFSFLKSLLQST

SIAEHNEAFVFPIINQKNTNGIFSHPGIFGWEVAVANPAAIKKIMLKIDAFPKADVIRTTEHTIISRFLRGPNLVFSNGS

SWKTQRKIANPAFHRSLPVKLFGDMAKKMFQVMDKQDSLVDITDLMERWTLDVIGEAGFGFRFNAVEDPTNNWVQLYKNI

SNGVNDPFWFFFTNLETNFLWLFPKRQRTHRELDTFLEMLDDVIVKKRADIASNNKNPHLQENEKDLLTLLIEASKEGSG

SLSDQELMSNLCAFFVAGHDTTANALSFTIYYLAKNPDIQQKAREEAISILGEDQDTIPTIEQTKEIDYINMVIKETLRM

NSPAVSAITRISTEDTELDGVFIPKGALVVPDIYALHHNPTIWHNPEEFNPERFVPGGEAERLSGAGMCWIPFGSGARQC

IGMNFSLAEQRVMLSLMLRKYTWSLPEDSIHKNMLQATKIGVMVAHDLNIVFKRRY*

>CYP509F4P Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

54% to CYP509F3 Phycomycesblakesleeanus

fgeneshPB_pg.20__103

SNV*IFFVATHDTTENAQSLAIYYLARNLEIQHRERKNVINISGEDKQDIIPSVDQTKGIIYIKMPIKATLGI

KEPILATLTQISLGVTVTVNLEIVL

>CYP5025A2 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

59% to CYP5025A1 Ustilago maydis

e_gw1.3.736.1

MSPKEEILLLDDSENILNSRASIQNQQLVYVDLKDHIKHTIPGPLNIPFVGSLYEMLPNITESWVRQFEK

YGPLVSVSILGTEMINTNNVDIAEIFSKESEYFTKRIKGSVLSEAKRVGLQGLFTTDTDETDWRLAHQLL

MPAFSSRAIKAYQIEMGRLVQQTIRIIEQIPQDGPVDIIDLSTKLTFETIGRIGFGYKFGLIDSLNSPSH

PFIGAMSYCLQQAVVRTQQARFVRSLPTEANRTFDRSLKLMHDIVDKVIQDRKRVPKSDTDNSESDSDSD

SNNNKDLLDFMLYARDENNLGLSDENMRDQVVTFLIAGHDTTANTVAWALYEISRSPEVEAKIVQEIVNA

GITAEELPTSEQISDLKYITQVIKETLRRYPPIRIISRICKKNCVIPGGYLIKKGSSVGVHLYSLHHNPE

IYPNPYRWNPDRWTPEEEQKRSRYSWMPFSTGPRACIGMAFSLQEMKTSLAMLLQKYRFIYDGPPIQFDP

KMATTKPYSFMMTVKPRTSFPQSNVSLK

>CYP5203A6 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

73% to CYP5203A2 Rhizopus oryzae

e_gw1.66.9.1

MSSKKITLPHSVSTYVGGAAVASLAILSAIYHDRAIFDETRKDILTEKGWPLVGSLPALIQGKDRLHDFLVESFYRLDRL

TLTMSALGIPRHIGTIDPANVEHILKHNFENYIKGPEFHSAMNDLFGDGIFNANGEDWKYQRKTASHIFNVKNFRDQFTD

VFVHEIDFMSDNILDKATETSELVDFHDLMYKFTLDSFILLGFGVRLNGLASKEVVPFAESFDIAQKNTFQRFVNPIWKV

TERIQSVVMPWRRSMNYHLNVVDTFAREVTEKRRVQLAKGEIHTDLLSRFMSARNTKGDLLNNTELRDIVLNFVIAGRDT

TAQALSWTLYMLLCHPRVEQKLLNEINENITDKVMHNSPELYETIKNMTYAHAVFYEVLRLYPSVPQNQKFALDNDIWPD

GTHVRKGDYILWSPYAQGRCEKVWGPDAKQFNPERWITPQGDLRRESQGQWPAFHAGPRVCLGQNLATLETLVAITFLIK

RYKFHLAPNQEITYQISLTLPMMNGIKVSVEKRQQ*

>CYP5203A7 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

57% to CYP5203A5 Rhizopus oryzae

57% to CYP5203A6

estExt_fgeneshPB_pg.C_550057

MDVVSNFISELRNKNLLSSNLGVVSTATIGVLLLLALKYPDRAIFTEHRDGVPHEKGLPLVGHLFGLLKNKYRIHDFQTD

KFVKLDTMTMTMSVLGIPRTIFTIDPRNVEHVLKTNFENYVKSTWFSECTVHLFGHGILNSNGAQWRWQRKAASLIFNVK

NFRDQFTDVFVDEVEILCNEILEKAVVSGEAVDLHEHIFRFTLDSFVYLGFGIQLNSLKTKEEVDFAASFDACQLYSLEK

FMNPMIEYTAIIDRILHPRKKTIKQHIETIDNFSSAVISKRRTELANGGTPNDLLSRFMGAKNEKDEPLSDKELKDISLN

FIIAGRDTTAVALTWVFYCLFNAPEVEKKLLEEITNCIKDEKKMDSAEIYETIKNMTYAHAVFYEVLRLYPPVPNNQKYA

LNDDILPDGTHVLKGDNVAWSPYGSSRNKKIWGPDAANFDPERWITLEGNLRRETQGRWSVFNGGPRVCLGQSFATLEAL

VVIIFLFKRYKFTMLPNQDITYETSLTLPMKNGLRVKVEKRV*

>CYP5203A8 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

63% to CYP5203A6 Phycomyces blakesleeanus

e_gw1.39.12.1

MPIDLFTDLSFANLLGGSLLLGIGTLACIYNDRAVFDTARKD

MRTLAGWPLVGSTPEIVMGLSRIHDYFISHNKHNELSTATTSAIGIPRHVHTSNPINIEHILKTNFENYIKGPEFHNALA

DVFGGGIFNANGEEWKFQRKTASNIFNIKNFRDHFTDIFVEELDFMVENIWDKAAESHEVIDFQEIMYKFTLDSFIRIGF

GAKINSLGNKSQVPFAVAFDSAQRLVMPRFVNLSWPITEAIQRTLFPWIPTVQTHLKVIDKFAHKVIEERREQLSRGEEH

GDILSRFMTARDLSDKKLGNTELRDVVLNFIIAGRDTTAQALSWTFYMLMCHPRVEKKLLDEINTMVPIEIMHDPVELYK

TVKNMNYAHAVFYEVLRLYPSVPLNQKYALNDDIWPDGTHIRKGDYILWAPYGQGRNEALWGPDAKMFKPERWILDDGRL

NREPSSKWTAFHGGPRACLGQNLATLEALVAIIFLVRRYKFSLSHAQDITYQVSLTLPMKYGMKVSVQRR

>CYP5203A9 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

63% to CYP5203A5Rhizopus oryzae

fgeneshPB_pg.37__72

MFAVSLKKIMNITHSGNEPADPWFASIGMISSASAIVLGLLALKYPDRAAFYERRKGIYHSRGWPILGATPSMIWNKEVI

HEYFLHQFEKSGVLTSAISSLGIPFTISTIDPRNIEHILKNNFENYVKGPAFDEATQDLLGHGIFNSNGERWKYQRKTAS

HIFNVKNFKDQFTDVFLNGFKIMSEKIFDPAVKENHSVDFHDAMYRFTLDSFILLGFGVHLKTLSTKEKVPFATSFDECQ

RNAIRRLTNPAWRIGETVRHCLAPWKKTIPQHVETINSFASDVIKNRRDQVAKGEEHGDLLSRFMKCRNEKGNLLDDTEL

RDTVLNFVIAGRDTTAQSLSWTFYNLMQNPAIEEKLLEEIREHITDSMEDDPPAMYEAIKHMTYAHAVFHETLRLHPSVP

NNQKYALNDDIWPDGTHIQKGDYVVWSPWAQGRCVSVWGEDAKIFKPERWITPEGDLRRESQGQWPAFHGGPRVCLGQNL

ATLQALIVIVFLLKRYKLSLVPGQEITYLVSLTLPMKNGMSVMVEKRQPAQ*

>CYP5203A10 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

79% to CYP5203A7 Phycomycesblakesleeanus

estExt_fgeneshPB_pg.C_310060

MEVVARFVADLRKKNILSSNLSVASTAAIGVLILLALRYPDRAIFTEHREGVPHDKGLPLVGQLFSLLKNKYRIHDFQAE

KFVKLDTMTMTMSVLGLPRGVMTIDPRNVEHVLKTNFENYVKSNWFNYCTEHLLGHGIFNANGAQWRWQRKAASLIFNVK

NFRDQFTDVFIDEIEILCSETLDKAVVSGDAVDIHDHMFRFTLDSFVYLGFGVQLNALKTKGEVTFAASFDACQLYSFEK

FMNPLIEFTSVIDRILHPRKKTMKQHIATVDQFAADVISKRRTELANGEVHTDLLSRFMSAKNENDEPLNDKELRDVVLN

FIIAGRDTTAQALSWTFYCLANAPEVEEKLFKEIKDYIKDEKKMDSTELYETIKNMTYSHAVFYEVLRLYPSVPNNQKYA

INDDVLPDGTKIRKGDTVSWSPYGTARSKNVWGLDAASFNPERWITPEGDLRRESQGKWSVFHGGPRVCLGQNLATLEAL

VAIIFLVKRYKFTMLPNQNITYETSLTHPMKNGLKVKVEKRA

>CYP5203A11 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

60% to CYP5203A6   Phycomyces blakesleeanus

estExt_Genewise1Plus.C_310065

MEGVLSLVENSNINILQNIGLVGGAAIAISLLAIAYPDRPVFTGIRSGIVYRAGAPIIGHLLE

LLKNKFQIHDFEIDFFQEIGTLTG(2)

AMPSLGLPFSIATIDPQNIEYILKTNFTNYVKGPHFGYATEHLLGHGIFNADGEQWRWQRKVASHIFNVKNFRDQFTDVFV

SKIDTMCESIFDKSIEEDLPIDFHDAMFRFTLDSFILLGFGVDLKALTTQGEVPFAVSFDKSQQYSFDRFTNPFIGITNT

FRSIFRPWEKSIQQHVQTIDDFASNVINQRREELARGEMPTDLLSRFMGAKNENGKDLSKTELRDIVLNFIIAGRDTTAQ

ALSWTFYNLALHPRVEEKLLREINEKIGNEKEHDAQQLYEIVKTMTYAHAVFHETLRLYPSVPENQKYALEDDIWPDGTP

VCKGDYVGWSPYAQARSTAVWGPDASCFNPERWITPEGELRRESQGQWPVFHGGPRVCLGQNLATLEALIAIAFLLKRYR

LSLLPGQVITYQTSLTLPMKNGMLVRVSKRQ

>CYP5204B1 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

47% to CYP5204A1 Rhizopus oryzae

fgeneshPB_pg.1__581

MQRIQDQIDAHYWIITNGQSWIKPVTAITLGIVLYKLFSPAPDPRKTTTIDPKLIPELVAYPLPIIGHVPTLSKGRNNFL

KECVDRYGPVFQLRIPGQNPYVVTGDIIPDIMKSSTKIVSFLEGIKTLIPATHVMELSYDHKYKAAPFNSRDKNPAIYPI

KQNFKSDKIHVFSERIQTGLHIVLKRDLDLKPGESKSVNMWDFLTNTVSQMSCPCFAGSVVGYDSELISSMAVLTQKIIR

AGIFLAVLPSWLGDAIVRRVFSVEKEIDITMRLLVPELTRTREEILNGTSEVTFSSMLLSLPLHDGSLRSIEETAFWFKS

IALSSIHTTSHISSFCLHELSCRPELVETLRNEINRLDSLNPETTATIPLLDSFLREVLRCNIDYLGHHSLALQDVQLRN

GQIIPKGSLIMSALLLAHEQGISGQATQDNHTKTCLPLDQFDAYRFVDAGEDTNATDVNLANLAFGLGAHACPGRYFAAN

EIKYMLSELIMRFNLSTPSGKRGENSVLLGTSVFPPKTPIVFTAI*

>CYP5205A3 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

60% to CYP5205A2Rhizopus oryzae

e_gw1.15.208.1 shortmodel

fgeneshPB_pg.15__173(best model)

in the CYP505 clan

MVVNTTSIIVAIKGANDLEEDGYIIQIGNGASVETVRNLAAEKLHLVGPTADIVLEDMEGNPLNEIDKIR

SQKVVYLNPKDTIKTVIPGPTKLPYIGNLYEMMPDMNAAFLRFFEKYGPVVDVNIIGNRVIATCDPEVAE

LFVKENEYFTKKIKAALKEIKLFAGQGLFTTDTSDPDWKLAHKLLMPAFSPRAIKVYQKEMGIIAQDTIR

IFEQYKPDEKVDILHWTTNLTFETIGKIGFGYEFGLLEKREAPPHPFIEAMAYCLKQSIARFLQAQFIKS

LPLEMNRRYDREVKLMHTIVDEVIKERKQSKDANDIEKDLLGFMLNARDEHHQGLSDENIRDQVVTFLIA

GHDTTANTLAWFLYEISRQPDIEAKILQEIANVGITHTDLPCSEQISKLKYIHMCLKETLRMHPPVRALG

KYCQQDCIIPGGYKIEAGTSVSVQLYGLHMNPKVYPDPYRFDPERWTPEEEQKRSKAAWLPFSTGPRACI

GMAFALQEAKTVIAMLLNRFKFCYDGPPVKYDPKQPTTKPVDLFMTIHDRTDFPESSINPEAYKPKESTG

LAKKMPKLSQSIEMATLKLPPITFLYGTQTGTSQDYASVLSNQARQFGFKNITLTDMDKWKVLKAGRYEG

PTGVNEDRELVVVCTATYNGMPPDNAEKFDKFLDKSDTQGNEKILHGLQYAVFGIGNKNWRTYQHFPIKV

DSRLDDLGADRFFISGKGDTDGDIDSDFNEWSAHFWSHTLSHYGLAISKDTSIVPSSSVNNEATQAAVVH

YVSPKDTEKWELGFNNRNGTHNAIVIENKELQQGDSGRSTRDIRIDVSKLNPVGDNDLLYLPGDHLEVMP

ENDPDIVEAVALGFGMILDSVFEIDQSSIVGLSPRSLAATIKGTCTIRNALTCYADLLSPPSRRILGYFA

AQLHKIAPETAKVFDSLTMPDVNNKDQYPEFTKKYRTLLDLQRGFPQVQKIEIGQFMAAVGVMQPRRYSI

ASSPHLFPKEAHLAVGVVDDVVNGKHYPGLASSFLAHQVPGESKAVLRANFKSSKGVFEMPPDAETPIIM

ISAGTGIAPFRGFLQERAYQHKHASGPVGECLVFFGCRREDQDRIYGDEFDEYVKEGVISGLHVAYSRQI

PPSARKYVQHQVLANANEIWRMMVPLDKSKKPAVVYICGSGAMSRDVRTTFRSMAISFGAAKDEEEADKF

IQKLIQSRQYNEDVWG*

>CYP5205A4 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

88% to CYP5205A3 Phycomycesblakesleeanus

e_gw1.15.206.1 shortmodel

fgeneshPB_pg.15__167(best model)

in the CYP505 clan

MSTNLTSLIVAVKGAQDLEEEGYIIQIGNGASVDTVRNLAAEKLDIVGSTANIVLEDAEGNTLDEIDRIR

SQKVVYLNTKDSIKSVIPGPTKLPYIGNLYEMMPDMNAGFLRFFEKYGPLIDVSILGTRMVATCDPDIAE

VFVKESEYFTKKIKTTLKEIKLFAGQGLFTTDTSDPDWKLAHKLLMPAFSPRAIKVYQNEMGIIAQETIR

ILEQYKPDEKVEILHWTTNLTFETIGKIGFGYEFGLLEKREAPPHPFIEAMGYCLKQSIVRFSQAQFMKS

LPLEMNRRYDREVNLMHSIVDKVIKDRKESEDATDIEKDLLGFMLNARDEHHQGLSDENIRDQVVTFLIA

GHDTTANTLAWFLYEISRQPEIEAKVLQEIANVGITHTELPSSEQISRLKYISMCLKETLRMHPPVRMLG

KYCQKDCILPGGYKIEADTPSVVHLYGLHMNPKVYPDPYNFDPERWTPEEEQKRSKAAWLPFSTGPRGCI

GMAFALQEAKTVIGMFLHRFKFCYDGPAVKYDPKQPTTKPVDLFMTIQNRTDFPEPSADAEVYEPKEASG

PTKEMPKLDRSIEMASVKLPPITFLYGSQTGTSQDYASVLSNQARQFGFKDVTLTDMDKWKVLDSGKYEG

PTGVNEDRELVVVCTATYNGMPPDNAERFDKFLDKSDAQGNERLLHGLQYAVFGIGNKNWRTYQYFPIKV

DSRLDDLGAERFFLSGKGDTDGDIDSDFNDWSAHFWSHTLSHYGLVISKDISVVPSSSTNKEASQAAVVH

YISPSDTEKWDLGFNNRNGTHNAIVIENKELQQGDSGRSTRDIRIDVTKLESVGDNDLLYLPGDHLEVMP

ENDPETVEAVALGFGMVLDSVFEIDQSSIVGLSPRSLAATIKGPCTIRNALTCYADLLSPPSRRILGYFA

AQLHKIAPETAEVFDSLTMPDVNNKDQYPEFIKKYRTLLDLQKGFPQVQKIEIGQFMAAVGVMQPRRYSI

ASSPHMFPKEAHLAVGVVDDVVNGKHYPGLASSFLAHQIPGESKTVLRAKFKSSKGVFEMPADAETPMIM

ISAGTGISPFRGFLQERAYQYKHASGPVGECLVFFGCRREDQDRIYGDEFDEYVKEGVISGLHVAYSRQI

PPSNRKYVQHQVLANANEIWRLLVPADETKKPAVVYICGSGAMSRDVRATFRSMAISFGAAKDEEEADKF

IQKLMQDHQYNEDVWG*

>CYP5206B1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

39% to CYP5206A6Rhizopus oryzae

gw1.3.485.1 revised

joined withfgeneshPB_pg.3__834 = N-term part

aa boundary betweenTDII and YLAD

MEKISKCIFESEYAFTVSKAIVASVAIKLAY

ILYSVFCKSQNDTDSWNREGFKEIPSPPEKYPYF(1)

GHILSLGNMPSLQVEKWHKEH(1)

GPIIHLNMGTAHWVFINNPQIAHEVLVKKGAVTSERHNHKFAYNMYSKNGS(2)

GIVFNRTGKKWKNSRNI (1)

ANSILSPQNINRITGGLEQSIDSSLETLKEESQKNEPVCLLPYLELIT

YGVIIKAVFGKDVASIDDPLLKKFIYISRGVMEHSGPKGNIASVLPGFSWISRLTSVEKD

MHAVVNIRDVSVKELLNDAVSGETDCLVKHAFSVKKENNLSDTDII(0)

YLADLIVGAGDTTASLLLWLFAILAEYQDVQKIICAEIDTFMMKHGRIPSFSDRLDL

PYTEAALLESARFRCVSNFGVPHCVTEDGN(2)

TVQIDEYCIPKNTLVVISMYAMHMNPDVYENPHKFMPERFFGRTNSWNTSSNGSIKDRDIYMFGWGR(2)

RICPGIHL (0)

TEIEVFTVCIRFLARCSIEPPIGKDGKPETIDLHELLGGGITFTPKEYKVMFIPRNDSLPI*

>CYP5206C1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

46% to CYP5206B1Phycomyces blakesleeanus

fgeneshPB_pg.10__160

MSSTLIQSLYNEENLLHITGFVAVGVAAKLVHTILVWANQGKGEDPWNREGFKKIPVPSGKYPYF(1)

GHVISMGKVPAFQVEKWHQESGPIIHITLGIQHWVIISDPFIAHELFSRNGIRASGRQRHFFTHEIYTDGGNRGILFND

TGKKWKNARGMALSILSPKFVNRFTAVIEDMADDTLRTLKETSDKEGAVWPMPLLKLGTFSAITRSLFGKTAESLGEETF

RTIAFLGEEVIRLAGPENDIDSFFPKFSWLTKLSSEKKAMENVVTKRDIIYRKLIKDAVEGDVDCLAKNAYALKDEYNLS

DMDLIIIMSDLFAAGGDPIALSIAWLYAILPHYPEIQKKMCDEIDQFIVKYGRIPSFSDREELPYVIAVMMENIRYRSIT

NFGIPHYATADIEFLEYFIPKGTVIMNSMHAMHMNPTVYEDAQKFMPERFLGCLKSWTTLSNGNIKDREMYAFGWGRRTC

PGSHFAEVEIFNMSVRTLARYTVEPALNTDGTPYYYDLDVVSTGLNLPPKEFRVRFVTRVDAPMIIPS*

>CYP5206C2 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

75% to CYP5206C1

gw1.1.533.1

MNSELIQSLYSEENILPVAGVIAAGVAAKLVHTLLVWAKKE

KNEDPWNKKGFKKISVPSGKYPYF(1)

GHSLTMTDNPTYKVEEWHQEC(1)

GPIIHLTLGVQHWVIVSDPYIAHELLSRNGVKASGRQRHYFTHEVYTDGGK(2)

RGVLFNNPGKKWKNSRGI (1)

ALSILSPKYVDRFTSVIEEMADDTVKVLKAASDKEGGVFPTPLLKLGTFSAITRSLFGK

TSEELGEETFKTIIFTAEELIRLAGPENDMASFFPHFSWIANCFAEKSSMINVVNNRDKI

YKKLIKDAIEGDVDCLAKSAYALKDEYGLSDIDLIVIM(1)

SDLFTAGGDPIALSLSWLFAVLPHHPEIQKRMCEEIDAFIIKHGRIPSFSDREEIPYIIAVMMENLRFRSITNFGIPHYATDD

IEFLGYFVPKGTVIMNSMHSMHMNPEVYENPYQFMPERFLGSLRSWTTLSRGSIEERDMYAFGWGR (2)

RTCPGSHF (0)

AEVEIFNLTVRTLARYTVEPTLNPDGTPHLYDWDVVYTGLNLPAKEYKVRFVTRTDTPVDIPL*

>CYP5206D1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

51% to CYP5206C1 Phycomyces blakesleeanus

estExt_Genewise1.C_260073

MENSLVDYISKNNYVKTAAKAAAVSLTASLVYYAIKEPKEDNWNRKDFKKIPGPSGYPFVGHMLSMGFTPSFQIEKWHEQ

YGPIVHINMGAQQWVIFNDPVLAHDLFVRNATKASDRRRHKFTNGMYSKGGRGIAFSQPGKKLKHTRAIALSILSPKYVD

RYLGVLENIASCTVELMKQETDRDGSVFPMPFIQMATFSAMIKSIFARPLHLDNDPVVKEIIYIMENELKFAGPAGDLGS

FFPNFAWANSLFQKKKKMEALVARRDELYKMLIKDALNSEEDCLVKQAYQMKEEYGLDDNDLIVMMSDMTSAGGDTTAIS

LSWLFAVLPHHPAVQKKICDEIDRFFAKFNRLPTFSDRDEFPYMCAVLRENIRFRSVTTFGIPHFTSEDIELQGYFIPKG

TVVACSMYAMHMNPDVYHDPKQFIPERFMGHTKTWSASANGPIDERDMYSFGWGRRICPGIYFAEVEEFNLCIHTLSRYT

VEPALDSDGYPVYPDLKHASSTSVVFAPAKYNVRLVEREDSPLKKQT

>CYP5206E1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

48% to CYP5206C1   Phycomyces blakesleeanus

fgeneshPB_pg.53__1

MDRSWFMNSFRENAMISVTGFIAVGLASKLVYEVFNWNYKAFLNKDEWNKKGFKKIPVPPKKYLYFGHMLSLSEDPTAQV

NQWLKTYGPILHLTMGVQHWVVIADPLLASEIFVRNASKSSGRQRHIFTHTIYADGAKGLSFTDSGKKWQKSRKIAQSML

SPERIEKFSGVIESITDNVVDELAKASNRDGSVCPLSFVKLSTFSIMLKSLFGKTVDSIDDPLLQDVICIADGIVKYISP

EQDIGSFIPSFSWITKFSKQRKGMANVVKLRNVVLPKLVSEAAHGEVDCLVKQAYALKEEYGLDDDDLVSMMSDLLAAGG

DPTSVSLTWLLLILAQYKDVQQRVCYEIDAFVEQNGRLPSFSDRENVPYIRAVLLECIRFRSITNFGIPRFVTEDIECLG

YFIPKNTVVMTSMHAMHMYPNNQTDADQFIPERFLGRTKTWAANSRANVQERDMYVFGWGRRICVGIHLVEVEVFNMCVR

ALGRYNIEIPMRQDGLVDDIISKGSVSRGLNCMPHDYTLKFIKRCNTPLDAHATKKD*

>CYP5206F1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

42% to CYP5206D1

estExt_fgeneshPB_pg.C_180202

MSIQQNFPTINYRHISPIVAASAVAASVCYFLFSKNTSHKGLNNIPSPKRNYPIFGHMFSLGKVPAEQIDEWHKELGPII

QLQVGSQVWVVVSNPHLAHELFTLRGSVTSARPSHFYFMDIYSRGGKGVVFVSATKSWKMARATAMGLLSFASVKRLSGV

FQKEADIMVDYMLKSTKKDGSVDSLKNLQLVAFNVIMSTCFGKRYNSIEDPEVVSMFAFINQHNIYARIEDDPGSFFPYL

SWILNLSNKKRKMDQFVRANRDKLFYELIKEARNGTSDCFVKSLYETDAKHSLNDLDIMIMMSDIVIAGSETTAVAMSWL

IAVTLNYPEIQTKIQAEIDAFTSEYGRLPEFSEAHKLPYLCSTQKESLRYRSITTFGLPHEASEDIDFKGYHIPKGAMLI

VSMKTLHMNSDKYKDPEKFIPERFMDKYTTISSAANGPILERDQYNFGWGRRICPGIHLAEMEMFEVFIRLFSSCDISPA

LDTNGNPIKVDLEGFRDYGLVDAPLPYGFRITERVYFEALFPKFISDVHFYSQ*

>CYP5206G1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

48% to CYP5206B1   Phycomyces blakesleeanus

estExt_fgeneshPB_pg.C_210147

MNIQLFLIKFGEESNKPIKNLVLTSLTITLVYTICSTIYKKYAKGNDPWNRKGFKKIPSPPERYPYIGHMYSLGDSPSTK

LDKWHVKHGPILHLYMGIQHWIFVSDPVIAHELMTRHGSVTSDRSNHTFAFEMFSKNGS(2)

GISFNKYGKKW

KDSRSAVLSILSVPYFDAVAGTIESVADNACGHLKKITENEGSVDPLEYIQMATYHTMIKAVLGKDVRSIDDTVLKDIIW

ITHKLLRYASPEGDIESFLPKFSWFREQTQLKKDMKSFVELRDKVYTDLIKEAVANNTECWITRAHARKSEYNLNDNDLI

VIASDLVSGGGENPCTSLMWLFAALSQYPDIHKRVCAEIDNFVTENGRIPNFLDRLDLPYTCALLKENLRFRNTSNFGIP

HRVTKDIEALGYFIPKDSLIVSSMHAMHMNSSVYNNPYEYMPERFLGHTKTWAAESYGKIDERFLFNFGWGRRICPGPYL

AEMTIFIVAVRILAQFHIEPTVDVNGKPEFVDLNSFSNKGFTFAPTEYKVKFVPRSNNNLPKDSV*

>CYP5206H1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

45% to CYP5206D1   Phycomyces blakesleeanus

estExt_fgeneshPB_pg.C_180113

MDKIDFQHLLSEKYMISTIGVIVFSMVVKAVYTLFKNRKNESTINQIRGETFHEIPSPKAGYPYVGQMFSMGDNPGAQIE

KWHRELGPVIRIKMGVQSWVLINDPLIAHDVFMRNGAKTSRRPIHSFTTGLYSKGGRGVSFNQPGKRWRSTRAVATTVLA

QKSIDKYTEFFEAIADKTVDRLISVSKKDGSVVPFPHFQLASFGVIIKLAVGKSVKSLDDPVFTKLLEMSDKTMMYGGIV

GDLGSFLPALKWINMFSSVHKDMVKMVESRDKNIAKLVNEAIEGENECLAQQMNILKAEYGLVDQDINVLFSDMITAGGD

TIAVALYWLFALLLQYSDVMKKMRDEIDSFIIEHKRIPRFSDRSELKYNIAVHRESLRFRAVTPFGLSHCATDDVISNGY

FIPKDTVILAGTDALHMNEKYFVEPKKFNPDRYIGIEKTMSASNNGPAEERDTYVFGWGRRICPGIYMAESEIFNLCTRI

LARCNVEPALNKDGTPAYPNLDKVVTMGIVSLPVEYKVRFVPRTDSPLDF*

>CYP5206J1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

46% to CYP5206F1Phycomyces blakesleeanus

fgeneshPB_pg.2__921

MPEFSLPSLSNEHFTLAAVAAAAAATLTATAFYAFSETKDPNLKHLKEIPEPKEKYPYIGHLISLGNRPGKQVTKWHNEL

GPIFKLRMGIQTWIMVSDPYIAHELFSTRGSLASSRPAHGYLRDICSAGGCGLIFAETSKKWHRTRSAAMALLSPKSVDP

IGQDMIEEADKLTKALIEGTAKHGCMSPSEDLYLVSYNVIMTVCFGLRAESVEDPDFKAMIDYIHQHGMYSGLSGDVGSF

LPILSLAAYISGIKKKQIDFVKVTRDQMFSRLMEKGINGEKDCFAKSLYEGKDKYGLDHQDILVLLGDIIFAGTDTTALT

TTWLLAILSNYPDVQRKIQAEIDDFVAKNGRLPLYSDRESFPYLAATQKEGLRLRSITEFGVPHEASEDINLRGYHVPKN

AILIGSLDAMHTDPLRYANPEKFIPERFLGYPESMSTLASGSIKKRDQYNFGWGRRLCPGIYMAETEMFYNLTRIFHRCN

MEPPLDVDGNPIIVNIDKFVDHGITSSPVPYKMRFIPRSEALF*

>CYP5206J2 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

85% to CYP5206J1 Phycomyces blakesleeanus

estExt_Genewise1Plus.C_100002

MPDFSLSSLRNENINLAVVAAAATAAVAATLTATAFYSFSETKDPNLKNLKEIPEPKEKYPFI(1)

GHLISLGNRPGKQVTKWHNEL(1)

GPIFKLRMGAQTWIMVSDPYLAHELFFTRGSLASSRPAHGYLRDIYSAGGC(2)

GLTFTVTSKKWHRSRSA (1)

AMALLAPKSVDPLGQDMIEEADKLTKSLLEDTAKHGSVSPSDGLYLVSYNVIMTVCFGLR

TESSDDPDFRSMVHYIHQHEIYGGVSGDVGSFLPILSLAAYISGTKKKQIDFVKKNRDEV

FSKLMEKGINGDKDCFVKSLHEDKAKYGLEHQDILVLL(1)

SDIIVAGTDTTALTTTWLLAIIANRPDIQRKIQAEIDDFVAKNGRLP

MYSDRESFPYLAATQKEGLRLRPITEFGVPHEASEDIDLRGYHVPKNSILIGSMDAMHTNPLRYARPEEFIPERFLSYPE

SMATLASGSIKKRDQYNFGWGRRLCPGIYMAETEMFYNMTRIFHRCNMEPPLDVDGKPIIVDIDAFIDHGITSSPVPYKM

RFVPRSEALF

>CYP5206K1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

47% to CYP5206C1  Phycomyces blakesleeanus

estExt_Genewise1Plus.C_10687

MDKKWLEVLQKEEHYLPLVGVVTVGLAARLVFALFSNICQNRKESERLKLEGYKEIPSPSGRYPFFGHMLSLGKAPSFKV

QKWHQQLGPIIRLDMGVQPWVLINDPYLAHELFVRNGINSSDRHKHSYAYWMYSKGGKGMIFNQPGKKWKSTRSAALSIL

APKNADQITESSVSITDNAIKLLKEDTDKEGAISPVRYMKMATYGTVFKAVFGKDVTSINDPTLNSLIHITERSIVYAGA

AGDIGAFFPSLSWINHLSSQKKAMNDIINERDKVLEVLIREAKDGDVKCLTKVAYSIKEELGLDEMDLTILLNDVFGAGG

DTTGMSLTWLFGILPQYPDVQKKICDEVDEFLVKYGSLPSFSSRDEFPYTTAVLRENLRFRSITNFGIPHFTANDVNISG

YHIPKDTILISSMHAMHMNSSIYEDPEKFIPERFLGTTKTWSASSSGSIKERDIYAFGWGR(2)

RICPGIHL (0)

AEMIVFNMCVRVLAQCTIEAPLDANGKPEFVDLNNIKTQGIIFGPQDYKVKFIKRDSSPFYHQL*

>CYP5206L1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

44% to CYP5206D1Phycomyces blakesleeanus

fgeneshPB_pg.6__211

also e_gw1.6.253.1(join)

MEHSRLRISVKEKLVNPLRRAVTAGVLGACLYKSYSLILENQENTSVWDRRGFKKIPSPSERYFYIGHFLSFREQPNIQL

QKWHKKYGPLIHLNMGAQHWIMISDPYIAHEIFVKNGAKTSGRHEHSFSYEKYAKAGSGIIFSHPGKKLNSALANAMRIL

SHQNVDQCIEEFEFTAETTLAQMMEATEREGSVDPSIYLKLGAYNTLIKAIFGRNISSINDPVFKDLLQVTQNVLQCSSP

HRDIKSLFPRLAWLECLIGNNKKKEKIVSSRDELYGRLLKEALDGDADCLAKEIYLLKEEQELEEKDLIVMLSK(1)

CDLIVAGETASTYMMWFFAIISQYTDIQKKMCEEIDKFISDTGRIPGFSDRDLL

PYLCCVLKENGRFRSPSNFGIPHTVNAD(1)

IRVSGYFIPKGTILMASMHAMHANEEVYTDPSRFLPERFNKSNKMWNTSTNGPIKERETYIFGWGR(2)

RTCPAIYF (0)

TEVEIFNMCVRTLARCSIEPEFDKEGNPMLVDLNLSNSLGLGSVPVPFKVRLVPR

TKFIFATTNFTT*

>CYP5206M1P Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

47% to CYP5206K1Phycomyces blakesleeanus

region in yellow doesnot match well and requires a frameshift

possible pseudogene

gw1.15.127.1 revised

MSHRLLKIKDSNHIIPIFGVVMLGLAAKYVYRLYSSSKQKQRLNDPWYKEGFKDIPSPSEKYPYI (1)

GHMLSLGDNPSFQLEKLHQEL(1)

GPIFRLQMGTQRWVLLSDPLLAHDLFVRNGINTSGRHPQKFSYKMYSKGGR(2)

GIVFSQPDKKWKNSRTV (1)

(?)MIFIYFKKKALMVLSSKFVDPLQKSIEDIAE &

HSREHGSVNPLLSLQMTTFNTILRAVFGKTTQSPDDPFIRQIIRDTEKGNLLVGSSGNLTS

FLPGLSWIEDLYHGNTREKLIEHRDQDLKKLIADAVDGDVDCLAKQMMTFKDEYGLDD

QDMLVIL (1)

SDLISAGEDTTSLSMSWLFGILPHYPDIQRKMCAEIDAIVTKYGRMPVFSDREEMPYIVAVLRENLRFRSSVNFSIPRYSTDD

IEFHEYFIPKDTVLITSMYTMHMRPENFSEPEKFIPERFLDDMRTWSASANGAIEDRDMYAFGWGR(2)

RVCPGIYL (0)

AEVEIFNVMVRTLSRHTIEPGLDSFGNLVYCSMDTLDTHGITFGPKDFTIRLVERKDSSLNYSS*

>CYP5206N1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

48% to CYP5206K1 Phycomycesblakesleeanus

e_gw1.25.82.1

MDNYLIEIISRKDYISLSIAAAAVGLAAKYSYNIYSNSRQNYINKDGFKNIPSPPGSYPYI(1)

GHMLTLNICPGEQVKRWHEEL(1)

GPIISLKMGAQPWVCISDQNIAHEIFVRNGVKSVNRPNHDFGYQVYSRGGK(2)

GLIFGSTDKAWKNARAA (1)

AQIILSPKYVDKFQSALVSTVDTVFKLMREEAEINGSVNPAKYFYMTTYSSILTAVFGKTVQSLDDPNLKDITFFVDHSNKYVTPIGALGSYLPHFEWIYRFTQHKAQMNAIVEVRDKLFTKLLHEAVSGDIDCLAKKLFMLKEEYNLDEMDLIILT (1)

GDLIGAGGETSGTSLTWLLAILSNYPEMQKKISDEIDSVIEKEGRIPTFSDRADMPFTTAV

LRENIRFRSCTNFGLPHYLEDDVEVFGYLIPKGTTLMTSMHAIHMNPDIYDEPEKFKPERFLNFTK

TWSAAANGGIKERDMFAFGWGR(2)

RVCPGIYF (0)

AEMEIFNMCVRIFSQCTVEPPYGLNGELKSVDMETIYSGGIIAAPLEYKIRFVTRANSLANTLKKSN*

>CYP5206P1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

52% to CYP5206C1 Phycomycesblakesleeanus

e_gw1.6.211.1

MYNALLPNVSAEKCALPLAGAIALGMAANITYKIFMWAQQKLKTQDFWCHPDYQKIPSPSKKYPYF(1)

GHMLSLKDTPGLQLQTWHRNL(1)

GPIIRLNMGVQHWVIINDPTIAHELFSRNGIKTSDRQKHKFTYDMYSKGGR(2)

GIPFNKTSKKWKNARNI (1)

AISILSPKYVESFTKVLDTIIDKAIKQLEDETEKNGSVSPMHSLKVVTFSAMLRS

LLGGSAKFIASETLDDIIKTTEVMFTYSGPEGDIDSFVPQLAWINKRSKHREEAEAIINH

RDSLYKRLIQDALEGDQDCLLKHIYSLRDEYELDETDLLVMT(1)

SDLISAGGDPTALSLAWLFAILSQNPGVQMKMQSEIDSFVARNGRTPGFSDREELPYTISVLLENIRFRSVTNFGVPHLTTQDVEF

LGFFIPKDTVVISSMHAMHMNENVYENADKFIPDRFSGSRKTWSISSNGSFEERDMYAFGWGR(2)

RICPGIHF (0)

AEVETFSVCVRTLARCNIEPIIGLDGKPEYVDLDSILPAGLNFSPKEYKVKFIKRG*

>CYP5208B1 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

49% to CYP5208A1 Rhizopus oryzae

fgeneshPB_pg.1__894

MESLYLHSSFPWATTKLSLFGTIVSAVALGTILYLVNPGKPRDTATQNLPPSAPNRLPILGHLLFFVKPDYLPELFRQWS

FIVGPVYTVYLGRKRWVILNSAAAVKDLIVDRGSIYSSRDLPDIMVNTLMNGVDKGGGFAFFPYGKQWRNLRRIAHSGLI

LKKIDLYQPILNDRRKVLLGNISRAIDDTKAISLTKYIEHFAMTNILTIAFADLCSFEPGDPKLHEVFSITERSATLLGP

SEQLVEFFPILKYILPNHIKKFQDLRQEILDFYGDLLREFKARLKKDPSKVKDCFMKEILAMDVLTDIQCMYFIALFVGA

GSETITSTLEWMLVLLANNPEFQDRAFAEIEQNVGLDRLPTAEDEHKLPFIQCIIHETLRIRSPAPISVPHSTSKDDVYN

GSFIPEGTTVVINVHAIHLEESKYPDAKKFLPDRHMDYVLDNEKKLFSSQSVEGRPHIGFSAGRRACVGIHLAERTLFTV

AAGILACFRIERETDELLNDYTPKDNRAATFAPTPYKVRLVHRHKGVSNLV*

>CYP5208C1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

46% to CYP5208B1Rhizopus oryzae

estExt_Genewise1Plus.C_60392

MDLQQKLTNDTVIAGVVGTVGAYLTYKLYKTISQPSEGNMPPIAPGRQPFVGHLLQMNQPIPPQKVF

SKWAKEVGPVYTVHMGTKRWIILNNTESVRDLIVNRGAIYSSRDLSPLLVDILFHG(1)

VENGGGLPFFPYGKEWRYLRRL(1)

THASLLKRKVDSYQHILEDRRLDFLKNLEEANKAGAEEGFCMNTQIEHLAMTTVLSIVY

GGELCYYDTNNPDLHAIYAQTSESTAVLQPSEQIREFLPIFSFLIPSRVKQYEGLVKRTD

TFHGNLLKQFKEKMAKNPDNVENCF

MKDMLTENSDITDLRLSDLAMVFVAAGSDTTSGTLQWLVAALANHPEVQDRAYADILENVGKDRLPGPEDEENLPYIKGI

LFETLRLHPPAPLSVPHCTTEDDVYGDWIIPKGTTIVMNLDSIHRDPTRYPQPDKFLPERHLEFIKNSKNQTSQSVEDRP

HLSFSSGRRMCVGIHLAERSLFTTATGLLATYRIERVSEELIDVSIQRDIYGVTSNPVPHNVRLVRRVPIA*

>CYP5209B1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

42% to CYP5209A1

estExt_fgeneshPB_pg.C_20032

MGSAVSILSATAFSWLISQLMTGVLWDGKNQDGTPKNPWAPSPSNQPYIWNAYDEVAERQYRAFTDWAKELGALISVKIG

QKRMVVLNSGSLVQESFVRLEQNNSARSIRDGVEVLMTDSGKTVFAAPFEIYWVRIRRAIAIIIGAAYIAKFDGLFSAQA

AKLSQGIQFEKSSKNGKPIDAEHLRQLVNLIAMDTSLAIVVGQTNTDPATMLLISEKCREIEAIQANKWYQYGHFINIIQ

STYSFLALMRKSLTAIAQRNDLLEVFLEWTSPFIANRGDQTVEVRTIAESLLTILPSKNDPEPAQLTADQVIVNLIHITL

HSYKNLSSALFTLIQRLASLPELQERIYAEVLSVKDKEGTLDDWPLIGALINESMRFEPPMRMYSHTSRVEHDILDGEDK

PFRIDDGTEIIANLDAIHFDEQYYAEPHTFNPDRFLVKEKKS(0)

FMPARDHLAFGAGRRKCQGAKASERMLAATVARLVKSYKLEGGDANVKVDYHSNIWSWTGRTETKGDEIKFISR*

>CYP5210A6 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

56% to CYP5210A5Rhizopus oryzae

e_gw1.4.106.1

MQQSIEAFKAIRLQDTLQATHQHWNVLLGLAEKYINQKVLSPLGINASVQRVLTGVGLASYFGYI

ISKYFIYRLYLNPVNKIPGPPVSWFPFTGNAIEIIKLE(0)

SGAPHKI

WKDKYGGIISYHGPWNSPRVLVTDAKLLKSILTTNEYDYIKAPQTSDFLRKFIGNGLLVAEGQEHRKQRKMLNPAFSVNT

IRYMVPMMAIPGVHLYKKWQKALKETDALEANVSHELSLATLDVIAIAGFGEEFEAVKLADTPERNKLGEAYMLIFSPEK

SIMRFLSFFFPILNKLPTQRNRKVNHDLRTLGTESRYLVERGKKRTEENDSKNSKDILSLMVKEIDEDGLGMTVSELQDQ

CLTFLAAGHETTSVALSWCLWLLAKNPGIQDELREEIRPLFRNLDTDHHIVPSYDDINSLKLLNNVCKETLRVIPPVPVT

NRVTRKEVILGDYILPKGTDVFISIIANHHSKQIWGDDAETFRPSRWDEELASKVSPYEYMPFLAGGRQCIGYKFALVEM

KILLAILIMDFKFSEKPGFEPKKEQLITLRPSPNMTLILEKA*

>CYP5211A2 Phycomyces blakesleeanus (Zygomycete fungus,Mucoromycotina)

62% to CYP5211A1 P450-25_var1 Rhizopus oryzae

fgeneshPB_pg.14__230

MNILSVLSPNISFYTTAFYVGVYSPLAGIIFLVLRYYYRRKNSILSSAPLIPTKNFWISYFGLVPPPDENETVDELSKFL

ISVGQDTQQSPLSVSWSIFGTPLVIVNSLKGIKDVLVYGQVKSKVQGRPSNVQRGNLIRLIQNHVFGGENINNSTGEGWR

WRRHVLLPPFQPRQLVPNLLPYVVKRAHELLDTFGKASDQGTALELDGVFQDLTMDVINFYLYGRSDLNYELVGGKENLK

HMHHKLGLGFQSLEAWFPFGINKTKWAQRAFGPSREHLKEFVKDSIVLAVEKQAEYKSDGQEFQSVTAAALSSGKYHEDQ

FDLINDLLSLTFAGYDTTAHTLAFCFSELARNPALQEELFLQVRAVLGPPPVLPESITADKLAKMPLVSAVYRETLRKYP

AVAFIPAHVNYDTNVDGVVVPAESEIWCNLRGIQMNPNIFPNPDKFDPSRWIRPGDTNDTLGGFDSMAADHTRESPIVTP

DQQYNFPDLSFTLGPHSCLGKNMVILELRTTIACTINEFTCSLKEGSVIDTKIVLTTKPRYGVWANFKRRSEIRI*

>CYP5311A1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

35% to CYP5213A1Rhizopus oryzae

fgeneshPB_pg.33__108

MIEYLKEFVDRIDSKTLENVKSLAFSKEGAIGISTAIILSSAYNYHKWSSRTISNGCPRVPHTLPFVGLTRVYRKDSKAF

CEEWHAKLGPVFRAHLFGKEVTVVSGHYVREVFLNKHFDFVKGVAKVFDTRLLTDSGSREDFTPEDLREIITKYLTPKLN

FYTKRVIKRLKQGVESSLGDKDSIELDNLYPFVQHLVVNASASIFVGEELSQNKLLIDSFKNMVRDVGKEIKQNPWFEPF

PTINKFRMWLIGKTSPVIKNHKEQLLNAIKPEVEYRLSQARSNPDWKKPTDMLQDLLENSKPPAHLDLMDHLVHIITFLI

FVALHTTSENTTVLLYRMLENPAIVDELVIEQQEVLEQEGLDANCGSEVFTRDILKKFVKLDSVCRETFRMKNQYISLPH

EYDGKVPLTLSNGAVINPGEDVLIDVWTNHQYTEDANDVEDADQFKAFRFVDQDKQSTKVGEDYLFFGMGRRACPGRWFA

IQEVQTILAMLVREYKFMPKGPIVFPTEERSPIPTGKCIIQRK*

>CYP5311A2 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

81% to CYP5311A1

fgeneshPB_pg.45__88

MIEYLKELVDRMNSKTLANLKRLVFSKKGGIGIIMAIILSSVYNYHKWSSRTISNGCPRVPHTLPFFGLTKVYRKDSKAF

CEEWHAKLGPVFRAHLFGKEVTVVSGHYVREVFLNKHFDFIKGIVKVFDTRLLTDNGSREDFPPEDLREIITKYLTPKLN

IYTRRLIKQLKQDVENILGLIEFDNLYPFVQHLIVNASASIFLGEENSQNKLLIDSIKNMVRLVGSEVKQNPWIEPFSPI

KKIRMWVIGKTSPVIRSYKEQLINAIKPVVEYRLSEARRNPDWKKPTDVLQDLLENSKPPAHMDLMDYLVCIITILIFVA

LHSTIENTTVLLYRILENPEIMDELDLEQREVIEQEGLDTNCGSELFTRDILKKFTKLDSVCRETFRMKNQYITLPHEYD

GKVPLTLSNGAVINPGDDVLIDVWTNHRYKKETTSVKDADEFRPFRFVNQNKQSTKVGEDYLFFGMGRHACPGRWFAMQE

IQAITAILVRECKFIPKGPIIFPTAERSPIPTGRYINFCKNGFNKKFLNRTIKHAILYNSIEAFCIKFIFAKVDTLQSLG

VLIDLFAEFNFFQKLKHLDGSHRRVLKYYEIFLADVQIWIYR*

>CYP5311A3 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

55% to CYP5311A1 Phycomycesblakesleeanus

e_gw1.10.197.1

MLQYVKELVDRLDNKKLEQIKEVATSKEGVIGITASIVLATAYSYHKHTTRP(0)

VSNGSPLVPYTFPLVGSTMEYRKSPEAFCRKWHEKLGPVFRAHLFGK(0)

EVTVIGGHEVKEVFLDKHFDFFAALDK(0)

TFNLRLLTGGGRPEDFKADPIRKIVTKYLTPNLDFYTDRVVKRVNRANLVNT(2)

CVIIDSKEFFSVYPLVQHMVAKASASIFVGENLANNAL

LIDSFKNMVIDVGSELIPIPWIEPFPTLVYIRMW(2)

YFGKNAPSTRRHKQQLRAAIGPELEDRIHQMNTNPEWKRP(0)

NDILQDIIEKEEHPSDIPYIDFIITMITAIIFASIHTTSEAATTVLYRILDNPEVIEALRE

EQDQVFRKEGIDENAGAEVFTRSIIKQFVKLDSVCR

ESSRLKNEFIKLPHAYEGTTPLKLSNGAIIKP(1)

GEEVLIDIWKNHRDPEIQNDLKDVEQFKPFRFVSSEKQATKVGEDFLVFGMGRHACPGRW

FAMQEVETIISMIIREYDIKATTPVTYPKSERGMPGGKFRLEKRKL*

>CYP5312A1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

28% to CYP5311A1Phycomyces blakesleeanus

estExt_fgeneshPB_pg.C_150247

MTDTTISRSIETVLKIVNDISPRIASAYQTTTRNELILVGGAALFSVYNLVQYIKDKSTAKYYLPPRVPFALPLVGHSLY

LLWDSNQFIDWCAKKYGEVYEISIMGKIVTVASGLSGQEALKADTDFLSLEEGVIKDVLYLQYAIDKTTFEIGFYVNPVV

AKAVISHKKVPRHTEGILKGMDAGFKNLLPATDSFVLKDPNHFFQRLIAHMSVPTLIGKEVGDNATVIESFAAFTADVTD

NIPIFMSVPVVFHRFITPYLQSFKRHRVIMSKFIAPVVESRRQAADAAKLKGETYKAEDDFLQGLLEFVKPDGTNYTADQ

VAQATLLVAFASVHTTATNLAFCAYWIVSRPDIKQAILEEIESVVGKDINTELTYEHFENMPYLDKVIRESVRQGADVLA

VGKKCLKTFTFSNGYQVPAGRVVETTNRRLNMGLSANRVDISEMDPLESGSRPPTTASRDYVTFGMGKHLCPGRFFAVLE

IKLTIIQLLRQYDITPSTSSPAHPVKLIGGFMATNSSAPIRFTKRKL*

>CYP5313A1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

55% to CYP5313A2 Phycomycesblakesleeanus

33% to CYP576A3Aspergillus terreus

fgeneshPB_pg.2__19revised with gc boundary after PLLNN

MNHIEAFSKYFIFTFPENINFTQVGKIAATGLKIQSAFFSPLGDIPGPFSKRFFEGSYFSKKKPGKRDYHNKYGHLVRIG

PSKISVSDKDIIKQIMVTEDFEKSSIYSKMKGKDEWNT

FNMIDKDTHKQRRRLVSSAFSIKYIKSLEPLFESVTESFVKR

INLDTERTKEGDEFGVIDIWQLLRCLTLDVIGETAFGGTFNMLENDDHAVSRAIVKLTRGVEF(0)

SILHPWLTNLILMIRPEGQPLLNN(0)

FVSNIISERTHSKEKRNDILQILVDTQHAKNTKDRMNSRQIASETGLFLIAGSETTSNTIGFALIEMCRNTDVLTELYAEIDKVDLD

EGRILFHQEQIKNLPYLNAVIKETMRLNHVASMGLERMVTHDIIIKENIVVPKGTHVRCCLHVAQIHPDYWPEPLTFNPN

RWLKNADPEPCTDAFFPFSLGSRNCIGKDFSMNEMRLVLATLIKNYEIKPISEQMKASEEKHHFLTLTIESGSFKVRMKP

RAT*

>CYP5313A2 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

56% to CYP5313A3 Phycomycesblakesleeanus

fgeneshPB_pg.5__74

MNNLTKTVQLLSVKHYKSAFTNLVKSVVLLLCLQAISKKMYWAFFGPLSRIPGPFAEKFISGSELFFGTKPGQRFKKVIT

YHQKYGHVVRIGPKAISVSDKDIIKQVLVTEDFEKGPSYTRFQNGTSASMLDTTDKIFHKQRAISPAFSIKYIKSLEPLF

ETVTDDFIKRINREIAANKQDTDFATVDIWWLLRCLAFDIIGETSLGGTFNMLSNNDHIMLVSVGKLLRGIDF(0)

VINHPWIAKLILLRK

VKKNPDLVNFVTNLIKERVKNKQRRDDIIQILINTQQAPKEEDRLSSDDIVVETTLFLVAGAETTSNTIGFS

MIELCRNKSALNRLRQEIDAIELEDGKQVFHQCQLRNLPYLNAVINETMRLNTIPSNGLERLVTRDIVIKGDIYVPSGTT

VRCYTGIAQTHPDYWSDPMEFKPERWLPNADPKPDMGAYNPFSAGSRNCVGKEFAMNEMRLAISTIIKHYDIEPISEEME

VARETRYFITLTLASSSFKIRMKHRNS

>CYP5313A3 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

56% to CYP5313A2   Phycomyces blakesleeanus

fgeneshPB_pg.14__210

MNFQREIRHGLATRLCQKPEVIQIGKITIGLFFLYHISNRFYYAFIGPLSKIPGPWIEKIFPELGGLFGKHHSQRFITLK

KYHEKYGHIVRIGPTEISISDKDMLKQILVTEDLSKGLGYKRFQNGGRANIFDTTDKGFHRQR(0)

RRLVSPAFSIKYINSLEPLIESVTESLIARINRDIEGTKSSKGFGQIDIWRLFQLFSLDVVGETSFGGTFNALEDS

NHVVPVTISKLLRTLGFVS (0)

VVNYPWIVKLLRIKK

TKKTPRLVAFATDIVLGRLEKGDRRNDILQIMIDTQKAAKEEDRLSTD

DIISEITMFLVAGTETISGTMGFVFIELCRHKNVWLKLRDEIDGIVLEEGKKFPCQSQLKDLPYLNAVINETMRLNSIVS

NGIDRIATRDIFMKGDVLVPEGTTVRCSPWIAQTHPDYWPEPLSFNPDRWLPGTDSKPNMEAYFPFSTGSRNCIGKTLAI

NEMRLVISALIKNFDLDDIPKEMMAANEKRYYITLTLESGSFKLLLKPRNACPQL*

>CYP5313A4 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

55% to CYP5313A2   Phycomyces blakesleeanus

fgeneshPB_pg.2__20

MDKLEKSSHNLIFYIQHNVPIIQLGKAAISLLAMYYMSNKIKCALFDPLNNIPGPFYRRFFPHFGNIGLKSGERFRLTEY

YHRKYGHVVRVGPDALSVSDKDIIKQILVIDDFEKGPAYSRLQNGGEASMLDLISKDLHRRRRRAISPAFSTKYIKSLEP

FFASSVESLIKKIDSEIEKTKGNEEFGTIDIWHITKCMALDVIGETAFGGTFNMIDNDDHIVPSTILKLMKILEFVISYP

WVTKIPFLKRNKRIPQLSNFVKNLIKSRLESNVKRDDILQILVDTMEAEDKRDRLTEYEIITETILFLVAGSETTSNTIG

FALIEMCRNPDSLEKLFIEIDGVDLDGGSNVFNQNQLKNLPYLNAIIKETMRLNTMPANGLERMVTRDIILKGDIFVPKG

TKVRCNISVAQVHPEYWSNPSAFKPERWLEDSNEKASPSAYFPFSAGSRNCIGKDFALNEMRLVLATLIKHYYIEPIPEQ

MVAAMEKRHYLTLTIASSSFKIRMKRRFS*

>CYP5313B1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

46% to CYP5313A2 Phycomycesblakesleeanus

estExt_fgeneshPB_pg.C_50177

MNYSSILNILKAPVWYMVSHLPEENTLGQFGKLAAVSLAVYYASDKLYCAFFGPLSKIPGPFIDKFFYEPEGVLFSHIGK

KSIRYLDYHEKYGPVIRVGPKTISISDKTMLKQVLVTEDLEKGPVYSILQNPGNESMFDARDKTYHKNN(0)

RRMYSPAFSVKYINSIEPIMRSCTEIMAQKINSDIERTKGDGEYGTVDVWYLFQCLALDVIGESGFG

SNFNTVGDEDHPIPQCLKKNMN(1)

GGLMTITPLATHMLEIVKDRVEGRTKRREDILQIMIDNERA

KNGDKPLDIMRIARSTVMFVIVGSETTSNTTGFAIIELCRSPDTMKRLRDEIDAIQLPEGETTFHQDQLKNLPYLNAVLN

ETLRLDSITASGLERIATQDSVLAGTVFVPKGTIVNCNILSAHRRADYWPEPLAFKPERWLPDYEHKPALDAYHPFSSGS

RNCIGKSYALNEMRHTIAMIIKNYEIKPIPEEMEASKNICGFLTLTVRSGSFKIQLKPRSA*

>CYP5314A1 Phycomycesblakesleeanus (Zygomycete fungus, Mucoromycotina)

29% to CYP530A11  Fusarium oxysporum

estExt_fgeneshPB_pg.C_130264

MADYLSILSSEVQRFSTDHPQVAAAGALGAMALSLLYTGFGSKKASPDGAIPLPQPRGRMPVIGHLWSIVKAPHIKMAEY

SKELGPIYQMSFGGRDYIVLNSPEVIKGVLETNGSKNSDRVPSTVVLLMSDNGLMWAWGADNSYLRKSRRLFHNGFINKT

NWEKNFPELYNNQVGRILRKIRDHGTADEGYSLMDVCYLYTINVSMSVLFNRDYESCDDPDFLEMNAVAHDFSDLGVALQ

IECPKILEFAISPFMNNAKRLQNKFRSVFSKYIKELREKRAKGIIVKCLISDILDVQEKEQLTEPELDNFAAASMVGATD

TTALSLANLLVTLANYPEVQLKVQKELDTVVGIERHPTEQDLINLPYTKAVITECLRFCPPVWISLPHMSRERQVYNGYE

IPANTGILQNIYATNMSPELFDKPEEFNPDRYYKEELLKPNQRDHWSFGNGRRTCPGNIFAEKSLQYFTARILWAYTLTT

PLDKNGNPIPVPMTDIKDPISQPAHCNIRYVPRRANVGSFV*